data_5CMZ # _entry.id 5CMZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5CMZ WWPDB D_1000211900 # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 5CMU unspecified PDB . 5CN0 unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5CMZ _pdbx_database_status.recvd_initial_deposition_date 2015-07-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zhu, Y.' 1 'Ye, S.' 2 'Zhang, R.' 3 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Rep' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2045-2322 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 5 _citation.language ? _citation.page_first 13028 _citation.page_last 13028 _citation.title ;Improved Pharmacological and Structural Properties of HIV Fusion Inhibitor AP3 over Enfuvirtide: Highlighting Advantages of Artificial Peptide Strategy. ; _citation.year 2015 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/srep13028 _citation.pdbx_database_id_PubMed 26286358 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Zhu, X.' 1 primary 'Zhu, Y.' 2 primary 'Ye, S.' 3 primary 'Wang, Q.' 4 primary 'Xu, W.' 5 primary 'Su, S.' 6 primary 'Sun, Z.' 7 primary 'Yu, F.' 8 primary 'Liu, Q.' 9 primary 'Wang, C.' 10 primary 'Zhang, T.' 11 primary 'Zhang, Z.' 12 primary 'Zhang, X.' 13 primary 'Xu, J.' 14 primary 'Du, L.' 15 primary 'Liu, K.' 16 primary 'Lu, L.' 17 primary 'Zhang, R.' 18 primary 'Jiang, S.' 19 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5CMZ _cell.details ? _cell.formula_units_Z ? _cell.length_a 44.403 _cell.length_a_esd ? _cell.length_b 44.403 _cell.length_b_esd ? _cell.length_c 227.897 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5CMZ _symmetry.cell_setting ? _symmetry.Int_Tables_number 173 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 63' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Envelope glycoprotein' 5230.056 2 ? ? 'UNP RESIDUES 35-79' ? 2 polymer syn 'Artificial HIV entry inhibitor AP3' 4682.471 2 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 4 non-polymer syn 1,2-ETHANEDIOL 62.068 1 ? ? ? ? 5 non-polymer nat '1-ETHOXY-2-(2-ETHOXYETHOXY)ETHANE' 162.227 1 ? ? ? ? 6 water nat water 18.015 37 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name go41 # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no yes 'SGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQ(NH2)' SGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQX A,C ? 2 'polypeptide(L)' no yes '(ACE)MTWEEWDKKIEELIKKSEELIKKIEEQIKKQEESIKK' XMTWEEWDKKIEELIKKSEELIKKIEEQIKKQEESIKK B,D ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 GLY n 1 3 ILE n 1 4 VAL n 1 5 GLN n 1 6 GLN n 1 7 GLN n 1 8 ASN n 1 9 ASN n 1 10 LEU n 1 11 LEU n 1 12 ARG n 1 13 ALA n 1 14 ILE n 1 15 GLU n 1 16 ALA n 1 17 GLN n 1 18 GLN n 1 19 HIS n 1 20 LEU n 1 21 LEU n 1 22 GLN n 1 23 LEU n 1 24 THR n 1 25 VAL n 1 26 TRP n 1 27 GLY n 1 28 ILE n 1 29 LYS n 1 30 GLN n 1 31 LEU n 1 32 GLN n 1 33 ALA n 1 34 ARG n 1 35 ILE n 1 36 LEU n 1 37 ALA n 1 38 VAL n 1 39 GLU n 1 40 ARG n 1 41 TYR n 1 42 LEU n 1 43 LYS n 1 44 ASP n 1 45 GLN n 1 46 NH2 n 2 1 ACE n 2 2 MET n 2 3 THR n 2 4 TRP n 2 5 GLU n 2 6 GLU n 2 7 TRP n 2 8 ASP n 2 9 LYS n 2 10 LYS n 2 11 ILE n 2 12 GLU n 2 13 GLU n 2 14 LEU n 2 15 ILE n 2 16 LYS n 2 17 LYS n 2 18 SER n 2 19 GLU n 2 20 GLU n 2 21 LEU n 2 22 ILE n 2 23 LYS n 2 24 LYS n 2 25 ILE n 2 26 GLU n 2 27 GLU n 2 28 GLN n 2 29 ILE n 2 30 LYS n 2 31 LYS n 2 32 GLN n 2 33 GLU n 2 34 GLU n 2 35 SER n 2 36 ILE n 2 37 LYS n 2 38 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 46 _entity_src_gen.gene_src_common_name HIV1 _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene env _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Human immunodeficiency virus 1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 11676 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 38 _pdbx_entity_src_syn.organism_scientific 'synthetic construct' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 32630 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP Q1HMR5_9HIV1 Q1HMR5 ? 1 SGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQ 35 2 PDB 5CMZ 5CMZ ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5CMZ A 1 ? 45 ? Q1HMR5 35 ? 79 ? 1 45 2 2 5CMZ B 1 ? 38 ? 5CMZ 40 ? 77 ? 40 77 3 1 5CMZ C 1 ? 45 ? Q1HMR5 35 ? 79 ? 1 45 4 2 5CMZ D 1 ? 38 ? 5CMZ 40 ? 77 ? 40 77 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5CMZ NH2 A 46 ? UNP Q1HMR5 ? ? amidation 100 1 3 5CMZ NH2 C 46 ? UNP Q1HMR5 ? ? amidation 100 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 P4G non-polymer . '1-ETHOXY-2-(2-ETHOXYETHOXY)ETHANE' ? 'C8 H18 O3' 162.227 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5CMZ _exptl.crystals_number ? _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.33 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 63.06 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2M Ammonium Sulfate, 0.1M Bis-Tris pH 6.5, 25% w/v PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'PSI PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-09-26 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.03317 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17U' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.03317 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17U _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5CMZ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.57 _reflns.d_resolution_low 38 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 61523 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.7 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 27.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5CMZ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.574 _refine.ls_d_res_low 37.983 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7574 _refine.ls_number_reflns_R_free 340 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 93.98 _refine.ls_percent_reflns_R_free 4.49 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2458 _refine.ls_R_factor_R_free 0.2642 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2448 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.40 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 29.98 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.21 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1317 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 20 _refine_hist.number_atoms_solvent 37 _refine_hist.number_atoms_total 1374 _refine_hist.d_res_high 2.574 _refine_hist.d_res_low 37.983 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.004 ? 1367 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.471 ? 1820 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 16.319 ? 547 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.034 ? 203 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.001 ? 226 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.5743 3.2430 . . 166 3393 89.00 . . . 0.2908 . 0.2606 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2430 10 . . 174 3841 99.00 . . . 0.2520 . 0.2382 . . . . . . . . . . # _struct.entry_id 5CMZ _struct.title 'Artificial HIV fusion inhibitor AP3 fused to the C-terminus of gp41 NHR' _struct.pdbx_descriptor 'Envelope glycoprotein, Artificial HIV entry inhibitor AP3' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5CMZ _struct_keywords.text 'Enfuvirtide, HIV fusion inhibitor, AP3, gp41, 6-HB, VIRAL PROTEIN-INHIBITOR complex' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN/INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 1 ? D N N 2 ? E N N 3 ? F N N 4 ? G N N 5 ? H N N 6 ? I N N 6 ? J N N 6 ? K N N 6 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ILE A 3 ? GLN A 45 ? ILE A 3 GLN A 45 1 ? 43 HELX_P HELX_P2 AA2 THR B 3 ? LYS B 31 ? THR B 42 LYS B 70 1 ? 29 HELX_P HELX_P3 AA3 ILE C 3 ? GLN C 45 ? ILE C 3 GLN C 45 1 ? 43 HELX_P HELX_P4 AA4 THR D 3 ? GLN D 32 ? THR D 42 GLN D 71 1 ? 30 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale both ? A GLN 45 C ? ? ? 1_555 A NH2 46 N ? ? A GLN 45 A NH2 100 1_555 ? ? ? ? ? ? ? 1.210 ? covale2 covale both ? B ACE 1 C ? ? ? 1_555 B MET 2 N ? ? B ACE 40 B MET 41 1_555 ? ? ? ? ? ? ? 1.330 ? covale3 covale both ? C GLN 45 C ? ? ? 1_555 C NH2 46 N ? ? C GLN 45 C NH2 100 1_555 ? ? ? ? ? ? ? 1.328 ? covale4 covale both ? D ACE 1 C ? ? ? 1_555 D MET 2 N ? ? D ACE 40 D MET 41 1_555 ? ? ? ? ? ? ? 1.303 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 201 ? 6 'binding site for residue SO4 A 201' AC2 Software A EDO 202 ? 3 'binding site for residue EDO A 202' AC3 Software C GLN 45 ? 4 'binding site for Di-peptide GLN C 45 and NH2 C 100' AC4 Software D ACE 40 ? 5 'binding site for Di-peptide ACE D 40 and MET D 41' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 ARG A 40 ? ARG A 40 . ? 1_555 ? 2 AC1 6 LYS A 43 ? LYS A 43 . ? 1_555 ? 3 AC1 6 HOH H . ? HOH A 301 . ? 1_555 ? 4 AC1 6 HOH H . ? HOH A 304 . ? 1_555 ? 5 AC1 6 ARG C 40 ? ARG C 40 . ? 1_555 ? 6 AC1 6 LYS C 43 ? LYS C 43 . ? 1_555 ? 7 AC2 3 ALA A 37 ? ALA A 37 . ? 1_555 ? 8 AC2 3 ASP A 44 ? ASP A 44 . ? 1_555 ? 9 AC2 3 HOH H . ? HOH A 310 . ? 1_555 ? 10 AC3 4 TYR C 41 ? TYR C 41 . ? 1_555 ? 11 AC3 4 LEU C 42 ? LEU C 42 . ? 1_555 ? 12 AC3 4 LYS C 43 ? LYS C 43 . ? 1_555 ? 13 AC3 4 ASP C 44 ? ASP C 44 . ? 1_555 ? 14 AC4 5 TRP C 26 ? TRP C 26 . ? 2_455 ? 15 AC4 5 THR D 3 ? THR D 42 . ? 1_555 ? 16 AC4 5 GLU D 6 ? GLU D 45 . ? 1_555 ? 17 AC4 5 TRP D 7 ? TRP D 46 . ? 1_555 ? 18 AC4 5 LYS D 10 ? LYS D 49 . ? 1_555 ? # _atom_sites.entry_id 5CMZ _atom_sites.fract_transf_matrix[1][1] 0.022521 _atom_sites.fract_transf_matrix[1][2] 0.013003 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.026005 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004388 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 ? ? ? A . n A 1 2 GLY 2 2 ? ? ? A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 GLN 6 6 6 GLN GLN A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 HIS 19 19 19 HIS HIS A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 TRP 26 26 26 TRP TRP A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 TYR 41 41 41 TYR TYR A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 NH2 46 100 100 NH2 NH2 A . n B 2 1 ACE 1 40 40 ACE ACE B . n B 2 2 MET 2 41 41 MET MET B . n B 2 3 THR 3 42 42 THR THR B . n B 2 4 TRP 4 43 43 TRP TRP B . n B 2 5 GLU 5 44 44 GLU GLU B . n B 2 6 GLU 6 45 45 GLU GLU B . n B 2 7 TRP 7 46 46 TRP TRP B . n B 2 8 ASP 8 47 47 ASP ASP B . n B 2 9 LYS 9 48 48 LYS LYS B . n B 2 10 LYS 10 49 49 LYS LYS B . n B 2 11 ILE 11 50 50 ILE ILE B . n B 2 12 GLU 12 51 51 GLU GLU B . n B 2 13 GLU 13 52 52 GLU GLU B . n B 2 14 LEU 14 53 53 LEU LEU B . n B 2 15 ILE 15 54 54 ILE ILE B . n B 2 16 LYS 16 55 55 LYS LYS B . n B 2 17 LYS 17 56 56 LYS LYS B . n B 2 18 SER 18 57 57 SER SER B . n B 2 19 GLU 19 58 58 GLU GLU B . n B 2 20 GLU 20 59 59 GLU GLU B . n B 2 21 LEU 21 60 60 LEU LEU B . n B 2 22 ILE 22 61 61 ILE ILE B . n B 2 23 LYS 23 62 62 LYS LYS B . n B 2 24 LYS 24 63 63 LYS LYS B . n B 2 25 ILE 25 64 64 ILE ILE B . n B 2 26 GLU 26 65 65 GLU GLU B . n B 2 27 GLU 27 66 66 GLU GLU B . n B 2 28 GLN 28 67 67 GLN GLN B . n B 2 29 ILE 29 68 68 ILE ILE B . n B 2 30 LYS 30 69 69 LYS LYS B . n B 2 31 LYS 31 70 70 LYS LYS B . n B 2 32 GLN 32 71 71 GLN GLN B . n B 2 33 GLU 33 72 72 GLU GLU B . n B 2 34 GLU 34 73 ? ? ? B . n B 2 35 SER 35 74 ? ? ? B . n B 2 36 ILE 36 75 ? ? ? B . n B 2 37 LYS 37 76 ? ? ? B . n B 2 38 LYS 38 77 ? ? ? B . n C 1 1 SER 1 1 1 SER SER C . n C 1 2 GLY 2 2 2 GLY GLY C . n C 1 3 ILE 3 3 3 ILE ILE C . n C 1 4 VAL 4 4 4 VAL VAL C . n C 1 5 GLN 5 5 5 GLN GLN C . n C 1 6 GLN 6 6 6 GLN GLN C . n C 1 7 GLN 7 7 7 GLN GLN C . n C 1 8 ASN 8 8 8 ASN ASN C . n C 1 9 ASN 9 9 9 ASN ASN C . n C 1 10 LEU 10 10 10 LEU LEU C . n C 1 11 LEU 11 11 11 LEU LEU C . n C 1 12 ARG 12 12 12 ARG ARG C . n C 1 13 ALA 13 13 13 ALA ALA C . n C 1 14 ILE 14 14 14 ILE ILE C . n C 1 15 GLU 15 15 15 GLU GLU C . n C 1 16 ALA 16 16 16 ALA ALA C . n C 1 17 GLN 17 17 17 GLN GLN C . n C 1 18 GLN 18 18 18 GLN GLN C . n C 1 19 HIS 19 19 19 HIS HIS C . n C 1 20 LEU 20 20 20 LEU LEU C . n C 1 21 LEU 21 21 21 LEU LEU C . n C 1 22 GLN 22 22 22 GLN GLN C . n C 1 23 LEU 23 23 23 LEU LEU C . n C 1 24 THR 24 24 24 THR THR C . n C 1 25 VAL 25 25 25 VAL VAL C . n C 1 26 TRP 26 26 26 TRP TRP C . n C 1 27 GLY 27 27 27 GLY GLY C . n C 1 28 ILE 28 28 28 ILE ILE C . n C 1 29 LYS 29 29 29 LYS LYS C . n C 1 30 GLN 30 30 30 GLN GLN C . n C 1 31 LEU 31 31 31 LEU LEU C . n C 1 32 GLN 32 32 32 GLN GLN C . n C 1 33 ALA 33 33 33 ALA ALA C . n C 1 34 ARG 34 34 34 ARG ARG C . n C 1 35 ILE 35 35 35 ILE ILE C . n C 1 36 LEU 36 36 36 LEU LEU C . n C 1 37 ALA 37 37 37 ALA ALA C . n C 1 38 VAL 38 38 38 VAL VAL C . n C 1 39 GLU 39 39 39 GLU GLU C . n C 1 40 ARG 40 40 40 ARG ARG C . n C 1 41 TYR 41 41 41 TYR TYR C . n C 1 42 LEU 42 42 42 LEU LEU C . n C 1 43 LYS 43 43 43 LYS LYS C . n C 1 44 ASP 44 44 44 ASP ASP C . n C 1 45 GLN 45 45 45 GLN GLN C . n C 1 46 NH2 46 100 100 NH2 NH2 C . n D 2 1 ACE 1 40 40 ACE ACE D . n D 2 2 MET 2 41 41 MET MET D . n D 2 3 THR 3 42 42 THR THR D . n D 2 4 TRP 4 43 43 TRP TRP D . n D 2 5 GLU 5 44 44 GLU GLU D . n D 2 6 GLU 6 45 45 GLU GLU D . n D 2 7 TRP 7 46 46 TRP TRP D . n D 2 8 ASP 8 47 47 ASP ASP D . n D 2 9 LYS 9 48 48 LYS LYS D . n D 2 10 LYS 10 49 49 LYS LYS D . n D 2 11 ILE 11 50 50 ILE ILE D . n D 2 12 GLU 12 51 51 GLU GLU D . n D 2 13 GLU 13 52 52 GLU GLU D . n D 2 14 LEU 14 53 53 LEU LEU D . n D 2 15 ILE 15 54 54 ILE ILE D . n D 2 16 LYS 16 55 55 LYS LYS D . n D 2 17 LYS 17 56 56 LYS LYS D . n D 2 18 SER 18 57 57 SER SER D . n D 2 19 GLU 19 58 58 GLU GLU D . n D 2 20 GLU 20 59 59 GLU GLU D . n D 2 21 LEU 21 60 60 LEU LEU D . n D 2 22 ILE 22 61 61 ILE ILE D . n D 2 23 LYS 23 62 62 LYS LYS D . n D 2 24 LYS 24 63 63 LYS LYS D . n D 2 25 ILE 25 64 64 ILE ILE D . n D 2 26 GLU 26 65 65 GLU GLU D . n D 2 27 GLU 27 66 66 GLU GLU D . n D 2 28 GLN 28 67 67 GLN GLN D . n D 2 29 ILE 29 68 68 ILE ILE D . n D 2 30 LYS 30 69 69 LYS LYS D . n D 2 31 LYS 31 70 70 LYS LYS D . n D 2 32 GLN 32 71 71 GLN GLN D . n D 2 33 GLU 33 72 72 GLU GLU D . n D 2 34 GLU 34 73 73 GLU GLU D . n D 2 35 SER 35 74 74 SER SER D . n D 2 36 ILE 36 75 ? ? ? D . n D 2 37 LYS 37 76 ? ? ? D . n D 2 38 LYS 38 77 ? ? ? D . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code E 3 SO4 1 201 61 SO4 SO4 A . F 4 EDO 1 202 62 EDO EDO A . G 5 P4G 1 203 63 P4G P4G A . H 6 HOH 1 301 26 HOH HOH A . H 6 HOH 2 302 28 HOH HOH A . H 6 HOH 3 303 16 HOH HOH A . H 6 HOH 4 304 19 HOH HOH A . H 6 HOH 5 305 24 HOH HOH A . H 6 HOH 6 306 20 HOH HOH A . H 6 HOH 7 307 3 HOH HOH A . H 6 HOH 8 308 32 HOH HOH A . H 6 HOH 9 309 1 HOH HOH A . H 6 HOH 10 310 18 HOH HOH A . H 6 HOH 11 311 11 HOH HOH A . H 6 HOH 12 312 2 HOH HOH A . H 6 HOH 13 313 17 HOH HOH A . H 6 HOH 14 314 33 HOH HOH A . H 6 HOH 15 315 8 HOH HOH A . H 6 HOH 16 316 34 HOH HOH A . H 6 HOH 17 317 37 HOH HOH A . H 6 HOH 18 318 14 HOH HOH A . H 6 HOH 19 319 22 HOH HOH A . I 6 HOH 1 101 23 HOH HOH B . I 6 HOH 2 102 21 HOH HOH B . J 6 HOH 1 201 12 HOH HOH C . J 6 HOH 2 202 35 HOH HOH C . J 6 HOH 3 203 29 HOH HOH C . J 6 HOH 4 204 7 HOH HOH C . J 6 HOH 5 205 31 HOH HOH C . J 6 HOH 6 206 6 HOH HOH C . J 6 HOH 7 207 4 HOH HOH C . J 6 HOH 8 208 5 HOH HOH C . J 6 HOH 9 209 13 HOH HOH C . J 6 HOH 10 210 36 HOH HOH C . J 6 HOH 11 211 10 HOH HOH C . J 6 HOH 12 212 9 HOH HOH C . J 6 HOH 13 213 15 HOH HOH C . J 6 HOH 14 214 30 HOH HOH C . J 6 HOH 15 215 27 HOH HOH C . K 6 HOH 1 101 25 HOH HOH D . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA hexameric 6 2 author_and_software_defined_assembly PISA hexameric 6 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1,2,4 A,B,E,F,G,H,I 2 1,3,5 C,D,J,K # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 12980 ? 1 MORE -130 ? 1 'SSA (A^2)' 12740 ? 2 'ABSA (A^2)' 12690 ? 2 MORE -100 ? 2 'SSA (A^2)' 14670 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_565 -y,x-y+1,z -0.5000000000 -0.8660254038 0.0000000000 -22.2015000000 0.8660254038 -0.5000000000 0.0000000000 38.4541260042 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 2_455 -y-1,x-y,z -0.5000000000 -0.8660254038 0.0000000000 -44.4030000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 3_455 -x+y-1,-x,z -0.5000000000 0.8660254038 0.0000000000 -44.4030000000 -0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 5 'crystal symmetry operation' 3_445 -x+y-1,-x-1,z -0.5000000000 0.8660254038 0.0000000000 -22.2015000000 -0.8660254038 -0.5000000000 0.0000000000 -38.4541260042 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 305 ? H HOH . 2 1 A HOH 306 ? H HOH . # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2015-09-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.8.1_1168 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 CH3 D ACE 40 ? ? N D MET 41 ? ? 1.65 2 1 O A HOH 313 ? ? O C HOH 212 ? ? 1.85 3 1 O C HOH 202 ? ? O C HOH 214 ? ? 2.11 4 1 OD1 C ASP 44 ? ? O C HOH 201 ? ? 2.12 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 302 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 B _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 101 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 2_565 _pdbx_validate_symm_contact.dist 2.17 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 O B ACE 40 ? ? C B ACE 40 ? ? N B MET 41 ? ? 105.85 122.70 -16.85 1.60 Y 2 1 O D ACE 40 ? ? C D ACE 40 ? ? N D MET 41 ? ? 96.45 122.70 -26.25 1.60 Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN B 71 ? ? -120.40 -68.95 2 1 GLN D 71 ? ? -73.03 44.98 3 1 GLU D 73 ? ? -73.98 35.90 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 1 ? A SER 1 2 1 Y 1 A GLY 2 ? A GLY 2 3 1 Y 1 B GLU 73 ? B GLU 34 4 1 Y 1 B SER 74 ? B SER 35 5 1 Y 1 B ILE 75 ? B ILE 36 6 1 Y 1 B LYS 76 ? B LYS 37 7 1 Y 1 B LYS 77 ? B LYS 38 8 1 Y 1 D ILE 75 ? D ILE 36 9 1 Y 1 D LYS 76 ? D LYS 37 10 1 Y 1 D LYS 77 ? D LYS 38 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'SULFATE ION' SO4 4 1,2-ETHANEDIOL EDO 5 '1-ETHOXY-2-(2-ETHOXYETHOXY)ETHANE' P4G 6 water HOH #