data_5CMZ
# 
_entry.id   5CMZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.397 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   5CMZ         pdb_00005cmz 10.2210/pdb5cmz/pdb 
WWPDB D_1000211900 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-09-16 
2 'Structure model' 1 1 2024-10-30 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'      
2 2 'Structure model' 'Database references'  
3 2 'Structure model' 'Derived calculations' 
4 2 'Structure model' 'Structure summary'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' chem_comp_atom            
2 2 'Structure model' chem_comp_bond            
3 2 'Structure model' database_2                
4 2 'Structure model' pdbx_entry_details        
5 2 'Structure model' pdbx_modification_feature 
6 2 'Structure model' pdbx_struct_oper_list     
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_database_2.pdbx_DOI'                      
2 2 'Structure model' '_database_2.pdbx_database_accession'       
3 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5CMZ 
_pdbx_database_status.recvd_initial_deposition_date   2015-07-17 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 5CMU unspecified 
PDB . 5CN0 unspecified 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhu, Y.'   1 
'Ye, S.'    2 
'Zhang, R.' 3 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Sci Rep' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2045-2322 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            5 
_citation.language                  ? 
_citation.page_first                13028 
_citation.page_last                 13028 
_citation.title                     
;Improved Pharmacological and Structural Properties of HIV Fusion Inhibitor AP3 over Enfuvirtide: Highlighting Advantages of Artificial Peptide Strategy.
;
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/srep13028 
_citation.pdbx_database_id_PubMed   26286358 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Zhu, X.'   1  ? 
primary 'Zhu, Y.'   2  ? 
primary 'Ye, S.'    3  ? 
primary 'Wang, Q.'  4  ? 
primary 'Xu, W.'    5  ? 
primary 'Su, S.'    6  ? 
primary 'Sun, Z.'   7  ? 
primary 'Yu, F.'    8  ? 
primary 'Liu, Q.'   9  ? 
primary 'Wang, C.'  10 ? 
primary 'Zhang, T.' 11 ? 
primary 'Zhang, Z.' 12 ? 
primary 'Zhang, X.' 13 ? 
primary 'Xu, J.'    14 ? 
primary 'Du, L.'    15 ? 
primary 'Liu, K.'   16 ? 
primary 'Lu, L.'    17 ? 
primary 'Zhang, R.' 18 ? 
primary 'Jiang, S.' 19 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Envelope glycoprotein'              5230.056 2  ? ? 'UNP RESIDUES 35-79' ? 
2 polymer     syn 'Artificial HIV entry inhibitor AP3' 4682.471 2  ? ? ?                    ? 
3 non-polymer syn 'SULFATE ION'                        96.063   1  ? ? ?                    ? 
4 non-polymer syn 1,2-ETHANEDIOL                       62.068   1  ? ? ?                    ? 
5 non-polymer nat '1-ETHOXY-2-(2-ETHOXYETHOXY)ETHANE'  162.227  1  ? ? ?                    ? 
6 water       nat water                                18.015   37 ? ? ?                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        go41 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no yes 'SGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQ(NH2)' SGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQX A,C 
? 
2 'polypeptide(L)' no yes '(ACE)MTWEEWDKKIEELIKKSEELIKKIEEQIKKQEESIKK'         XMTWEEWDKKIEELIKKSEELIKKIEEQIKKQEESIKK         B,D 
? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'SULFATE ION'                       SO4 
4 1,2-ETHANEDIOL                      EDO 
5 '1-ETHOXY-2-(2-ETHOXYETHOXY)ETHANE' P4G 
6 water                               HOH 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  SER n 
1 2  GLY n 
1 3  ILE n 
1 4  VAL n 
1 5  GLN n 
1 6  GLN n 
1 7  GLN n 
1 8  ASN n 
1 9  ASN n 
1 10 LEU n 
1 11 LEU n 
1 12 ARG n 
1 13 ALA n 
1 14 ILE n 
1 15 GLU n 
1 16 ALA n 
1 17 GLN n 
1 18 GLN n 
1 19 HIS n 
1 20 LEU n 
1 21 LEU n 
1 22 GLN n 
1 23 LEU n 
1 24 THR n 
1 25 VAL n 
1 26 TRP n 
1 27 GLY n 
1 28 ILE n 
1 29 LYS n 
1 30 GLN n 
1 31 LEU n 
1 32 GLN n 
1 33 ALA n 
1 34 ARG n 
1 35 ILE n 
1 36 LEU n 
1 37 ALA n 
1 38 VAL n 
1 39 GLU n 
1 40 ARG n 
1 41 TYR n 
1 42 LEU n 
1 43 LYS n 
1 44 ASP n 
1 45 GLN n 
1 46 NH2 n 
2 1  ACE n 
2 2  MET n 
2 3  THR n 
2 4  TRP n 
2 5  GLU n 
2 6  GLU n 
2 7  TRP n 
2 8  ASP n 
2 9  LYS n 
2 10 LYS n 
2 11 ILE n 
2 12 GLU n 
2 13 GLU n 
2 14 LEU n 
2 15 ILE n 
2 16 LYS n 
2 17 LYS n 
2 18 SER n 
2 19 GLU n 
2 20 GLU n 
2 21 LEU n 
2 22 ILE n 
2 23 LYS n 
2 24 LYS n 
2 25 ILE n 
2 26 GLU n 
2 27 GLU n 
2 28 GLN n 
2 29 ILE n 
2 30 LYS n 
2 31 LYS n 
2 32 GLN n 
2 33 GLU n 
2 34 GLU n 
2 35 SER n 
2 36 ILE n 
2 37 LYS n 
2 38 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   46 
_entity_src_gen.gene_src_common_name               HIV1 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 env 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Human immunodeficiency virus 1' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     11676 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       38 
_pdbx_entity_src_syn.organism_scientific    'synthetic construct' 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       32630 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACE non-polymer         . 'ACETYL GROUP'                      ?                 'C2 H4 O'        44.053  
ALA 'L-peptide linking' y ALANINE                             ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                            ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                          ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                     ?                 'C4 H7 N O4'     133.103 
EDO non-polymer         . 1,2-ETHANEDIOL                      'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
GLN 'L-peptide linking' y GLUTAMINE                           ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                     ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                             ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                           ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                               ?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                          ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                             ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                              ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                          ?                 'C5 H11 N O2 S'  149.211 
NH2 non-polymer         . 'AMINO GROUP'                       ?                 'H2 N'           16.023  
P4G non-polymer         . '1-ETHOXY-2-(2-ETHOXYETHOXY)ETHANE' ?                 'C8 H18 O3'      162.227 
SER 'L-peptide linking' y SERINE                              ?                 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'                       ?                 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE                           ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                          ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                            ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                              ?                 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  SER 1  1   ?   ?   ?   A . n 
A 1 2  GLY 2  2   ?   ?   ?   A . n 
A 1 3  ILE 3  3   3   ILE ILE A . n 
A 1 4  VAL 4  4   4   VAL VAL A . n 
A 1 5  GLN 5  5   5   GLN GLN A . n 
A 1 6  GLN 6  6   6   GLN GLN A . n 
A 1 7  GLN 7  7   7   GLN GLN A . n 
A 1 8  ASN 8  8   8   ASN ASN A . n 
A 1 9  ASN 9  9   9   ASN ASN A . n 
A 1 10 LEU 10 10  10  LEU LEU A . n 
A 1 11 LEU 11 11  11  LEU LEU A . n 
A 1 12 ARG 12 12  12  ARG ARG A . n 
A 1 13 ALA 13 13  13  ALA ALA A . n 
A 1 14 ILE 14 14  14  ILE ILE A . n 
A 1 15 GLU 15 15  15  GLU GLU A . n 
A 1 16 ALA 16 16  16  ALA ALA A . n 
A 1 17 GLN 17 17  17  GLN GLN A . n 
A 1 18 GLN 18 18  18  GLN GLN A . n 
A 1 19 HIS 19 19  19  HIS HIS A . n 
A 1 20 LEU 20 20  20  LEU LEU A . n 
A 1 21 LEU 21 21  21  LEU LEU A . n 
A 1 22 GLN 22 22  22  GLN GLN A . n 
A 1 23 LEU 23 23  23  LEU LEU A . n 
A 1 24 THR 24 24  24  THR THR A . n 
A 1 25 VAL 25 25  25  VAL VAL A . n 
A 1 26 TRP 26 26  26  TRP TRP A . n 
A 1 27 GLY 27 27  27  GLY GLY A . n 
A 1 28 ILE 28 28  28  ILE ILE A . n 
A 1 29 LYS 29 29  29  LYS LYS A . n 
A 1 30 GLN 30 30  30  GLN GLN A . n 
A 1 31 LEU 31 31  31  LEU LEU A . n 
A 1 32 GLN 32 32  32  GLN GLN A . n 
A 1 33 ALA 33 33  33  ALA ALA A . n 
A 1 34 ARG 34 34  34  ARG ARG A . n 
A 1 35 ILE 35 35  35  ILE ILE A . n 
A 1 36 LEU 36 36  36  LEU LEU A . n 
A 1 37 ALA 37 37  37  ALA ALA A . n 
A 1 38 VAL 38 38  38  VAL VAL A . n 
A 1 39 GLU 39 39  39  GLU GLU A . n 
A 1 40 ARG 40 40  40  ARG ARG A . n 
A 1 41 TYR 41 41  41  TYR TYR A . n 
A 1 42 LEU 42 42  42  LEU LEU A . n 
A 1 43 LYS 43 43  43  LYS LYS A . n 
A 1 44 ASP 44 44  44  ASP ASP A . n 
A 1 45 GLN 45 45  45  GLN GLN A . n 
A 1 46 NH2 46 100 100 NH2 NH2 A . n 
B 2 1  ACE 1  40  40  ACE ACE B . n 
B 2 2  MET 2  41  41  MET MET B . n 
B 2 3  THR 3  42  42  THR THR B . n 
B 2 4  TRP 4  43  43  TRP TRP B . n 
B 2 5  GLU 5  44  44  GLU GLU B . n 
B 2 6  GLU 6  45  45  GLU GLU B . n 
B 2 7  TRP 7  46  46  TRP TRP B . n 
B 2 8  ASP 8  47  47  ASP ASP B . n 
B 2 9  LYS 9  48  48  LYS LYS B . n 
B 2 10 LYS 10 49  49  LYS LYS B . n 
B 2 11 ILE 11 50  50  ILE ILE B . n 
B 2 12 GLU 12 51  51  GLU GLU B . n 
B 2 13 GLU 13 52  52  GLU GLU B . n 
B 2 14 LEU 14 53  53  LEU LEU B . n 
B 2 15 ILE 15 54  54  ILE ILE B . n 
B 2 16 LYS 16 55  55  LYS LYS B . n 
B 2 17 LYS 17 56  56  LYS LYS B . n 
B 2 18 SER 18 57  57  SER SER B . n 
B 2 19 GLU 19 58  58  GLU GLU B . n 
B 2 20 GLU 20 59  59  GLU GLU B . n 
B 2 21 LEU 21 60  60  LEU LEU B . n 
B 2 22 ILE 22 61  61  ILE ILE B . n 
B 2 23 LYS 23 62  62  LYS LYS B . n 
B 2 24 LYS 24 63  63  LYS LYS B . n 
B 2 25 ILE 25 64  64  ILE ILE B . n 
B 2 26 GLU 26 65  65  GLU GLU B . n 
B 2 27 GLU 27 66  66  GLU GLU B . n 
B 2 28 GLN 28 67  67  GLN GLN B . n 
B 2 29 ILE 29 68  68  ILE ILE B . n 
B 2 30 LYS 30 69  69  LYS LYS B . n 
B 2 31 LYS 31 70  70  LYS LYS B . n 
B 2 32 GLN 32 71  71  GLN GLN B . n 
B 2 33 GLU 33 72  72  GLU GLU B . n 
B 2 34 GLU 34 73  ?   ?   ?   B . n 
B 2 35 SER 35 74  ?   ?   ?   B . n 
B 2 36 ILE 36 75  ?   ?   ?   B . n 
B 2 37 LYS 37 76  ?   ?   ?   B . n 
B 2 38 LYS 38 77  ?   ?   ?   B . n 
C 1 1  SER 1  1   1   SER SER C . n 
C 1 2  GLY 2  2   2   GLY GLY C . n 
C 1 3  ILE 3  3   3   ILE ILE C . n 
C 1 4  VAL 4  4   4   VAL VAL C . n 
C 1 5  GLN 5  5   5   GLN GLN C . n 
C 1 6  GLN 6  6   6   GLN GLN C . n 
C 1 7  GLN 7  7   7   GLN GLN C . n 
C 1 8  ASN 8  8   8   ASN ASN C . n 
C 1 9  ASN 9  9   9   ASN ASN C . n 
C 1 10 LEU 10 10  10  LEU LEU C . n 
C 1 11 LEU 11 11  11  LEU LEU C . n 
C 1 12 ARG 12 12  12  ARG ARG C . n 
C 1 13 ALA 13 13  13  ALA ALA C . n 
C 1 14 ILE 14 14  14  ILE ILE C . n 
C 1 15 GLU 15 15  15  GLU GLU C . n 
C 1 16 ALA 16 16  16  ALA ALA C . n 
C 1 17 GLN 17 17  17  GLN GLN C . n 
C 1 18 GLN 18 18  18  GLN GLN C . n 
C 1 19 HIS 19 19  19  HIS HIS C . n 
C 1 20 LEU 20 20  20  LEU LEU C . n 
C 1 21 LEU 21 21  21  LEU LEU C . n 
C 1 22 GLN 22 22  22  GLN GLN C . n 
C 1 23 LEU 23 23  23  LEU LEU C . n 
C 1 24 THR 24 24  24  THR THR C . n 
C 1 25 VAL 25 25  25  VAL VAL C . n 
C 1 26 TRP 26 26  26  TRP TRP C . n 
C 1 27 GLY 27 27  27  GLY GLY C . n 
C 1 28 ILE 28 28  28  ILE ILE C . n 
C 1 29 LYS 29 29  29  LYS LYS C . n 
C 1 30 GLN 30 30  30  GLN GLN C . n 
C 1 31 LEU 31 31  31  LEU LEU C . n 
C 1 32 GLN 32 32  32  GLN GLN C . n 
C 1 33 ALA 33 33  33  ALA ALA C . n 
C 1 34 ARG 34 34  34  ARG ARG C . n 
C 1 35 ILE 35 35  35  ILE ILE C . n 
C 1 36 LEU 36 36  36  LEU LEU C . n 
C 1 37 ALA 37 37  37  ALA ALA C . n 
C 1 38 VAL 38 38  38  VAL VAL C . n 
C 1 39 GLU 39 39  39  GLU GLU C . n 
C 1 40 ARG 40 40  40  ARG ARG C . n 
C 1 41 TYR 41 41  41  TYR TYR C . n 
C 1 42 LEU 42 42  42  LEU LEU C . n 
C 1 43 LYS 43 43  43  LYS LYS C . n 
C 1 44 ASP 44 44  44  ASP ASP C . n 
C 1 45 GLN 45 45  45  GLN GLN C . n 
C 1 46 NH2 46 100 100 NH2 NH2 C . n 
D 2 1  ACE 1  40  40  ACE ACE D . n 
D 2 2  MET 2  41  41  MET MET D . n 
D 2 3  THR 3  42  42  THR THR D . n 
D 2 4  TRP 4  43  43  TRP TRP D . n 
D 2 5  GLU 5  44  44  GLU GLU D . n 
D 2 6  GLU 6  45  45  GLU GLU D . n 
D 2 7  TRP 7  46  46  TRP TRP D . n 
D 2 8  ASP 8  47  47  ASP ASP D . n 
D 2 9  LYS 9  48  48  LYS LYS D . n 
D 2 10 LYS 10 49  49  LYS LYS D . n 
D 2 11 ILE 11 50  50  ILE ILE D . n 
D 2 12 GLU 12 51  51  GLU GLU D . n 
D 2 13 GLU 13 52  52  GLU GLU D . n 
D 2 14 LEU 14 53  53  LEU LEU D . n 
D 2 15 ILE 15 54  54  ILE ILE D . n 
D 2 16 LYS 16 55  55  LYS LYS D . n 
D 2 17 LYS 17 56  56  LYS LYS D . n 
D 2 18 SER 18 57  57  SER SER D . n 
D 2 19 GLU 19 58  58  GLU GLU D . n 
D 2 20 GLU 20 59  59  GLU GLU D . n 
D 2 21 LEU 21 60  60  LEU LEU D . n 
D 2 22 ILE 22 61  61  ILE ILE D . n 
D 2 23 LYS 23 62  62  LYS LYS D . n 
D 2 24 LYS 24 63  63  LYS LYS D . n 
D 2 25 ILE 25 64  64  ILE ILE D . n 
D 2 26 GLU 26 65  65  GLU GLU D . n 
D 2 27 GLU 27 66  66  GLU GLU D . n 
D 2 28 GLN 28 67  67  GLN GLN D . n 
D 2 29 ILE 29 68  68  ILE ILE D . n 
D 2 30 LYS 30 69  69  LYS LYS D . n 
D 2 31 LYS 31 70  70  LYS LYS D . n 
D 2 32 GLN 32 71  71  GLN GLN D . n 
D 2 33 GLU 33 72  72  GLU GLU D . n 
D 2 34 GLU 34 73  73  GLU GLU D . n 
D 2 35 SER 35 74  74  SER SER D . n 
D 2 36 ILE 36 75  ?   ?   ?   D . n 
D 2 37 LYS 37 76  ?   ?   ?   D . n 
D 2 38 LYS 38 77  ?   ?   ?   D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 SO4 1  201 61 SO4 SO4 A . 
F 4 EDO 1  202 62 EDO EDO A . 
G 5 P4G 1  203 63 P4G P4G A . 
H 6 HOH 1  301 26 HOH HOH A . 
H 6 HOH 2  302 28 HOH HOH A . 
H 6 HOH 3  303 16 HOH HOH A . 
H 6 HOH 4  304 19 HOH HOH A . 
H 6 HOH 5  305 24 HOH HOH A . 
H 6 HOH 6  306 20 HOH HOH A . 
H 6 HOH 7  307 3  HOH HOH A . 
H 6 HOH 8  308 32 HOH HOH A . 
H 6 HOH 9  309 1  HOH HOH A . 
H 6 HOH 10 310 18 HOH HOH A . 
H 6 HOH 11 311 11 HOH HOH A . 
H 6 HOH 12 312 2  HOH HOH A . 
H 6 HOH 13 313 17 HOH HOH A . 
H 6 HOH 14 314 33 HOH HOH A . 
H 6 HOH 15 315 8  HOH HOH A . 
H 6 HOH 16 316 34 HOH HOH A . 
H 6 HOH 17 317 37 HOH HOH A . 
H 6 HOH 18 318 14 HOH HOH A . 
H 6 HOH 19 319 22 HOH HOH A . 
I 6 HOH 1  101 23 HOH HOH B . 
I 6 HOH 2  102 21 HOH HOH B . 
J 6 HOH 1  201 12 HOH HOH C . 
J 6 HOH 2  202 35 HOH HOH C . 
J 6 HOH 3  203 29 HOH HOH C . 
J 6 HOH 4  204 7  HOH HOH C . 
J 6 HOH 5  205 31 HOH HOH C . 
J 6 HOH 6  206 6  HOH HOH C . 
J 6 HOH 7  207 4  HOH HOH C . 
J 6 HOH 8  208 5  HOH HOH C . 
J 6 HOH 9  209 13 HOH HOH C . 
J 6 HOH 10 210 36 HOH HOH C . 
J 6 HOH 11 211 10 HOH HOH C . 
J 6 HOH 12 212 9  HOH HOH C . 
J 6 HOH 13 213 15 HOH HOH C . 
J 6 HOH 14 214 30 HOH HOH C . 
J 6 HOH 15 215 27 HOH HOH C . 
K 6 HOH 1  101 25 HOH HOH D . 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? 1.8.1_1168 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .          2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .          3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER   ? ? ? .          4 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5CMZ 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     44.403 
_cell.length_a_esd                 ? 
_cell.length_b                     44.403 
_cell.length_b_esd                 ? 
_cell.length_c                     227.897 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        12 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5CMZ 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                173 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 63' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5CMZ 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.33 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         63.06 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.2M Ammonium Sulfate, 0.1M Bis-Tris pH 6.5, 25% w/v PEG 3350' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'PSI PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-09-26 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.03317 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SSRF BEAMLINE BL17U' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.03317 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL17U 
_diffrn_source.pdbx_synchrotron_site       SSRF 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5CMZ 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.57 
_reflns.d_resolution_low                 38 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       61523 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.9 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.7 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            27.2 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5CMZ 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.574 
_refine.ls_d_res_low                             37.983 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     7574 
_refine.ls_number_reflns_R_free                  340 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    93.98 
_refine.ls_percent_reflns_R_free                 4.49 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2458 
_refine.ls_R_factor_R_free                       0.2642 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2448 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.40 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 29.98 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.21 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1317 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         20 
_refine_hist.number_atoms_solvent             37 
_refine_hist.number_atoms_total               1374 
_refine_hist.d_res_high                       2.574 
_refine_hist.d_res_low                        37.983 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.004  ? 1367 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.471  ? 1820 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 16.319 ? 547  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.034  ? 203  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.001  ? 226  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.5743 3.2430 . . 166 3393 89.00 . . . 0.2908 . 0.2606 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2430 10     . . 174 3841 99.00 . . . 0.2520 . 0.2382 . . . . . . . . . . 
# 
_struct.entry_id                     5CMZ 
_struct.title                        'Artificial HIV fusion inhibitor AP3 fused to the C-terminus of gp41 NHR' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5CMZ 
_struct_keywords.text            'Enfuvirtide, HIV fusion inhibitor, AP3, gp41, 6-HB, VIRAL PROTEIN-INHIBITOR complex' 
_struct_keywords.pdbx_keywords   'VIRAL PROTEIN/INHIBITOR' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 5 ? 
H N N 6 ? 
I N N 6 ? 
J N N 6 ? 
K N N 6 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP Q1HMR5_9HIV1 Q1HMR5 ? 1 SGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQ 35 
2 PDB 5CMZ         5CMZ   ? 2 ?                                             1  
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5CMZ A 1 ? 45 ? Q1HMR5 35 ? 79 ? 1  45 
2 2 5CMZ B 1 ? 38 ? 5CMZ   40 ? 77 ? 40 77 
3 1 5CMZ C 1 ? 45 ? Q1HMR5 35 ? 79 ? 1  45 
4 2 5CMZ D 1 ? 38 ? 5CMZ   40 ? 77 ? 40 77 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5CMZ NH2 A 46 ? UNP Q1HMR5 ? ? amidation 100 1 
3 5CMZ NH2 C 46 ? UNP Q1HMR5 ? ? amidation 100 2 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA hexameric 6 
2 author_and_software_defined_assembly PISA hexameric 6 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 12980 ? 
1 MORE         -130  ? 
1 'SSA (A^2)'  12740 ? 
2 'ABSA (A^2)' 12690 ? 
2 MORE         -100  ? 
2 'SSA (A^2)'  14670 ? 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1,2,4 A,B,E,F,G,H,I 
2 1,3,5 C,D,J,K       
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z         1.0000000000  0.0000000000  0.0000000000 0.0000000000   0.0000000000  
1.0000000000  0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_565 -y,x-y+1,z    -0.5000000000 -0.8660254038 0.0000000000 -22.2015000000 0.8660254038  
-0.5000000000 0.0000000000 38.4541260042  0.0000000000 0.0000000000 1.0000000000 0.0000000000 
3 'crystal symmetry operation' 2_455 -y-1,x-y,z    -0.5000000000 -0.8660254038 0.0000000000 -44.4030000000 0.8660254038  
-0.5000000000 0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000 0.0000000000 
4 'crystal symmetry operation' 3_455 -x+y-1,-x,z   -0.5000000000 0.8660254038  0.0000000000 -44.4030000000 -0.8660254038 
-0.5000000000 0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000 0.0000000000 
5 'crystal symmetry operation' 3_445 -x+y-1,-x-1,z -0.5000000000 0.8660254038  0.0000000000 -22.2015000000 -0.8660254038 
-0.5000000000 0.0000000000 -38.4541260042 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 ILE A 3 ? GLN A 45 ? ILE A 3  GLN A 45 1 ? 43 
HELX_P HELX_P2 AA2 THR B 3 ? LYS B 31 ? THR B 42 LYS B 70 1 ? 29 
HELX_P HELX_P3 AA3 ILE C 3 ? GLN C 45 ? ILE C 3  GLN C 45 1 ? 43 
HELX_P HELX_P4 AA4 THR D 3 ? GLN D 32 ? THR D 42 GLN D 71 1 ? 30 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1 covale both ? A GLN 45 C ? ? ? 1_555 A NH2 46 N ? ? A GLN 45 A NH2 100 1_555 ? ? ? ? ? ? ? 1.210 ? ? 
covale2 covale both ? B ACE 1  C ? ? ? 1_555 B MET 2  N ? ? B ACE 40 B MET 41  1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale3 covale both ? C GLN 45 C ? ? ? 1_555 C NH2 46 N ? ? C GLN 45 C NH2 100 1_555 ? ? ? ? ? ? ? 1.328 ? ? 
covale4 covale both ? D ACE 1  C ? ? ? 1_555 D MET 2  N ? ? D ACE 40 D MET 41  1_555 ? ? ? ? ? ? ? 1.303 ? ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_modification_feature.ordinal 
_pdbx_modification_feature.label_comp_id 
_pdbx_modification_feature.label_asym_id 
_pdbx_modification_feature.label_seq_id 
_pdbx_modification_feature.label_alt_id 
_pdbx_modification_feature.modified_residue_label_comp_id 
_pdbx_modification_feature.modified_residue_label_asym_id 
_pdbx_modification_feature.modified_residue_label_seq_id 
_pdbx_modification_feature.modified_residue_label_alt_id 
_pdbx_modification_feature.auth_comp_id 
_pdbx_modification_feature.auth_asym_id 
_pdbx_modification_feature.auth_seq_id 
_pdbx_modification_feature.PDB_ins_code 
_pdbx_modification_feature.symmetry 
_pdbx_modification_feature.modified_residue_auth_comp_id 
_pdbx_modification_feature.modified_residue_auth_asym_id 
_pdbx_modification_feature.modified_residue_auth_seq_id 
_pdbx_modification_feature.modified_residue_PDB_ins_code 
_pdbx_modification_feature.modified_residue_symmetry 
_pdbx_modification_feature.comp_id_linking_atom 
_pdbx_modification_feature.modified_residue_id_linking_atom 
_pdbx_modification_feature.modified_residue_id 
_pdbx_modification_feature.ref_pcm_id 
_pdbx_modification_feature.ref_comp_id 
_pdbx_modification_feature.type 
_pdbx_modification_feature.category 
1 ACE B 1  ? MET B 2  ? ACE B 40  ? 1_555 MET B 41 ? 1_555 . . MET 4  ACE None 'Terminal acetylation' 
2 ACE D 1  ? MET D 2  ? ACE D 40  ? 1_555 MET D 41 ? 1_555 . . MET 4  ACE None 'Terminal acetylation' 
3 NH2 A 46 ? GLN A 45 ? NH2 A 100 ? 1_555 GLN A 45 ? 1_555 . . GLN 18 NH2 None 'Terminal amidation'   
4 NH2 C 46 ? GLN C 45 ? NH2 C 100 ? 1_555 GLN C 45 ? 1_555 . . GLN 18 NH2 None 'Terminal amidation'   
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A SO4 201 ? 6 'binding site for residue SO4 A 201'                 
AC2 Software A EDO 202 ? 3 'binding site for residue EDO A 202'                 
AC3 Software C GLN 45  ? 4 'binding site for Di-peptide GLN C 45 and NH2 C 100' 
AC4 Software D ACE 40  ? 5 'binding site for Di-peptide ACE D 40 and MET D 41'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 ARG A 40 ? ARG A 40  . ? 1_555 ? 
2  AC1 6 LYS A 43 ? LYS A 43  . ? 1_555 ? 
3  AC1 6 HOH H .  ? HOH A 301 . ? 1_555 ? 
4  AC1 6 HOH H .  ? HOH A 304 . ? 1_555 ? 
5  AC1 6 ARG C 40 ? ARG C 40  . ? 1_555 ? 
6  AC1 6 LYS C 43 ? LYS C 43  . ? 1_555 ? 
7  AC2 3 ALA A 37 ? ALA A 37  . ? 1_555 ? 
8  AC2 3 ASP A 44 ? ASP A 44  . ? 1_555 ? 
9  AC2 3 HOH H .  ? HOH A 310 . ? 1_555 ? 
10 AC3 4 TYR C 41 ? TYR C 41  . ? 1_555 ? 
11 AC3 4 LEU C 42 ? LEU C 42  . ? 1_555 ? 
12 AC3 4 LYS C 43 ? LYS C 43  . ? 1_555 ? 
13 AC3 4 ASP C 44 ? ASP C 44  . ? 1_555 ? 
14 AC4 5 TRP C 26 ? TRP C 26  . ? 2_455 ? 
15 AC4 5 THR D 3  ? THR D 42  . ? 1_555 ? 
16 AC4 5 GLU D 6  ? GLU D 45  . ? 1_555 ? 
17 AC4 5 TRP D 7  ? TRP D 46  . ? 1_555 ? 
18 AC4 5 LYS D 10 ? LYS D 49  . ? 1_555 ? 
# 
_pdbx_entry_details.entry_id                   5CMZ 
_pdbx_entry_details.compound_details           ? 
_pdbx_entry_details.source_details             ? 
_pdbx_entry_details.nonpolymer_details         ? 
_pdbx_entry_details.sequence_details           ? 
_pdbx_entry_details.has_ligand_of_interest     ? 
_pdbx_entry_details.has_protein_modification   Y 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 CH3 D ACE 40  ? ? N D MET 41  ? ? 1.65 
2 1 O   A HOH 313 ? ? O C HOH 212 ? ? 1.85 
3 1 O   C HOH 202 ? ? O C HOH 214 ? ? 2.11 
4 1 OD1 C ASP 44  ? ? O C HOH 201 ? ? 2.12 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     302 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    B 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     101 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   2_565 
_pdbx_validate_symm_contact.dist              2.17 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 O B ACE 40 ? ? C B ACE 40 ? ? N B MET 41 ? ? 105.85 122.70 -16.85 1.60 Y 
2 1 O D ACE 40 ? ? C D ACE 40 ? ? N D MET 41 ? ? 96.45  122.70 -26.25 1.60 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLN B 71 ? ? -120.40 -68.95 
2 1 GLN D 71 ? ? -73.03  44.98  
3 1 GLU D 73 ? ? -73.98  35.90  
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 305 ? H HOH . 
2 1 A HOH 306 ? H HOH . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 1  ? A SER 1  
2  1 Y 1 A GLY 2  ? A GLY 2  
3  1 Y 1 B GLU 73 ? B GLU 34 
4  1 Y 1 B SER 74 ? B SER 35 
5  1 Y 1 B ILE 75 ? B ILE 36 
6  1 Y 1 B LYS 76 ? B LYS 37 
7  1 Y 1 B LYS 77 ? B LYS 38 
8  1 Y 1 D ILE 75 ? D ILE 36 
9  1 Y 1 D LYS 76 ? D LYS 37 
10 1 Y 1 D LYS 77 ? D LYS 38 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ACE C    C N N 1   
ACE O    O N N 2   
ACE CH3  C N N 3   
ACE H    H N N 4   
ACE H1   H N N 5   
ACE H2   H N N 6   
ACE H3   H N N 7   
ALA N    N N N 8   
ALA CA   C N S 9   
ALA C    C N N 10  
ALA O    O N N 11  
ALA CB   C N N 12  
ALA OXT  O N N 13  
ALA H    H N N 14  
ALA H2   H N N 15  
ALA HA   H N N 16  
ALA HB1  H N N 17  
ALA HB2  H N N 18  
ALA HB3  H N N 19  
ALA HXT  H N N 20  
ARG N    N N N 21  
ARG CA   C N S 22  
ARG C    C N N 23  
ARG O    O N N 24  
ARG CB   C N N 25  
ARG CG   C N N 26  
ARG CD   C N N 27  
ARG NE   N N N 28  
ARG CZ   C N N 29  
ARG NH1  N N N 30  
ARG NH2  N N N 31  
ARG OXT  O N N 32  
ARG H    H N N 33  
ARG H2   H N N 34  
ARG HA   H N N 35  
ARG HB2  H N N 36  
ARG HB3  H N N 37  
ARG HG2  H N N 38  
ARG HG3  H N N 39  
ARG HD2  H N N 40  
ARG HD3  H N N 41  
ARG HE   H N N 42  
ARG HH11 H N N 43  
ARG HH12 H N N 44  
ARG HH21 H N N 45  
ARG HH22 H N N 46  
ARG HXT  H N N 47  
ASN N    N N N 48  
ASN CA   C N S 49  
ASN C    C N N 50  
ASN O    O N N 51  
ASN CB   C N N 52  
ASN CG   C N N 53  
ASN OD1  O N N 54  
ASN ND2  N N N 55  
ASN OXT  O N N 56  
ASN H    H N N 57  
ASN H2   H N N 58  
ASN HA   H N N 59  
ASN HB2  H N N 60  
ASN HB3  H N N 61  
ASN HD21 H N N 62  
ASN HD22 H N N 63  
ASN HXT  H N N 64  
ASP N    N N N 65  
ASP CA   C N S 66  
ASP C    C N N 67  
ASP O    O N N 68  
ASP CB   C N N 69  
ASP CG   C N N 70  
ASP OD1  O N N 71  
ASP OD2  O N N 72  
ASP OXT  O N N 73  
ASP H    H N N 74  
ASP H2   H N N 75  
ASP HA   H N N 76  
ASP HB2  H N N 77  
ASP HB3  H N N 78  
ASP HD2  H N N 79  
ASP HXT  H N N 80  
EDO C1   C N N 81  
EDO O1   O N N 82  
EDO C2   C N N 83  
EDO O2   O N N 84  
EDO H11  H N N 85  
EDO H12  H N N 86  
EDO HO1  H N N 87  
EDO H21  H N N 88  
EDO H22  H N N 89  
EDO HO2  H N N 90  
GLN N    N N N 91  
GLN CA   C N S 92  
GLN C    C N N 93  
GLN O    O N N 94  
GLN CB   C N N 95  
GLN CG   C N N 96  
GLN CD   C N N 97  
GLN OE1  O N N 98  
GLN NE2  N N N 99  
GLN OXT  O N N 100 
GLN H    H N N 101 
GLN H2   H N N 102 
GLN HA   H N N 103 
GLN HB2  H N N 104 
GLN HB3  H N N 105 
GLN HG2  H N N 106 
GLN HG3  H N N 107 
GLN HE21 H N N 108 
GLN HE22 H N N 109 
GLN HXT  H N N 110 
GLU N    N N N 111 
GLU CA   C N S 112 
GLU C    C N N 113 
GLU O    O N N 114 
GLU CB   C N N 115 
GLU CG   C N N 116 
GLU CD   C N N 117 
GLU OE1  O N N 118 
GLU OE2  O N N 119 
GLU OXT  O N N 120 
GLU H    H N N 121 
GLU H2   H N N 122 
GLU HA   H N N 123 
GLU HB2  H N N 124 
GLU HB3  H N N 125 
GLU HG2  H N N 126 
GLU HG3  H N N 127 
GLU HE2  H N N 128 
GLU HXT  H N N 129 
GLY N    N N N 130 
GLY CA   C N N 131 
GLY C    C N N 132 
GLY O    O N N 133 
GLY OXT  O N N 134 
GLY H    H N N 135 
GLY H2   H N N 136 
GLY HA2  H N N 137 
GLY HA3  H N N 138 
GLY HXT  H N N 139 
HIS N    N N N 140 
HIS CA   C N S 141 
HIS C    C N N 142 
HIS O    O N N 143 
HIS CB   C N N 144 
HIS CG   C Y N 145 
HIS ND1  N Y N 146 
HIS CD2  C Y N 147 
HIS CE1  C Y N 148 
HIS NE2  N Y N 149 
HIS OXT  O N N 150 
HIS H    H N N 151 
HIS H2   H N N 152 
HIS HA   H N N 153 
HIS HB2  H N N 154 
HIS HB3  H N N 155 
HIS HD1  H N N 156 
HIS HD2  H N N 157 
HIS HE1  H N N 158 
HIS HE2  H N N 159 
HIS HXT  H N N 160 
HOH O    O N N 161 
HOH H1   H N N 162 
HOH H2   H N N 163 
ILE N    N N N 164 
ILE CA   C N S 165 
ILE C    C N N 166 
ILE O    O N N 167 
ILE CB   C N S 168 
ILE CG1  C N N 169 
ILE CG2  C N N 170 
ILE CD1  C N N 171 
ILE OXT  O N N 172 
ILE H    H N N 173 
ILE H2   H N N 174 
ILE HA   H N N 175 
ILE HB   H N N 176 
ILE HG12 H N N 177 
ILE HG13 H N N 178 
ILE HG21 H N N 179 
ILE HG22 H N N 180 
ILE HG23 H N N 181 
ILE HD11 H N N 182 
ILE HD12 H N N 183 
ILE HD13 H N N 184 
ILE HXT  H N N 185 
LEU N    N N N 186 
LEU CA   C N S 187 
LEU C    C N N 188 
LEU O    O N N 189 
LEU CB   C N N 190 
LEU CG   C N N 191 
LEU CD1  C N N 192 
LEU CD2  C N N 193 
LEU OXT  O N N 194 
LEU H    H N N 195 
LEU H2   H N N 196 
LEU HA   H N N 197 
LEU HB2  H N N 198 
LEU HB3  H N N 199 
LEU HG   H N N 200 
LEU HD11 H N N 201 
LEU HD12 H N N 202 
LEU HD13 H N N 203 
LEU HD21 H N N 204 
LEU HD22 H N N 205 
LEU HD23 H N N 206 
LEU HXT  H N N 207 
LYS N    N N N 208 
LYS CA   C N S 209 
LYS C    C N N 210 
LYS O    O N N 211 
LYS CB   C N N 212 
LYS CG   C N N 213 
LYS CD   C N N 214 
LYS CE   C N N 215 
LYS NZ   N N N 216 
LYS OXT  O N N 217 
LYS H    H N N 218 
LYS H2   H N N 219 
LYS HA   H N N 220 
LYS HB2  H N N 221 
LYS HB3  H N N 222 
LYS HG2  H N N 223 
LYS HG3  H N N 224 
LYS HD2  H N N 225 
LYS HD3  H N N 226 
LYS HE2  H N N 227 
LYS HE3  H N N 228 
LYS HZ1  H N N 229 
LYS HZ2  H N N 230 
LYS HZ3  H N N 231 
LYS HXT  H N N 232 
MET N    N N N 233 
MET CA   C N S 234 
MET C    C N N 235 
MET O    O N N 236 
MET CB   C N N 237 
MET CG   C N N 238 
MET SD   S N N 239 
MET CE   C N N 240 
MET OXT  O N N 241 
MET H    H N N 242 
MET H2   H N N 243 
MET HA   H N N 244 
MET HB2  H N N 245 
MET HB3  H N N 246 
MET HG2  H N N 247 
MET HG3  H N N 248 
MET HE1  H N N 249 
MET HE2  H N N 250 
MET HE3  H N N 251 
MET HXT  H N N 252 
NH2 N    N N N 253 
NH2 HN1  H N N 254 
NH2 HN2  H N N 255 
P4G C8   C N N 256 
P4G C7   C N N 257 
P4G O4   O N N 258 
P4G C6   C N N 259 
P4G C5   C N N 260 
P4G O3   O N N 261 
P4G C4   C N N 262 
P4G C3   C N N 263 
P4G O2   O N N 264 
P4G C2   C N N 265 
P4G C1   C N N 266 
P4G H81  H N N 267 
P4G H82  H N N 268 
P4G H83  H N N 269 
P4G H71  H N N 270 
P4G H72  H N N 271 
P4G H61  H N N 272 
P4G H62  H N N 273 
P4G H51  H N N 274 
P4G H52  H N N 275 
P4G H41  H N N 276 
P4G H42  H N N 277 
P4G H31  H N N 278 
P4G H32  H N N 279 
P4G H21  H N N 280 
P4G H22  H N N 281 
P4G H11  H N N 282 
P4G H12  H N N 283 
P4G H13  H N N 284 
SER N    N N N 285 
SER CA   C N S 286 
SER C    C N N 287 
SER O    O N N 288 
SER CB   C N N 289 
SER OG   O N N 290 
SER OXT  O N N 291 
SER H    H N N 292 
SER H2   H N N 293 
SER HA   H N N 294 
SER HB2  H N N 295 
SER HB3  H N N 296 
SER HG   H N N 297 
SER HXT  H N N 298 
SO4 S    S N N 299 
SO4 O1   O N N 300 
SO4 O2   O N N 301 
SO4 O3   O N N 302 
SO4 O4   O N N 303 
THR N    N N N 304 
THR CA   C N S 305 
THR C    C N N 306 
THR O    O N N 307 
THR CB   C N R 308 
THR OG1  O N N 309 
THR CG2  C N N 310 
THR OXT  O N N 311 
THR H    H N N 312 
THR H2   H N N 313 
THR HA   H N N 314 
THR HB   H N N 315 
THR HG1  H N N 316 
THR HG21 H N N 317 
THR HG22 H N N 318 
THR HG23 H N N 319 
THR HXT  H N N 320 
TRP N    N N N 321 
TRP CA   C N S 322 
TRP C    C N N 323 
TRP O    O N N 324 
TRP CB   C N N 325 
TRP CG   C Y N 326 
TRP CD1  C Y N 327 
TRP CD2  C Y N 328 
TRP NE1  N Y N 329 
TRP CE2  C Y N 330 
TRP CE3  C Y N 331 
TRP CZ2  C Y N 332 
TRP CZ3  C Y N 333 
TRP CH2  C Y N 334 
TRP OXT  O N N 335 
TRP H    H N N 336 
TRP H2   H N N 337 
TRP HA   H N N 338 
TRP HB2  H N N 339 
TRP HB3  H N N 340 
TRP HD1  H N N 341 
TRP HE1  H N N 342 
TRP HE3  H N N 343 
TRP HZ2  H N N 344 
TRP HZ3  H N N 345 
TRP HH2  H N N 346 
TRP HXT  H N N 347 
TYR N    N N N 348 
TYR CA   C N S 349 
TYR C    C N N 350 
TYR O    O N N 351 
TYR CB   C N N 352 
TYR CG   C Y N 353 
TYR CD1  C Y N 354 
TYR CD2  C Y N 355 
TYR CE1  C Y N 356 
TYR CE2  C Y N 357 
TYR CZ   C Y N 358 
TYR OH   O N N 359 
TYR OXT  O N N 360 
TYR H    H N N 361 
TYR H2   H N N 362 
TYR HA   H N N 363 
TYR HB2  H N N 364 
TYR HB3  H N N 365 
TYR HD1  H N N 366 
TYR HD2  H N N 367 
TYR HE1  H N N 368 
TYR HE2  H N N 369 
TYR HH   H N N 370 
TYR HXT  H N N 371 
VAL N    N N N 372 
VAL CA   C N S 373 
VAL C    C N N 374 
VAL O    O N N 375 
VAL CB   C N N 376 
VAL CG1  C N N 377 
VAL CG2  C N N 378 
VAL OXT  O N N 379 
VAL H    H N N 380 
VAL H2   H N N 381 
VAL HA   H N N 382 
VAL HB   H N N 383 
VAL HG11 H N N 384 
VAL HG12 H N N 385 
VAL HG13 H N N 386 
VAL HG21 H N N 387 
VAL HG22 H N N 388 
VAL HG23 H N N 389 
VAL HXT  H N N 390 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ACE C   O    doub N N 1   
ACE C   CH3  sing N N 2   
ACE C   H    sing N N 3   
ACE CH3 H1   sing N N 4   
ACE CH3 H2   sing N N 5   
ACE CH3 H3   sing N N 6   
ALA N   CA   sing N N 7   
ALA N   H    sing N N 8   
ALA N   H2   sing N N 9   
ALA CA  C    sing N N 10  
ALA CA  CB   sing N N 11  
ALA CA  HA   sing N N 12  
ALA C   O    doub N N 13  
ALA C   OXT  sing N N 14  
ALA CB  HB1  sing N N 15  
ALA CB  HB2  sing N N 16  
ALA CB  HB3  sing N N 17  
ALA OXT HXT  sing N N 18  
ARG N   CA   sing N N 19  
ARG N   H    sing N N 20  
ARG N   H2   sing N N 21  
ARG CA  C    sing N N 22  
ARG CA  CB   sing N N 23  
ARG CA  HA   sing N N 24  
ARG C   O    doub N N 25  
ARG C   OXT  sing N N 26  
ARG CB  CG   sing N N 27  
ARG CB  HB2  sing N N 28  
ARG CB  HB3  sing N N 29  
ARG CG  CD   sing N N 30  
ARG CG  HG2  sing N N 31  
ARG CG  HG3  sing N N 32  
ARG CD  NE   sing N N 33  
ARG CD  HD2  sing N N 34  
ARG CD  HD3  sing N N 35  
ARG NE  CZ   sing N N 36  
ARG NE  HE   sing N N 37  
ARG CZ  NH1  sing N N 38  
ARG CZ  NH2  doub N N 39  
ARG NH1 HH11 sing N N 40  
ARG NH1 HH12 sing N N 41  
ARG NH2 HH21 sing N N 42  
ARG NH2 HH22 sing N N 43  
ARG OXT HXT  sing N N 44  
ASN N   CA   sing N N 45  
ASN N   H    sing N N 46  
ASN N   H2   sing N N 47  
ASN CA  C    sing N N 48  
ASN CA  CB   sing N N 49  
ASN CA  HA   sing N N 50  
ASN C   O    doub N N 51  
ASN C   OXT  sing N N 52  
ASN CB  CG   sing N N 53  
ASN CB  HB2  sing N N 54  
ASN CB  HB3  sing N N 55  
ASN CG  OD1  doub N N 56  
ASN CG  ND2  sing N N 57  
ASN ND2 HD21 sing N N 58  
ASN ND2 HD22 sing N N 59  
ASN OXT HXT  sing N N 60  
ASP N   CA   sing N N 61  
ASP N   H    sing N N 62  
ASP N   H2   sing N N 63  
ASP CA  C    sing N N 64  
ASP CA  CB   sing N N 65  
ASP CA  HA   sing N N 66  
ASP C   O    doub N N 67  
ASP C   OXT  sing N N 68  
ASP CB  CG   sing N N 69  
ASP CB  HB2  sing N N 70  
ASP CB  HB3  sing N N 71  
ASP CG  OD1  doub N N 72  
ASP CG  OD2  sing N N 73  
ASP OD2 HD2  sing N N 74  
ASP OXT HXT  sing N N 75  
EDO C1  O1   sing N N 76  
EDO C1  C2   sing N N 77  
EDO C1  H11  sing N N 78  
EDO C1  H12  sing N N 79  
EDO O1  HO1  sing N N 80  
EDO C2  O2   sing N N 81  
EDO C2  H21  sing N N 82  
EDO C2  H22  sing N N 83  
EDO O2  HO2  sing N N 84  
GLN N   CA   sing N N 85  
GLN N   H    sing N N 86  
GLN N   H2   sing N N 87  
GLN CA  C    sing N N 88  
GLN CA  CB   sing N N 89  
GLN CA  HA   sing N N 90  
GLN C   O    doub N N 91  
GLN C   OXT  sing N N 92  
GLN CB  CG   sing N N 93  
GLN CB  HB2  sing N N 94  
GLN CB  HB3  sing N N 95  
GLN CG  CD   sing N N 96  
GLN CG  HG2  sing N N 97  
GLN CG  HG3  sing N N 98  
GLN CD  OE1  doub N N 99  
GLN CD  NE2  sing N N 100 
GLN NE2 HE21 sing N N 101 
GLN NE2 HE22 sing N N 102 
GLN OXT HXT  sing N N 103 
GLU N   CA   sing N N 104 
GLU N   H    sing N N 105 
GLU N   H2   sing N N 106 
GLU CA  C    sing N N 107 
GLU CA  CB   sing N N 108 
GLU CA  HA   sing N N 109 
GLU C   O    doub N N 110 
GLU C   OXT  sing N N 111 
GLU CB  CG   sing N N 112 
GLU CB  HB2  sing N N 113 
GLU CB  HB3  sing N N 114 
GLU CG  CD   sing N N 115 
GLU CG  HG2  sing N N 116 
GLU CG  HG3  sing N N 117 
GLU CD  OE1  doub N N 118 
GLU CD  OE2  sing N N 119 
GLU OE2 HE2  sing N N 120 
GLU OXT HXT  sing N N 121 
GLY N   CA   sing N N 122 
GLY N   H    sing N N 123 
GLY N   H2   sing N N 124 
GLY CA  C    sing N N 125 
GLY CA  HA2  sing N N 126 
GLY CA  HA3  sing N N 127 
GLY C   O    doub N N 128 
GLY C   OXT  sing N N 129 
GLY OXT HXT  sing N N 130 
HIS N   CA   sing N N 131 
HIS N   H    sing N N 132 
HIS N   H2   sing N N 133 
HIS CA  C    sing N N 134 
HIS CA  CB   sing N N 135 
HIS CA  HA   sing N N 136 
HIS C   O    doub N N 137 
HIS C   OXT  sing N N 138 
HIS CB  CG   sing N N 139 
HIS CB  HB2  sing N N 140 
HIS CB  HB3  sing N N 141 
HIS CG  ND1  sing Y N 142 
HIS CG  CD2  doub Y N 143 
HIS ND1 CE1  doub Y N 144 
HIS ND1 HD1  sing N N 145 
HIS CD2 NE2  sing Y N 146 
HIS CD2 HD2  sing N N 147 
HIS CE1 NE2  sing Y N 148 
HIS CE1 HE1  sing N N 149 
HIS NE2 HE2  sing N N 150 
HIS OXT HXT  sing N N 151 
HOH O   H1   sing N N 152 
HOH O   H2   sing N N 153 
ILE N   CA   sing N N 154 
ILE N   H    sing N N 155 
ILE N   H2   sing N N 156 
ILE CA  C    sing N N 157 
ILE CA  CB   sing N N 158 
ILE CA  HA   sing N N 159 
ILE C   O    doub N N 160 
ILE C   OXT  sing N N 161 
ILE CB  CG1  sing N N 162 
ILE CB  CG2  sing N N 163 
ILE CB  HB   sing N N 164 
ILE CG1 CD1  sing N N 165 
ILE CG1 HG12 sing N N 166 
ILE CG1 HG13 sing N N 167 
ILE CG2 HG21 sing N N 168 
ILE CG2 HG22 sing N N 169 
ILE CG2 HG23 sing N N 170 
ILE CD1 HD11 sing N N 171 
ILE CD1 HD12 sing N N 172 
ILE CD1 HD13 sing N N 173 
ILE OXT HXT  sing N N 174 
LEU N   CA   sing N N 175 
LEU N   H    sing N N 176 
LEU N   H2   sing N N 177 
LEU CA  C    sing N N 178 
LEU CA  CB   sing N N 179 
LEU CA  HA   sing N N 180 
LEU C   O    doub N N 181 
LEU C   OXT  sing N N 182 
LEU CB  CG   sing N N 183 
LEU CB  HB2  sing N N 184 
LEU CB  HB3  sing N N 185 
LEU CG  CD1  sing N N 186 
LEU CG  CD2  sing N N 187 
LEU CG  HG   sing N N 188 
LEU CD1 HD11 sing N N 189 
LEU CD1 HD12 sing N N 190 
LEU CD1 HD13 sing N N 191 
LEU CD2 HD21 sing N N 192 
LEU CD2 HD22 sing N N 193 
LEU CD2 HD23 sing N N 194 
LEU OXT HXT  sing N N 195 
LYS N   CA   sing N N 196 
LYS N   H    sing N N 197 
LYS N   H2   sing N N 198 
LYS CA  C    sing N N 199 
LYS CA  CB   sing N N 200 
LYS CA  HA   sing N N 201 
LYS C   O    doub N N 202 
LYS C   OXT  sing N N 203 
LYS CB  CG   sing N N 204 
LYS CB  HB2  sing N N 205 
LYS CB  HB3  sing N N 206 
LYS CG  CD   sing N N 207 
LYS CG  HG2  sing N N 208 
LYS CG  HG3  sing N N 209 
LYS CD  CE   sing N N 210 
LYS CD  HD2  sing N N 211 
LYS CD  HD3  sing N N 212 
LYS CE  NZ   sing N N 213 
LYS CE  HE2  sing N N 214 
LYS CE  HE3  sing N N 215 
LYS NZ  HZ1  sing N N 216 
LYS NZ  HZ2  sing N N 217 
LYS NZ  HZ3  sing N N 218 
LYS OXT HXT  sing N N 219 
MET N   CA   sing N N 220 
MET N   H    sing N N 221 
MET N   H2   sing N N 222 
MET CA  C    sing N N 223 
MET CA  CB   sing N N 224 
MET CA  HA   sing N N 225 
MET C   O    doub N N 226 
MET C   OXT  sing N N 227 
MET CB  CG   sing N N 228 
MET CB  HB2  sing N N 229 
MET CB  HB3  sing N N 230 
MET CG  SD   sing N N 231 
MET CG  HG2  sing N N 232 
MET CG  HG3  sing N N 233 
MET SD  CE   sing N N 234 
MET CE  HE1  sing N N 235 
MET CE  HE2  sing N N 236 
MET CE  HE3  sing N N 237 
MET OXT HXT  sing N N 238 
NH2 N   HN1  sing N N 239 
NH2 N   HN2  sing N N 240 
P4G C8  C7   sing N N 241 
P4G C8  H81  sing N N 242 
P4G C8  H82  sing N N 243 
P4G C8  H83  sing N N 244 
P4G C7  O4   sing N N 245 
P4G C7  H71  sing N N 246 
P4G C7  H72  sing N N 247 
P4G O4  C6   sing N N 248 
P4G C6  C5   sing N N 249 
P4G C6  H61  sing N N 250 
P4G C6  H62  sing N N 251 
P4G C5  O3   sing N N 252 
P4G C5  H51  sing N N 253 
P4G C5  H52  sing N N 254 
P4G O3  C4   sing N N 255 
P4G C4  C3   sing N N 256 
P4G C4  H41  sing N N 257 
P4G C4  H42  sing N N 258 
P4G C3  O2   sing N N 259 
P4G C3  H31  sing N N 260 
P4G C3  H32  sing N N 261 
P4G O2  C2   sing N N 262 
P4G C2  C1   sing N N 263 
P4G C2  H21  sing N N 264 
P4G C2  H22  sing N N 265 
P4G C1  H11  sing N N 266 
P4G C1  H12  sing N N 267 
P4G C1  H13  sing N N 268 
SER N   CA   sing N N 269 
SER N   H    sing N N 270 
SER N   H2   sing N N 271 
SER CA  C    sing N N 272 
SER CA  CB   sing N N 273 
SER CA  HA   sing N N 274 
SER C   O    doub N N 275 
SER C   OXT  sing N N 276 
SER CB  OG   sing N N 277 
SER CB  HB2  sing N N 278 
SER CB  HB3  sing N N 279 
SER OG  HG   sing N N 280 
SER OXT HXT  sing N N 281 
SO4 S   O1   doub N N 282 
SO4 S   O2   doub N N 283 
SO4 S   O3   sing N N 284 
SO4 S   O4   sing N N 285 
THR N   CA   sing N N 286 
THR N   H    sing N N 287 
THR N   H2   sing N N 288 
THR CA  C    sing N N 289 
THR CA  CB   sing N N 290 
THR CA  HA   sing N N 291 
THR C   O    doub N N 292 
THR C   OXT  sing N N 293 
THR CB  OG1  sing N N 294 
THR CB  CG2  sing N N 295 
THR CB  HB   sing N N 296 
THR OG1 HG1  sing N N 297 
THR CG2 HG21 sing N N 298 
THR CG2 HG22 sing N N 299 
THR CG2 HG23 sing N N 300 
THR OXT HXT  sing N N 301 
TRP N   CA   sing N N 302 
TRP N   H    sing N N 303 
TRP N   H2   sing N N 304 
TRP CA  C    sing N N 305 
TRP CA  CB   sing N N 306 
TRP CA  HA   sing N N 307 
TRP C   O    doub N N 308 
TRP C   OXT  sing N N 309 
TRP CB  CG   sing N N 310 
TRP CB  HB2  sing N N 311 
TRP CB  HB3  sing N N 312 
TRP CG  CD1  doub Y N 313 
TRP CG  CD2  sing Y N 314 
TRP CD1 NE1  sing Y N 315 
TRP CD1 HD1  sing N N 316 
TRP CD2 CE2  doub Y N 317 
TRP CD2 CE3  sing Y N 318 
TRP NE1 CE2  sing Y N 319 
TRP NE1 HE1  sing N N 320 
TRP CE2 CZ2  sing Y N 321 
TRP CE3 CZ3  doub Y N 322 
TRP CE3 HE3  sing N N 323 
TRP CZ2 CH2  doub Y N 324 
TRP CZ2 HZ2  sing N N 325 
TRP CZ3 CH2  sing Y N 326 
TRP CZ3 HZ3  sing N N 327 
TRP CH2 HH2  sing N N 328 
TRP OXT HXT  sing N N 329 
TYR N   CA   sing N N 330 
TYR N   H    sing N N 331 
TYR N   H2   sing N N 332 
TYR CA  C    sing N N 333 
TYR CA  CB   sing N N 334 
TYR CA  HA   sing N N 335 
TYR C   O    doub N N 336 
TYR C   OXT  sing N N 337 
TYR CB  CG   sing N N 338 
TYR CB  HB2  sing N N 339 
TYR CB  HB3  sing N N 340 
TYR CG  CD1  doub Y N 341 
TYR CG  CD2  sing Y N 342 
TYR CD1 CE1  sing Y N 343 
TYR CD1 HD1  sing N N 344 
TYR CD2 CE2  doub Y N 345 
TYR CD2 HD2  sing N N 346 
TYR CE1 CZ   doub Y N 347 
TYR CE1 HE1  sing N N 348 
TYR CE2 CZ   sing Y N 349 
TYR CE2 HE2  sing N N 350 
TYR CZ  OH   sing N N 351 
TYR OH  HH   sing N N 352 
TYR OXT HXT  sing N N 353 
VAL N   CA   sing N N 354 
VAL N   H    sing N N 355 
VAL N   H2   sing N N 356 
VAL CA  C    sing N N 357 
VAL CA  CB   sing N N 358 
VAL CA  HA   sing N N 359 
VAL C   O    doub N N 360 
VAL C   OXT  sing N N 361 
VAL CB  CG1  sing N N 362 
VAL CB  CG2  sing N N 363 
VAL CB  HB   sing N N 364 
VAL CG1 HG11 sing N N 365 
VAL CG1 HG12 sing N N 366 
VAL CG1 HG13 sing N N 367 
VAL CG2 HG21 sing N N 368 
VAL CG2 HG22 sing N N 369 
VAL CG2 HG23 sing N N 370 
VAL OXT HXT  sing N N 371 
# 
_atom_sites.entry_id                    5CMZ 
_atom_sites.fract_transf_matrix[1][1]   0.022521 
_atom_sites.fract_transf_matrix[1][2]   0.013003 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.026005 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004388 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_