data_5CMZ # _entry.id 5CMZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5CMZ pdb_00005cmz 10.2210/pdb5cmz/pdb WWPDB D_1000211900 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-09-16 2 'Structure model' 1 1 2024-10-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_entry_details 5 2 'Structure model' pdbx_modification_feature 6 2 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5CMZ _pdbx_database_status.recvd_initial_deposition_date 2015-07-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 5CMU unspecified PDB . 5CN0 unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zhu, Y.' 1 'Ye, S.' 2 'Zhang, R.' 3 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Rep' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2045-2322 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 5 _citation.language ? _citation.page_first 13028 _citation.page_last 13028 _citation.title ;Improved Pharmacological and Structural Properties of HIV Fusion Inhibitor AP3 over Enfuvirtide: Highlighting Advantages of Artificial Peptide Strategy. ; _citation.year 2015 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/srep13028 _citation.pdbx_database_id_PubMed 26286358 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhu, X.' 1 ? primary 'Zhu, Y.' 2 ? primary 'Ye, S.' 3 ? primary 'Wang, Q.' 4 ? primary 'Xu, W.' 5 ? primary 'Su, S.' 6 ? primary 'Sun, Z.' 7 ? primary 'Yu, F.' 8 ? primary 'Liu, Q.' 9 ? primary 'Wang, C.' 10 ? primary 'Zhang, T.' 11 ? primary 'Zhang, Z.' 12 ? primary 'Zhang, X.' 13 ? primary 'Xu, J.' 14 ? primary 'Du, L.' 15 ? primary 'Liu, K.' 16 ? primary 'Lu, L.' 17 ? primary 'Zhang, R.' 18 ? primary 'Jiang, S.' 19 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Envelope glycoprotein' 5230.056 2 ? ? 'UNP RESIDUES 35-79' ? 2 polymer syn 'Artificial HIV entry inhibitor AP3' 4682.471 2 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 4 non-polymer syn 1,2-ETHANEDIOL 62.068 1 ? ? ? ? 5 non-polymer nat '1-ETHOXY-2-(2-ETHOXYETHOXY)ETHANE' 162.227 1 ? ? ? ? 6 water nat water 18.015 37 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name go41 # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no yes 'SGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQ(NH2)' SGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQX A,C ? 2 'polypeptide(L)' no yes '(ACE)MTWEEWDKKIEELIKKSEELIKKIEEQIKKQEESIKK' XMTWEEWDKKIEELIKKSEELIKKIEEQIKKQEESIKK B,D ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'SULFATE ION' SO4 4 1,2-ETHANEDIOL EDO 5 '1-ETHOXY-2-(2-ETHOXYETHOXY)ETHANE' P4G 6 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 GLY n 1 3 ILE n 1 4 VAL n 1 5 GLN n 1 6 GLN n 1 7 GLN n 1 8 ASN n 1 9 ASN n 1 10 LEU n 1 11 LEU n 1 12 ARG n 1 13 ALA n 1 14 ILE n 1 15 GLU n 1 16 ALA n 1 17 GLN n 1 18 GLN n 1 19 HIS n 1 20 LEU n 1 21 LEU n 1 22 GLN n 1 23 LEU n 1 24 THR n 1 25 VAL n 1 26 TRP n 1 27 GLY n 1 28 ILE n 1 29 LYS n 1 30 GLN n 1 31 LEU n 1 32 GLN n 1 33 ALA n 1 34 ARG n 1 35 ILE n 1 36 LEU n 1 37 ALA n 1 38 VAL n 1 39 GLU n 1 40 ARG n 1 41 TYR n 1 42 LEU n 1 43 LYS n 1 44 ASP n 1 45 GLN n 1 46 NH2 n 2 1 ACE n 2 2 MET n 2 3 THR n 2 4 TRP n 2 5 GLU n 2 6 GLU n 2 7 TRP n 2 8 ASP n 2 9 LYS n 2 10 LYS n 2 11 ILE n 2 12 GLU n 2 13 GLU n 2 14 LEU n 2 15 ILE n 2 16 LYS n 2 17 LYS n 2 18 SER n 2 19 GLU n 2 20 GLU n 2 21 LEU n 2 22 ILE n 2 23 LYS n 2 24 LYS n 2 25 ILE n 2 26 GLU n 2 27 GLU n 2 28 GLN n 2 29 ILE n 2 30 LYS n 2 31 LYS n 2 32 GLN n 2 33 GLU n 2 34 GLU n 2 35 SER n 2 36 ILE n 2 37 LYS n 2 38 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 46 _entity_src_gen.gene_src_common_name HIV1 _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene env _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Human immunodeficiency virus 1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 11676 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 38 _pdbx_entity_src_syn.organism_scientific 'synthetic construct' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 32630 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 P4G non-polymer . '1-ETHOXY-2-(2-ETHOXYETHOXY)ETHANE' ? 'C8 H18 O3' 162.227 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 ? ? ? A . n A 1 2 GLY 2 2 ? ? ? A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 GLN 6 6 6 GLN GLN A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 HIS 19 19 19 HIS HIS A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 TRP 26 26 26 TRP TRP A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 TYR 41 41 41 TYR TYR A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 NH2 46 100 100 NH2 NH2 A . n B 2 1 ACE 1 40 40 ACE ACE B . n B 2 2 MET 2 41 41 MET MET B . n B 2 3 THR 3 42 42 THR THR B . n B 2 4 TRP 4 43 43 TRP TRP B . n B 2 5 GLU 5 44 44 GLU GLU B . n B 2 6 GLU 6 45 45 GLU GLU B . n B 2 7 TRP 7 46 46 TRP TRP B . n B 2 8 ASP 8 47 47 ASP ASP B . n B 2 9 LYS 9 48 48 LYS LYS B . n B 2 10 LYS 10 49 49 LYS LYS B . n B 2 11 ILE 11 50 50 ILE ILE B . n B 2 12 GLU 12 51 51 GLU GLU B . n B 2 13 GLU 13 52 52 GLU GLU B . n B 2 14 LEU 14 53 53 LEU LEU B . n B 2 15 ILE 15 54 54 ILE ILE B . n B 2 16 LYS 16 55 55 LYS LYS B . n B 2 17 LYS 17 56 56 LYS LYS B . n B 2 18 SER 18 57 57 SER SER B . n B 2 19 GLU 19 58 58 GLU GLU B . n B 2 20 GLU 20 59 59 GLU GLU B . n B 2 21 LEU 21 60 60 LEU LEU B . n B 2 22 ILE 22 61 61 ILE ILE B . n B 2 23 LYS 23 62 62 LYS LYS B . n B 2 24 LYS 24 63 63 LYS LYS B . n B 2 25 ILE 25 64 64 ILE ILE B . n B 2 26 GLU 26 65 65 GLU GLU B . n B 2 27 GLU 27 66 66 GLU GLU B . n B 2 28 GLN 28 67 67 GLN GLN B . n B 2 29 ILE 29 68 68 ILE ILE B . n B 2 30 LYS 30 69 69 LYS LYS B . n B 2 31 LYS 31 70 70 LYS LYS B . n B 2 32 GLN 32 71 71 GLN GLN B . n B 2 33 GLU 33 72 72 GLU GLU B . n B 2 34 GLU 34 73 ? ? ? B . n B 2 35 SER 35 74 ? ? ? B . n B 2 36 ILE 36 75 ? ? ? B . n B 2 37 LYS 37 76 ? ? ? B . n B 2 38 LYS 38 77 ? ? ? B . n C 1 1 SER 1 1 1 SER SER C . n C 1 2 GLY 2 2 2 GLY GLY C . n C 1 3 ILE 3 3 3 ILE ILE C . n C 1 4 VAL 4 4 4 VAL VAL C . n C 1 5 GLN 5 5 5 GLN GLN C . n C 1 6 GLN 6 6 6 GLN GLN C . n C 1 7 GLN 7 7 7 GLN GLN C . n C 1 8 ASN 8 8 8 ASN ASN C . n C 1 9 ASN 9 9 9 ASN ASN C . n C 1 10 LEU 10 10 10 LEU LEU C . n C 1 11 LEU 11 11 11 LEU LEU C . n C 1 12 ARG 12 12 12 ARG ARG C . n C 1 13 ALA 13 13 13 ALA ALA C . n C 1 14 ILE 14 14 14 ILE ILE C . n C 1 15 GLU 15 15 15 GLU GLU C . n C 1 16 ALA 16 16 16 ALA ALA C . n C 1 17 GLN 17 17 17 GLN GLN C . n C 1 18 GLN 18 18 18 GLN GLN C . n C 1 19 HIS 19 19 19 HIS HIS C . n C 1 20 LEU 20 20 20 LEU LEU C . n C 1 21 LEU 21 21 21 LEU LEU C . n C 1 22 GLN 22 22 22 GLN GLN C . n C 1 23 LEU 23 23 23 LEU LEU C . n C 1 24 THR 24 24 24 THR THR C . n C 1 25 VAL 25 25 25 VAL VAL C . n C 1 26 TRP 26 26 26 TRP TRP C . n C 1 27 GLY 27 27 27 GLY GLY C . n C 1 28 ILE 28 28 28 ILE ILE C . n C 1 29 LYS 29 29 29 LYS LYS C . n C 1 30 GLN 30 30 30 GLN GLN C . n C 1 31 LEU 31 31 31 LEU LEU C . n C 1 32 GLN 32 32 32 GLN GLN C . n C 1 33 ALA 33 33 33 ALA ALA C . n C 1 34 ARG 34 34 34 ARG ARG C . n C 1 35 ILE 35 35 35 ILE ILE C . n C 1 36 LEU 36 36 36 LEU LEU C . n C 1 37 ALA 37 37 37 ALA ALA C . n C 1 38 VAL 38 38 38 VAL VAL C . n C 1 39 GLU 39 39 39 GLU GLU C . n C 1 40 ARG 40 40 40 ARG ARG C . n C 1 41 TYR 41 41 41 TYR TYR C . n C 1 42 LEU 42 42 42 LEU LEU C . n C 1 43 LYS 43 43 43 LYS LYS C . n C 1 44 ASP 44 44 44 ASP ASP C . n C 1 45 GLN 45 45 45 GLN GLN C . n C 1 46 NH2 46 100 100 NH2 NH2 C . n D 2 1 ACE 1 40 40 ACE ACE D . n D 2 2 MET 2 41 41 MET MET D . n D 2 3 THR 3 42 42 THR THR D . n D 2 4 TRP 4 43 43 TRP TRP D . n D 2 5 GLU 5 44 44 GLU GLU D . n D 2 6 GLU 6 45 45 GLU GLU D . n D 2 7 TRP 7 46 46 TRP TRP D . n D 2 8 ASP 8 47 47 ASP ASP D . n D 2 9 LYS 9 48 48 LYS LYS D . n D 2 10 LYS 10 49 49 LYS LYS D . n D 2 11 ILE 11 50 50 ILE ILE D . n D 2 12 GLU 12 51 51 GLU GLU D . n D 2 13 GLU 13 52 52 GLU GLU D . n D 2 14 LEU 14 53 53 LEU LEU D . n D 2 15 ILE 15 54 54 ILE ILE D . n D 2 16 LYS 16 55 55 LYS LYS D . n D 2 17 LYS 17 56 56 LYS LYS D . n D 2 18 SER 18 57 57 SER SER D . n D 2 19 GLU 19 58 58 GLU GLU D . n D 2 20 GLU 20 59 59 GLU GLU D . n D 2 21 LEU 21 60 60 LEU LEU D . n D 2 22 ILE 22 61 61 ILE ILE D . n D 2 23 LYS 23 62 62 LYS LYS D . n D 2 24 LYS 24 63 63 LYS LYS D . n D 2 25 ILE 25 64 64 ILE ILE D . n D 2 26 GLU 26 65 65 GLU GLU D . n D 2 27 GLU 27 66 66 GLU GLU D . n D 2 28 GLN 28 67 67 GLN GLN D . n D 2 29 ILE 29 68 68 ILE ILE D . n D 2 30 LYS 30 69 69 LYS LYS D . n D 2 31 LYS 31 70 70 LYS LYS D . n D 2 32 GLN 32 71 71 GLN GLN D . n D 2 33 GLU 33 72 72 GLU GLU D . n D 2 34 GLU 34 73 73 GLU GLU D . n D 2 35 SER 35 74 74 SER SER D . n D 2 36 ILE 36 75 ? ? ? D . n D 2 37 LYS 37 76 ? ? ? D . n D 2 38 LYS 38 77 ? ? ? D . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code E 3 SO4 1 201 61 SO4 SO4 A . F 4 EDO 1 202 62 EDO EDO A . G 5 P4G 1 203 63 P4G P4G A . H 6 HOH 1 301 26 HOH HOH A . H 6 HOH 2 302 28 HOH HOH A . H 6 HOH 3 303 16 HOH HOH A . H 6 HOH 4 304 19 HOH HOH A . H 6 HOH 5 305 24 HOH HOH A . H 6 HOH 6 306 20 HOH HOH A . H 6 HOH 7 307 3 HOH HOH A . H 6 HOH 8 308 32 HOH HOH A . H 6 HOH 9 309 1 HOH HOH A . H 6 HOH 10 310 18 HOH HOH A . H 6 HOH 11 311 11 HOH HOH A . H 6 HOH 12 312 2 HOH HOH A . H 6 HOH 13 313 17 HOH HOH A . H 6 HOH 14 314 33 HOH HOH A . H 6 HOH 15 315 8 HOH HOH A . H 6 HOH 16 316 34 HOH HOH A . H 6 HOH 17 317 37 HOH HOH A . H 6 HOH 18 318 14 HOH HOH A . H 6 HOH 19 319 22 HOH HOH A . I 6 HOH 1 101 23 HOH HOH B . I 6 HOH 2 102 21 HOH HOH B . J 6 HOH 1 201 12 HOH HOH C . J 6 HOH 2 202 35 HOH HOH C . J 6 HOH 3 203 29 HOH HOH C . J 6 HOH 4 204 7 HOH HOH C . J 6 HOH 5 205 31 HOH HOH C . J 6 HOH 6 206 6 HOH HOH C . J 6 HOH 7 207 4 HOH HOH C . J 6 HOH 8 208 5 HOH HOH C . J 6 HOH 9 209 13 HOH HOH C . J 6 HOH 10 210 36 HOH HOH C . J 6 HOH 11 211 10 HOH HOH C . J 6 HOH 12 212 9 HOH HOH C . J 6 HOH 13 213 15 HOH HOH C . J 6 HOH 14 214 30 HOH HOH C . J 6 HOH 15 215 27 HOH HOH C . K 6 HOH 1 101 25 HOH HOH D . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.8.1_1168 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5CMZ _cell.details ? _cell.formula_units_Z ? _cell.length_a 44.403 _cell.length_a_esd ? _cell.length_b 44.403 _cell.length_b_esd ? _cell.length_c 227.897 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5CMZ _symmetry.cell_setting ? _symmetry.Int_Tables_number 173 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 63' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5CMZ _exptl.crystals_number ? _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.33 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 63.06 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2M Ammonium Sulfate, 0.1M Bis-Tris pH 6.5, 25% w/v PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'PSI PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-09-26 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.03317 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17U' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.03317 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17U _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5CMZ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.57 _reflns.d_resolution_low 38 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 61523 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.7 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 27.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5CMZ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.574 _refine.ls_d_res_low 37.983 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7574 _refine.ls_number_reflns_R_free 340 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 93.98 _refine.ls_percent_reflns_R_free 4.49 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2458 _refine.ls_R_factor_R_free 0.2642 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2448 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.40 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 29.98 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.21 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1317 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 20 _refine_hist.number_atoms_solvent 37 _refine_hist.number_atoms_total 1374 _refine_hist.d_res_high 2.574 _refine_hist.d_res_low 37.983 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.004 ? 1367 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.471 ? 1820 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 16.319 ? 547 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.034 ? 203 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.001 ? 226 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.5743 3.2430 . . 166 3393 89.00 . . . 0.2908 . 0.2606 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2430 10 . . 174 3841 99.00 . . . 0.2520 . 0.2382 . . . . . . . . . . # _struct.entry_id 5CMZ _struct.title 'Artificial HIV fusion inhibitor AP3 fused to the C-terminus of gp41 NHR' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5CMZ _struct_keywords.text 'Enfuvirtide, HIV fusion inhibitor, AP3, gp41, 6-HB, VIRAL PROTEIN-INHIBITOR complex' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN/INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 1 ? D N N 2 ? E N N 3 ? F N N 4 ? G N N 5 ? H N N 6 ? I N N 6 ? J N N 6 ? K N N 6 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP Q1HMR5_9HIV1 Q1HMR5 ? 1 SGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQ 35 2 PDB 5CMZ 5CMZ ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5CMZ A 1 ? 45 ? Q1HMR5 35 ? 79 ? 1 45 2 2 5CMZ B 1 ? 38 ? 5CMZ 40 ? 77 ? 40 77 3 1 5CMZ C 1 ? 45 ? Q1HMR5 35 ? 79 ? 1 45 4 2 5CMZ D 1 ? 38 ? 5CMZ 40 ? 77 ? 40 77 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5CMZ NH2 A 46 ? UNP Q1HMR5 ? ? amidation 100 1 3 5CMZ NH2 C 46 ? UNP Q1HMR5 ? ? amidation 100 2 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA hexameric 6 2 author_and_software_defined_assembly PISA hexameric 6 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 12980 ? 1 MORE -130 ? 1 'SSA (A^2)' 12740 ? 2 'ABSA (A^2)' 12690 ? 2 MORE -100 ? 2 'SSA (A^2)' 14670 ? # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1,2,4 A,B,E,F,G,H,I 2 1,3,5 C,D,J,K # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_565 -y,x-y+1,z -0.5000000000 -0.8660254038 0.0000000000 -22.2015000000 0.8660254038 -0.5000000000 0.0000000000 38.4541260042 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 2_455 -y-1,x-y,z -0.5000000000 -0.8660254038 0.0000000000 -44.4030000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 3_455 -x+y-1,-x,z -0.5000000000 0.8660254038 0.0000000000 -44.4030000000 -0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 5 'crystal symmetry operation' 3_445 -x+y-1,-x-1,z -0.5000000000 0.8660254038 0.0000000000 -22.2015000000 -0.8660254038 -0.5000000000 0.0000000000 -38.4541260042 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ILE A 3 ? GLN A 45 ? ILE A 3 GLN A 45 1 ? 43 HELX_P HELX_P2 AA2 THR B 3 ? LYS B 31 ? THR B 42 LYS B 70 1 ? 29 HELX_P HELX_P3 AA3 ILE C 3 ? GLN C 45 ? ILE C 3 GLN C 45 1 ? 43 HELX_P HELX_P4 AA4 THR D 3 ? GLN D 32 ? THR D 42 GLN D 71 1 ? 30 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A GLN 45 C ? ? ? 1_555 A NH2 46 N ? ? A GLN 45 A NH2 100 1_555 ? ? ? ? ? ? ? 1.210 ? ? covale2 covale both ? B ACE 1 C ? ? ? 1_555 B MET 2 N ? ? B ACE 40 B MET 41 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale3 covale both ? C GLN 45 C ? ? ? 1_555 C NH2 46 N ? ? C GLN 45 C NH2 100 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale4 covale both ? D ACE 1 C ? ? ? 1_555 D MET 2 N ? ? D ACE 40 D MET 41 1_555 ? ? ? ? ? ? ? 1.303 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 ACE B 1 ? MET B 2 ? ACE B 40 ? 1_555 MET B 41 ? 1_555 . . MET 4 ACE None 'Terminal acetylation' 2 ACE D 1 ? MET D 2 ? ACE D 40 ? 1_555 MET D 41 ? 1_555 . . MET 4 ACE None 'Terminal acetylation' 3 NH2 A 46 ? GLN A 45 ? NH2 A 100 ? 1_555 GLN A 45 ? 1_555 . . GLN 18 NH2 None 'Terminal amidation' 4 NH2 C 46 ? GLN C 45 ? NH2 C 100 ? 1_555 GLN C 45 ? 1_555 . . GLN 18 NH2 None 'Terminal amidation' # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 201 ? 6 'binding site for residue SO4 A 201' AC2 Software A EDO 202 ? 3 'binding site for residue EDO A 202' AC3 Software C GLN 45 ? 4 'binding site for Di-peptide GLN C 45 and NH2 C 100' AC4 Software D ACE 40 ? 5 'binding site for Di-peptide ACE D 40 and MET D 41' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 ARG A 40 ? ARG A 40 . ? 1_555 ? 2 AC1 6 LYS A 43 ? LYS A 43 . ? 1_555 ? 3 AC1 6 HOH H . ? HOH A 301 . ? 1_555 ? 4 AC1 6 HOH H . ? HOH A 304 . ? 1_555 ? 5 AC1 6 ARG C 40 ? ARG C 40 . ? 1_555 ? 6 AC1 6 LYS C 43 ? LYS C 43 . ? 1_555 ? 7 AC2 3 ALA A 37 ? ALA A 37 . ? 1_555 ? 8 AC2 3 ASP A 44 ? ASP A 44 . ? 1_555 ? 9 AC2 3 HOH H . ? HOH A 310 . ? 1_555 ? 10 AC3 4 TYR C 41 ? TYR C 41 . ? 1_555 ? 11 AC3 4 LEU C 42 ? LEU C 42 . ? 1_555 ? 12 AC3 4 LYS C 43 ? LYS C 43 . ? 1_555 ? 13 AC3 4 ASP C 44 ? ASP C 44 . ? 1_555 ? 14 AC4 5 TRP C 26 ? TRP C 26 . ? 2_455 ? 15 AC4 5 THR D 3 ? THR D 42 . ? 1_555 ? 16 AC4 5 GLU D 6 ? GLU D 45 . ? 1_555 ? 17 AC4 5 TRP D 7 ? TRP D 46 . ? 1_555 ? 18 AC4 5 LYS D 10 ? LYS D 49 . ? 1_555 ? # _pdbx_entry_details.entry_id 5CMZ _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 CH3 D ACE 40 ? ? N D MET 41 ? ? 1.65 2 1 O A HOH 313 ? ? O C HOH 212 ? ? 1.85 3 1 O C HOH 202 ? ? O C HOH 214 ? ? 2.11 4 1 OD1 C ASP 44 ? ? O C HOH 201 ? ? 2.12 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 302 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 B _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 101 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 2_565 _pdbx_validate_symm_contact.dist 2.17 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 O B ACE 40 ? ? C B ACE 40 ? ? N B MET 41 ? ? 105.85 122.70 -16.85 1.60 Y 2 1 O D ACE 40 ? ? C D ACE 40 ? ? N D MET 41 ? ? 96.45 122.70 -26.25 1.60 Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN B 71 ? ? -120.40 -68.95 2 1 GLN D 71 ? ? -73.03 44.98 3 1 GLU D 73 ? ? -73.98 35.90 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 305 ? H HOH . 2 1 A HOH 306 ? H HOH . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 1 ? A SER 1 2 1 Y 1 A GLY 2 ? A GLY 2 3 1 Y 1 B GLU 73 ? B GLU 34 4 1 Y 1 B SER 74 ? B SER 35 5 1 Y 1 B ILE 75 ? B ILE 36 6 1 Y 1 B LYS 76 ? B LYS 37 7 1 Y 1 B LYS 77 ? B LYS 38 8 1 Y 1 D ILE 75 ? D ILE 36 9 1 Y 1 D LYS 76 ? D LYS 37 10 1 Y 1 D LYS 77 ? D LYS 38 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ACE C C N N 1 ACE O O N N 2 ACE CH3 C N N 3 ACE H H N N 4 ACE H1 H N N 5 ACE H2 H N N 6 ACE H3 H N N 7 ALA N N N N 8 ALA CA C N S 9 ALA C C N N 10 ALA O O N N 11 ALA CB C N N 12 ALA OXT O N N 13 ALA H H N N 14 ALA H2 H N N 15 ALA HA H N N 16 ALA HB1 H N N 17 ALA HB2 H N N 18 ALA HB3 H N N 19 ALA HXT H N N 20 ARG N N N N 21 ARG CA C N S 22 ARG C C N N 23 ARG O O N N 24 ARG CB C N N 25 ARG CG C N N 26 ARG CD C N N 27 ARG NE N N N 28 ARG CZ C N N 29 ARG NH1 N N N 30 ARG NH2 N N N 31 ARG OXT O N N 32 ARG H H N N 33 ARG H2 H N N 34 ARG HA H N N 35 ARG HB2 H N N 36 ARG HB3 H N N 37 ARG HG2 H N N 38 ARG HG3 H N N 39 ARG HD2 H N N 40 ARG HD3 H N N 41 ARG HE H N N 42 ARG HH11 H N N 43 ARG HH12 H N N 44 ARG HH21 H N N 45 ARG HH22 H N N 46 ARG HXT H N N 47 ASN N N N N 48 ASN CA C N S 49 ASN C C N N 50 ASN O O N N 51 ASN CB C N N 52 ASN CG C N N 53 ASN OD1 O N N 54 ASN ND2 N N N 55 ASN OXT O N N 56 ASN H H N N 57 ASN H2 H N N 58 ASN HA H N N 59 ASN HB2 H N N 60 ASN HB3 H N N 61 ASN HD21 H N N 62 ASN HD22 H N N 63 ASN HXT H N N 64 ASP N N N N 65 ASP CA C N S 66 ASP C C N N 67 ASP O O N N 68 ASP CB C N N 69 ASP CG C N N 70 ASP OD1 O N N 71 ASP OD2 O N N 72 ASP OXT O N N 73 ASP H H N N 74 ASP H2 H N N 75 ASP HA H N N 76 ASP HB2 H N N 77 ASP HB3 H N N 78 ASP HD2 H N N 79 ASP HXT H N N 80 EDO C1 C N N 81 EDO O1 O N N 82 EDO C2 C N N 83 EDO O2 O N N 84 EDO H11 H N N 85 EDO H12 H N N 86 EDO HO1 H N N 87 EDO H21 H N N 88 EDO H22 H N N 89 EDO HO2 H N N 90 GLN N N N N 91 GLN CA C N S 92 GLN C C N N 93 GLN O O N N 94 GLN CB C N N 95 GLN CG C N N 96 GLN CD C N N 97 GLN OE1 O N N 98 GLN NE2 N N N 99 GLN OXT O N N 100 GLN H H N N 101 GLN H2 H N N 102 GLN HA H N N 103 GLN HB2 H N N 104 GLN HB3 H N N 105 GLN HG2 H N N 106 GLN HG3 H N N 107 GLN HE21 H N N 108 GLN HE22 H N N 109 GLN HXT H N N 110 GLU N N N N 111 GLU CA C N S 112 GLU C C N N 113 GLU O O N N 114 GLU CB C N N 115 GLU CG C N N 116 GLU CD C N N 117 GLU OE1 O N N 118 GLU OE2 O N N 119 GLU OXT O N N 120 GLU H H N N 121 GLU H2 H N N 122 GLU HA H N N 123 GLU HB2 H N N 124 GLU HB3 H N N 125 GLU HG2 H N N 126 GLU HG3 H N N 127 GLU HE2 H N N 128 GLU HXT H N N 129 GLY N N N N 130 GLY CA C N N 131 GLY C C N N 132 GLY O O N N 133 GLY OXT O N N 134 GLY H H N N 135 GLY H2 H N N 136 GLY HA2 H N N 137 GLY HA3 H N N 138 GLY HXT H N N 139 HIS N N N N 140 HIS CA C N S 141 HIS C C N N 142 HIS O O N N 143 HIS CB C N N 144 HIS CG C Y N 145 HIS ND1 N Y N 146 HIS CD2 C Y N 147 HIS CE1 C Y N 148 HIS NE2 N Y N 149 HIS OXT O N N 150 HIS H H N N 151 HIS H2 H N N 152 HIS HA H N N 153 HIS HB2 H N N 154 HIS HB3 H N N 155 HIS HD1 H N N 156 HIS HD2 H N N 157 HIS HE1 H N N 158 HIS HE2 H N N 159 HIS HXT H N N 160 HOH O O N N 161 HOH H1 H N N 162 HOH H2 H N N 163 ILE N N N N 164 ILE CA C N S 165 ILE C C N N 166 ILE O O N N 167 ILE CB C N S 168 ILE CG1 C N N 169 ILE CG2 C N N 170 ILE CD1 C N N 171 ILE OXT O N N 172 ILE H H N N 173 ILE H2 H N N 174 ILE HA H N N 175 ILE HB H N N 176 ILE HG12 H N N 177 ILE HG13 H N N 178 ILE HG21 H N N 179 ILE HG22 H N N 180 ILE HG23 H N N 181 ILE HD11 H N N 182 ILE HD12 H N N 183 ILE HD13 H N N 184 ILE HXT H N N 185 LEU N N N N 186 LEU CA C N S 187 LEU C C N N 188 LEU O O N N 189 LEU CB C N N 190 LEU CG C N N 191 LEU CD1 C N N 192 LEU CD2 C N N 193 LEU OXT O N N 194 LEU H H N N 195 LEU H2 H N N 196 LEU HA H N N 197 LEU HB2 H N N 198 LEU HB3 H N N 199 LEU HG H N N 200 LEU HD11 H N N 201 LEU HD12 H N N 202 LEU HD13 H N N 203 LEU HD21 H N N 204 LEU HD22 H N N 205 LEU HD23 H N N 206 LEU HXT H N N 207 LYS N N N N 208 LYS CA C N S 209 LYS C C N N 210 LYS O O N N 211 LYS CB C N N 212 LYS CG C N N 213 LYS CD C N N 214 LYS CE C N N 215 LYS NZ N N N 216 LYS OXT O N N 217 LYS H H N N 218 LYS H2 H N N 219 LYS HA H N N 220 LYS HB2 H N N 221 LYS HB3 H N N 222 LYS HG2 H N N 223 LYS HG3 H N N 224 LYS HD2 H N N 225 LYS HD3 H N N 226 LYS HE2 H N N 227 LYS HE3 H N N 228 LYS HZ1 H N N 229 LYS HZ2 H N N 230 LYS HZ3 H N N 231 LYS HXT H N N 232 MET N N N N 233 MET CA C N S 234 MET C C N N 235 MET O O N N 236 MET CB C N N 237 MET CG C N N 238 MET SD S N N 239 MET CE C N N 240 MET OXT O N N 241 MET H H N N 242 MET H2 H N N 243 MET HA H N N 244 MET HB2 H N N 245 MET HB3 H N N 246 MET HG2 H N N 247 MET HG3 H N N 248 MET HE1 H N N 249 MET HE2 H N N 250 MET HE3 H N N 251 MET HXT H N N 252 NH2 N N N N 253 NH2 HN1 H N N 254 NH2 HN2 H N N 255 P4G C8 C N N 256 P4G C7 C N N 257 P4G O4 O N N 258 P4G C6 C N N 259 P4G C5 C N N 260 P4G O3 O N N 261 P4G C4 C N N 262 P4G C3 C N N 263 P4G O2 O N N 264 P4G C2 C N N 265 P4G C1 C N N 266 P4G H81 H N N 267 P4G H82 H N N 268 P4G H83 H N N 269 P4G H71 H N N 270 P4G H72 H N N 271 P4G H61 H N N 272 P4G H62 H N N 273 P4G H51 H N N 274 P4G H52 H N N 275 P4G H41 H N N 276 P4G H42 H N N 277 P4G H31 H N N 278 P4G H32 H N N 279 P4G H21 H N N 280 P4G H22 H N N 281 P4G H11 H N N 282 P4G H12 H N N 283 P4G H13 H N N 284 SER N N N N 285 SER CA C N S 286 SER C C N N 287 SER O O N N 288 SER CB C N N 289 SER OG O N N 290 SER OXT O N N 291 SER H H N N 292 SER H2 H N N 293 SER HA H N N 294 SER HB2 H N N 295 SER HB3 H N N 296 SER HG H N N 297 SER HXT H N N 298 SO4 S S N N 299 SO4 O1 O N N 300 SO4 O2 O N N 301 SO4 O3 O N N 302 SO4 O4 O N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ACE C O doub N N 1 ACE C CH3 sing N N 2 ACE C H sing N N 3 ACE CH3 H1 sing N N 4 ACE CH3 H2 sing N N 5 ACE CH3 H3 sing N N 6 ALA N CA sing N N 7 ALA N H sing N N 8 ALA N H2 sing N N 9 ALA CA C sing N N 10 ALA CA CB sing N N 11 ALA CA HA sing N N 12 ALA C O doub N N 13 ALA C OXT sing N N 14 ALA CB HB1 sing N N 15 ALA CB HB2 sing N N 16 ALA CB HB3 sing N N 17 ALA OXT HXT sing N N 18 ARG N CA sing N N 19 ARG N H sing N N 20 ARG N H2 sing N N 21 ARG CA C sing N N 22 ARG CA CB sing N N 23 ARG CA HA sing N N 24 ARG C O doub N N 25 ARG C OXT sing N N 26 ARG CB CG sing N N 27 ARG CB HB2 sing N N 28 ARG CB HB3 sing N N 29 ARG CG CD sing N N 30 ARG CG HG2 sing N N 31 ARG CG HG3 sing N N 32 ARG CD NE sing N N 33 ARG CD HD2 sing N N 34 ARG CD HD3 sing N N 35 ARG NE CZ sing N N 36 ARG NE HE sing N N 37 ARG CZ NH1 sing N N 38 ARG CZ NH2 doub N N 39 ARG NH1 HH11 sing N N 40 ARG NH1 HH12 sing N N 41 ARG NH2 HH21 sing N N 42 ARG NH2 HH22 sing N N 43 ARG OXT HXT sing N N 44 ASN N CA sing N N 45 ASN N H sing N N 46 ASN N H2 sing N N 47 ASN CA C sing N N 48 ASN CA CB sing N N 49 ASN CA HA sing N N 50 ASN C O doub N N 51 ASN C OXT sing N N 52 ASN CB CG sing N N 53 ASN CB HB2 sing N N 54 ASN CB HB3 sing N N 55 ASN CG OD1 doub N N 56 ASN CG ND2 sing N N 57 ASN ND2 HD21 sing N N 58 ASN ND2 HD22 sing N N 59 ASN OXT HXT sing N N 60 ASP N CA sing N N 61 ASP N H sing N N 62 ASP N H2 sing N N 63 ASP CA C sing N N 64 ASP CA CB sing N N 65 ASP CA HA sing N N 66 ASP C O doub N N 67 ASP C OXT sing N N 68 ASP CB CG sing N N 69 ASP CB HB2 sing N N 70 ASP CB HB3 sing N N 71 ASP CG OD1 doub N N 72 ASP CG OD2 sing N N 73 ASP OD2 HD2 sing N N 74 ASP OXT HXT sing N N 75 EDO C1 O1 sing N N 76 EDO C1 C2 sing N N 77 EDO C1 H11 sing N N 78 EDO C1 H12 sing N N 79 EDO O1 HO1 sing N N 80 EDO C2 O2 sing N N 81 EDO C2 H21 sing N N 82 EDO C2 H22 sing N N 83 EDO O2 HO2 sing N N 84 GLN N CA sing N N 85 GLN N H sing N N 86 GLN N H2 sing N N 87 GLN CA C sing N N 88 GLN CA CB sing N N 89 GLN CA HA sing N N 90 GLN C O doub N N 91 GLN C OXT sing N N 92 GLN CB CG sing N N 93 GLN CB HB2 sing N N 94 GLN CB HB3 sing N N 95 GLN CG CD sing N N 96 GLN CG HG2 sing N N 97 GLN CG HG3 sing N N 98 GLN CD OE1 doub N N 99 GLN CD NE2 sing N N 100 GLN NE2 HE21 sing N N 101 GLN NE2 HE22 sing N N 102 GLN OXT HXT sing N N 103 GLU N CA sing N N 104 GLU N H sing N N 105 GLU N H2 sing N N 106 GLU CA C sing N N 107 GLU CA CB sing N N 108 GLU CA HA sing N N 109 GLU C O doub N N 110 GLU C OXT sing N N 111 GLU CB CG sing N N 112 GLU CB HB2 sing N N 113 GLU CB HB3 sing N N 114 GLU CG CD sing N N 115 GLU CG HG2 sing N N 116 GLU CG HG3 sing N N 117 GLU CD OE1 doub N N 118 GLU CD OE2 sing N N 119 GLU OE2 HE2 sing N N 120 GLU OXT HXT sing N N 121 GLY N CA sing N N 122 GLY N H sing N N 123 GLY N H2 sing N N 124 GLY CA C sing N N 125 GLY CA HA2 sing N N 126 GLY CA HA3 sing N N 127 GLY C O doub N N 128 GLY C OXT sing N N 129 GLY OXT HXT sing N N 130 HIS N CA sing N N 131 HIS N H sing N N 132 HIS N H2 sing N N 133 HIS CA C sing N N 134 HIS CA CB sing N N 135 HIS CA HA sing N N 136 HIS C O doub N N 137 HIS C OXT sing N N 138 HIS CB CG sing N N 139 HIS CB HB2 sing N N 140 HIS CB HB3 sing N N 141 HIS CG ND1 sing Y N 142 HIS CG CD2 doub Y N 143 HIS ND1 CE1 doub Y N 144 HIS ND1 HD1 sing N N 145 HIS CD2 NE2 sing Y N 146 HIS CD2 HD2 sing N N 147 HIS CE1 NE2 sing Y N 148 HIS CE1 HE1 sing N N 149 HIS NE2 HE2 sing N N 150 HIS OXT HXT sing N N 151 HOH O H1 sing N N 152 HOH O H2 sing N N 153 ILE N CA sing N N 154 ILE N H sing N N 155 ILE N H2 sing N N 156 ILE CA C sing N N 157 ILE CA CB sing N N 158 ILE CA HA sing N N 159 ILE C O doub N N 160 ILE C OXT sing N N 161 ILE CB CG1 sing N N 162 ILE CB CG2 sing N N 163 ILE CB HB sing N N 164 ILE CG1 CD1 sing N N 165 ILE CG1 HG12 sing N N 166 ILE CG1 HG13 sing N N 167 ILE CG2 HG21 sing N N 168 ILE CG2 HG22 sing N N 169 ILE CG2 HG23 sing N N 170 ILE CD1 HD11 sing N N 171 ILE CD1 HD12 sing N N 172 ILE CD1 HD13 sing N N 173 ILE OXT HXT sing N N 174 LEU N CA sing N N 175 LEU N H sing N N 176 LEU N H2 sing N N 177 LEU CA C sing N N 178 LEU CA CB sing N N 179 LEU CA HA sing N N 180 LEU C O doub N N 181 LEU C OXT sing N N 182 LEU CB CG sing N N 183 LEU CB HB2 sing N N 184 LEU CB HB3 sing N N 185 LEU CG CD1 sing N N 186 LEU CG CD2 sing N N 187 LEU CG HG sing N N 188 LEU CD1 HD11 sing N N 189 LEU CD1 HD12 sing N N 190 LEU CD1 HD13 sing N N 191 LEU CD2 HD21 sing N N 192 LEU CD2 HD22 sing N N 193 LEU CD2 HD23 sing N N 194 LEU OXT HXT sing N N 195 LYS N CA sing N N 196 LYS N H sing N N 197 LYS N H2 sing N N 198 LYS CA C sing N N 199 LYS CA CB sing N N 200 LYS CA HA sing N N 201 LYS C O doub N N 202 LYS C OXT sing N N 203 LYS CB CG sing N N 204 LYS CB HB2 sing N N 205 LYS CB HB3 sing N N 206 LYS CG CD sing N N 207 LYS CG HG2 sing N N 208 LYS CG HG3 sing N N 209 LYS CD CE sing N N 210 LYS CD HD2 sing N N 211 LYS CD HD3 sing N N 212 LYS CE NZ sing N N 213 LYS CE HE2 sing N N 214 LYS CE HE3 sing N N 215 LYS NZ HZ1 sing N N 216 LYS NZ HZ2 sing N N 217 LYS NZ HZ3 sing N N 218 LYS OXT HXT sing N N 219 MET N CA sing N N 220 MET N H sing N N 221 MET N H2 sing N N 222 MET CA C sing N N 223 MET CA CB sing N N 224 MET CA HA sing N N 225 MET C O doub N N 226 MET C OXT sing N N 227 MET CB CG sing N N 228 MET CB HB2 sing N N 229 MET CB HB3 sing N N 230 MET CG SD sing N N 231 MET CG HG2 sing N N 232 MET CG HG3 sing N N 233 MET SD CE sing N N 234 MET CE HE1 sing N N 235 MET CE HE2 sing N N 236 MET CE HE3 sing N N 237 MET OXT HXT sing N N 238 NH2 N HN1 sing N N 239 NH2 N HN2 sing N N 240 P4G C8 C7 sing N N 241 P4G C8 H81 sing N N 242 P4G C8 H82 sing N N 243 P4G C8 H83 sing N N 244 P4G C7 O4 sing N N 245 P4G C7 H71 sing N N 246 P4G C7 H72 sing N N 247 P4G O4 C6 sing N N 248 P4G C6 C5 sing N N 249 P4G C6 H61 sing N N 250 P4G C6 H62 sing N N 251 P4G C5 O3 sing N N 252 P4G C5 H51 sing N N 253 P4G C5 H52 sing N N 254 P4G O3 C4 sing N N 255 P4G C4 C3 sing N N 256 P4G C4 H41 sing N N 257 P4G C4 H42 sing N N 258 P4G C3 O2 sing N N 259 P4G C3 H31 sing N N 260 P4G C3 H32 sing N N 261 P4G O2 C2 sing N N 262 P4G C2 C1 sing N N 263 P4G C2 H21 sing N N 264 P4G C2 H22 sing N N 265 P4G C1 H11 sing N N 266 P4G C1 H12 sing N N 267 P4G C1 H13 sing N N 268 SER N CA sing N N 269 SER N H sing N N 270 SER N H2 sing N N 271 SER CA C sing N N 272 SER CA CB sing N N 273 SER CA HA sing N N 274 SER C O doub N N 275 SER C OXT sing N N 276 SER CB OG sing N N 277 SER CB HB2 sing N N 278 SER CB HB3 sing N N 279 SER OG HG sing N N 280 SER OXT HXT sing N N 281 SO4 S O1 doub N N 282 SO4 S O2 doub N N 283 SO4 S O3 sing N N 284 SO4 S O4 sing N N 285 THR N CA sing N N 286 THR N H sing N N 287 THR N H2 sing N N 288 THR CA C sing N N 289 THR CA CB sing N N 290 THR CA HA sing N N 291 THR C O doub N N 292 THR C OXT sing N N 293 THR CB OG1 sing N N 294 THR CB CG2 sing N N 295 THR CB HB sing N N 296 THR OG1 HG1 sing N N 297 THR CG2 HG21 sing N N 298 THR CG2 HG22 sing N N 299 THR CG2 HG23 sing N N 300 THR OXT HXT sing N N 301 TRP N CA sing N N 302 TRP N H sing N N 303 TRP N H2 sing N N 304 TRP CA C sing N N 305 TRP CA CB sing N N 306 TRP CA HA sing N N 307 TRP C O doub N N 308 TRP C OXT sing N N 309 TRP CB CG sing N N 310 TRP CB HB2 sing N N 311 TRP CB HB3 sing N N 312 TRP CG CD1 doub Y N 313 TRP CG CD2 sing Y N 314 TRP CD1 NE1 sing Y N 315 TRP CD1 HD1 sing N N 316 TRP CD2 CE2 doub Y N 317 TRP CD2 CE3 sing Y N 318 TRP NE1 CE2 sing Y N 319 TRP NE1 HE1 sing N N 320 TRP CE2 CZ2 sing Y N 321 TRP CE3 CZ3 doub Y N 322 TRP CE3 HE3 sing N N 323 TRP CZ2 CH2 doub Y N 324 TRP CZ2 HZ2 sing N N 325 TRP CZ3 CH2 sing Y N 326 TRP CZ3 HZ3 sing N N 327 TRP CH2 HH2 sing N N 328 TRP OXT HXT sing N N 329 TYR N CA sing N N 330 TYR N H sing N N 331 TYR N H2 sing N N 332 TYR CA C sing N N 333 TYR CA CB sing N N 334 TYR CA HA sing N N 335 TYR C O doub N N 336 TYR C OXT sing N N 337 TYR CB CG sing N N 338 TYR CB HB2 sing N N 339 TYR CB HB3 sing N N 340 TYR CG CD1 doub Y N 341 TYR CG CD2 sing Y N 342 TYR CD1 CE1 sing Y N 343 TYR CD1 HD1 sing N N 344 TYR CD2 CE2 doub Y N 345 TYR CD2 HD2 sing N N 346 TYR CE1 CZ doub Y N 347 TYR CE1 HE1 sing N N 348 TYR CE2 CZ sing Y N 349 TYR CE2 HE2 sing N N 350 TYR CZ OH sing N N 351 TYR OH HH sing N N 352 TYR OXT HXT sing N N 353 VAL N CA sing N N 354 VAL N H sing N N 355 VAL N H2 sing N N 356 VAL CA C sing N N 357 VAL CA CB sing N N 358 VAL CA HA sing N N 359 VAL C O doub N N 360 VAL C OXT sing N N 361 VAL CB CG1 sing N N 362 VAL CB CG2 sing N N 363 VAL CB HB sing N N 364 VAL CG1 HG11 sing N N 365 VAL CG1 HG12 sing N N 366 VAL CG1 HG13 sing N N 367 VAL CG2 HG21 sing N N 368 VAL CG2 HG22 sing N N 369 VAL CG2 HG23 sing N N 370 VAL OXT HXT sing N N 371 # _atom_sites.entry_id 5CMZ _atom_sites.fract_transf_matrix[1][1] 0.022521 _atom_sites.fract_transf_matrix[1][2] 0.013003 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.026005 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004388 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_