data_5DKQ # _entry.id 5DKQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5DKQ pdb_00005dkq 10.2210/pdb5dkq/pdb WWPDB D_1000213356 ? ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 5DKN PDB . unspecified 5DKR PDB . # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5DKQ _pdbx_database_status.recvd_initial_deposition_date 2015-09-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Cavalier, M.C.' 1 'Ansari, M.I.' 2 'Pierce, A.D.' 3 'Wilder, P.T.' 4 'McKnight, L.E.' 5 'Raman, E.P.' 6 'Neau, D.B.' 7 'Bezawada, P.' 8 'Alasady, M.J.' 9 'Varney, K.M.' 10 'Toth, E.A.' 11 'MacKerell Jr., A.D.' 12 'Coop, A.' 13 'Weber, D.J.' 14 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 59 _citation.language ? _citation.page_first 592 _citation.page_last 608 _citation.title 'Small Molecule Inhibitors of Ca(2+)-S100B Reveal Two Protein Conformations.' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.5b01369 _citation.pdbx_database_id_PubMed 26727270 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Cavalier, M.C.' 1 ? primary 'Ansari, M.I.' 2 ? primary 'Pierce, A.D.' 3 ? primary 'Wilder, P.T.' 4 ? primary 'McKnight, L.E.' 5 ? primary 'Raman, E.P.' 6 ? primary 'Neau, D.B.' 7 ? primary 'Bezawada, P.' 8 ? primary 'Alasady, M.J.' 9 ? primary 'Charpentier, T.H.' 10 ? primary 'Varney, K.M.' 11 ? primary 'Toth, E.A.' 12 ? primary 'MacKerell, A.D.' 13 ? primary 'Coop, A.' 14 ? primary 'Weber, D.J.' 15 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5DKQ _cell.details ? _cell.formula_units_Z ? _cell.length_a 63.485 _cell.length_a_esd ? _cell.length_b 63.485 _cell.length_b_esd ? _cell.length_c 48.275 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5DKQ _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein S100-B' 10681.974 1 ? ? ? ? 2 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? 3 non-polymer syn "2,2'-[pentane-1,5-diylbis(oxybenzene-4,1-diyl)]di-1,4,5,6-tetrahydropyrimidine" 420.547 1 ? ? ? ? 4 water nat water 18.015 108 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'S-100 protein beta chain,S-100 protein subunit beta,S100 calcium-binding protein B' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAM ITTACHEFFEHE ; _entity_poly.pdbx_seq_one_letter_code_can ;MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAM ITTACHEFFEHE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 GLU n 1 4 LEU n 1 5 GLU n 1 6 LYS n 1 7 ALA n 1 8 VAL n 1 9 VAL n 1 10 ALA n 1 11 LEU n 1 12 ILE n 1 13 ASP n 1 14 VAL n 1 15 PHE n 1 16 HIS n 1 17 GLN n 1 18 TYR n 1 19 SER n 1 20 GLY n 1 21 ARG n 1 22 GLU n 1 23 GLY n 1 24 ASP n 1 25 LYS n 1 26 HIS n 1 27 LYS n 1 28 LEU n 1 29 LYS n 1 30 LYS n 1 31 SER n 1 32 GLU n 1 33 LEU n 1 34 LYS n 1 35 GLU n 1 36 LEU n 1 37 ILE n 1 38 ASN n 1 39 ASN n 1 40 GLU n 1 41 LEU n 1 42 SER n 1 43 HIS n 1 44 PHE n 1 45 LEU n 1 46 GLU n 1 47 GLU n 1 48 ILE n 1 49 LYS n 1 50 GLU n 1 51 GLN n 1 52 GLU n 1 53 VAL n 1 54 VAL n 1 55 ASP n 1 56 LYS n 1 57 VAL n 1 58 MET n 1 59 GLU n 1 60 THR n 1 61 LEU n 1 62 ASP n 1 63 SER n 1 64 ASP n 1 65 GLY n 1 66 ASP n 1 67 GLY n 1 68 GLU n 1 69 CYS n 1 70 ASP n 1 71 PHE n 1 72 GLN n 1 73 GLU n 1 74 PHE n 1 75 MET n 1 76 ALA n 1 77 PHE n 1 78 VAL n 1 79 ALA n 1 80 MET n 1 81 ILE n 1 82 THR n 1 83 THR n 1 84 ALA n 1 85 CYS n 1 86 HIS n 1 87 GLU n 1 88 PHE n 1 89 PHE n 1 90 GLU n 1 91 HIS n 1 92 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 92 _entity_src_gen.gene_src_common_name Bovine _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene S100B _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bos taurus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9913 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code S100B_BOVIN _struct_ref.pdbx_db_accession P02638 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAM ITTACHEFFEHE ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5DKQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 92 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02638 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 92 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 0 _struct_ref_seq.pdbx_auth_seq_align_end 91 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 5D0 non-polymer . "2,2'-[pentane-1,5-diylbis(oxybenzene-4,1-diyl)]di-1,4,5,6-tetrahydropyrimidine" ? 'C25 H32 N4 O2' 420.547 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5DKQ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.28 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 45.98 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '25% Peg 3,350; 0.1M Bis-Tris, pH 7.5; 7.5mM CaCl2; 5% glycerol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-12-14 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.127092 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRL BEAMLINE BL7-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.127092 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL7-1 _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.B_iso_Wilson_estimate 22.750 _reflns.entry_id 5DKQ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.590 _reflns.d_resolution_low 38.430 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13794 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.100 _reflns.pdbx_Rmerge_I_obs 0.049 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 23.300 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.020 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 97324 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 1.590 1.620 ? 1.500 4162 ? ? 663 ? 99.300 ? ? ? ? 1.414 ? ? ? ? ? ? ? ? 6.300 ? ? ? ? ? 0.609 0 1 1 0.517 ? 8.710 38.430 ? 65.000 532 ? ? 109 ? 96.100 ? ? ? ? 0.030 ? ? ? ? ? ? ? ? 4.900 ? ? ? ? ? 0.015 0 2 1 0.997 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 67.340 _refine.B_iso_mean 31.6900 _refine.B_iso_min 17.530 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5DKQ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.5910 _refine.ls_d_res_low 38.4270 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13753 _refine.ls_number_reflns_R_free 1376 _refine.ls_number_reflns_R_work 12377 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.8900 _refine.ls_percent_reflns_R_free 10.0100 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2066 _refine.ls_R_factor_R_free 0.2298 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2040 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1MHO _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 24.5300 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1500 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set 0.8163 _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 1.5910 _refine_hist.d_res_low 38.4270 _refine_hist.pdbx_number_atoms_ligand 33 _refine_hist.number_atoms_solvent 108 _refine_hist.number_atoms_total 878 _refine_hist.pdbx_number_residues_total 91 _refine_hist.pdbx_B_iso_mean_ligand 37.80 _refine_hist.pdbx_B_iso_mean_solvent 39.05 _refine_hist.pdbx_number_atoms_protein 737 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 ? 790 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.971 ? 1056 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.070 ? 110 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 137 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 16.276 ? 304 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.5906 1.6475 1339 . 134 1205 99.0000 . . . 0.3077 . 0.2839 . . . . . . 10 . . . 'X-RAY DIFFRACTION' 1.6475 1.7135 1338 . 134 1204 100.0000 . . . 0.3322 . 0.2552 . . . . . . 10 . . . 'X-RAY DIFFRACTION' 1.7135 1.7914 1350 . 135 1215 100.0000 . . . 0.2865 . 0.2471 . . . . . . 10 . . . 'X-RAY DIFFRACTION' 1.7914 1.8859 1351 . 135 1216 100.0000 . . . 0.3033 . 0.2289 . . . . . . 10 . . . 'X-RAY DIFFRACTION' 1.8859 2.0040 1366 . 136 1230 100.0000 . . . 0.2524 . 0.2227 . . . . . . 10 . . . 'X-RAY DIFFRACTION' 2.0040 2.1588 1356 . 136 1220 100.0000 . . . 0.2488 . 0.2099 . . . . . . 10 . . . 'X-RAY DIFFRACTION' 2.1588 2.3760 1368 . 137 1231 100.0000 . . . 0.2212 . 0.1996 . . . . . . 10 . . . 'X-RAY DIFFRACTION' 2.3760 2.7197 1385 . 138 1247 100.0000 . . . 0.2134 . 0.1980 . . . . . . 10 . . . 'X-RAY DIFFRACTION' 2.7197 3.4262 1403 . 141 1262 100.0000 . . . 0.2375 . 0.2031 . . . . . . 10 . . . 'X-RAY DIFFRACTION' 3.4262 38.4382 1497 . 150 1347 100.0000 . . . 0.1990 . 0.1864 . . . . . . 10 . . . # _struct.entry_id 5DKQ _struct.title 'Crystal Structure of Calcium-loaded S100B bound to SBi4214' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5DKQ _struct_keywords.text 'malignant melanoma, calcium binding, covalent inhibitor, METAL BINDING PROTEIN-INHIBITOR complex' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN/INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 2 ? GLY A 20 ? SER A 1 GLY A 19 1 ? 19 HELX_P HELX_P2 AA2 LYS A 29 ? LEU A 41 ? LYS A 28 LEU A 40 1 ? 13 HELX_P HELX_P3 AA3 GLU A 50 ? ASP A 62 ? GLU A 49 ASP A 61 1 ? 13 HELX_P HELX_P4 AA4 ASP A 70 ? GLU A 87 ? ASP A 69 GLU A 86 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A SER 19 O ? ? ? 1_555 B CA . CA ? ? A SER 18 A CA 101 1_555 ? ? ? ? ? ? ? 2.351 ? ? metalc2 metalc ? ? A GLU 22 O ? ? ? 1_555 B CA . CA ? ? A GLU 21 A CA 101 1_555 ? ? ? ? ? ? ? 2.424 ? ? metalc3 metalc ? ? A ASP 24 O ? ? ? 1_555 B CA . CA ? ? A ASP 23 A CA 101 1_555 ? ? ? ? ? ? ? 2.217 ? ? metalc4 metalc ? ? A LYS 27 O ? ? ? 1_555 B CA . CA ? ? A LYS 26 A CA 101 1_555 ? ? ? ? ? ? ? 2.362 ? ? metalc5 metalc ? ? A GLU 32 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 31 A CA 101 1_555 ? ? ? ? ? ? ? 2.495 ? ? metalc6 metalc ? ? A GLU 32 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 31 A CA 101 1_555 ? ? ? ? ? ? ? 2.611 ? ? metalc7 metalc ? ? A ASP 62 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 61 A CA 102 1_555 ? ? ? ? ? ? ? 2.272 ? ? metalc8 metalc ? ? A ASP 64 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 63 A CA 102 1_555 ? ? ? ? ? ? ? 2.323 ? ? metalc9 metalc ? ? A ASP 66 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 65 A CA 102 1_555 ? ? ? ? ? ? ? 2.366 ? ? metalc10 metalc ? ? A GLU 68 O ? ? ? 1_555 C CA . CA ? ? A GLU 67 A CA 102 1_555 ? ? ? ? ? ? ? 2.428 ? ? metalc11 metalc ? ? A GLU 73 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 72 A CA 102 1_555 ? ? ? ? ? ? ? 2.445 ? ? metalc12 metalc ? ? A GLU 73 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 72 A CA 102 1_555 ? ? ? ? ? ? ? 2.563 ? ? metalc13 metalc ? ? B CA . CA ? ? ? 1_555 E HOH . O ? ? A CA 101 A HOH 250 1_555 ? ? ? ? ? ? ? 2.316 ? ? metalc14 metalc ? ? C CA . CA ? ? ? 1_555 E HOH . O ? ? A CA 102 A HOH 219 1_555 ? ? ? ? ? ? ? 2.421 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 101 ? 6 'binding site for residue CA A 101' AC2 Software A CA 102 ? 6 'binding site for residue CA A 102' AC3 Software A 5D0 103 ? 10 'binding site for residue 5D0 A 103' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 SER A 19 ? SER A 18 . ? 1_555 ? 2 AC1 6 GLU A 22 ? GLU A 21 . ? 1_555 ? 3 AC1 6 ASP A 24 ? ASP A 23 . ? 1_555 ? 4 AC1 6 LYS A 27 ? LYS A 26 . ? 1_555 ? 5 AC1 6 GLU A 32 ? GLU A 31 . ? 1_555 ? 6 AC1 6 HOH E . ? HOH A 250 . ? 1_555 ? 7 AC2 6 ASP A 62 ? ASP A 61 . ? 1_555 ? 8 AC2 6 ASP A 64 ? ASP A 63 . ? 1_555 ? 9 AC2 6 ASP A 66 ? ASP A 65 . ? 1_555 ? 10 AC2 6 GLU A 68 ? GLU A 67 . ? 1_555 ? 11 AC2 6 GLU A 73 ? GLU A 72 . ? 1_555 ? 12 AC2 6 HOH E . ? HOH A 219 . ? 1_555 ? 13 AC3 10 VAL A 9 ? VAL A 8 . ? 2_554 ? 14 AC3 10 ILE A 12 ? ILE A 11 . ? 8_554 ? 15 AC3 10 ASP A 13 ? ASP A 12 . ? 2_554 ? 16 AC3 10 HIS A 16 ? HIS A 15 . ? 8_554 ? 17 AC3 10 HIS A 43 ? HIS A 42 . ? 7_554 ? 18 AC3 10 HIS A 43 ? HIS A 42 . ? 1_555 ? 19 AC3 10 CYS A 85 ? CYS A 84 . ? 1_555 ? 20 AC3 10 HIS A 86 ? HIS A 85 . ? 1_555 ? 21 AC3 10 PHE A 88 ? PHE A 87 . ? 1_555 ? 22 AC3 10 PHE A 89 ? PHE A 88 . ? 1_555 ? # _atom_sites.entry_id 5DKQ _atom_sites.fract_transf_matrix[1][1] 0.015752 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015752 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.020715 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CA N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 0 MET MET A . n A 1 2 SER 2 1 1 SER SER A . n A 1 3 GLU 3 2 2 GLU GLU A . n A 1 4 LEU 4 3 3 LEU LEU A . n A 1 5 GLU 5 4 4 GLU GLU A . n A 1 6 LYS 6 5 5 LYS LYS A . n A 1 7 ALA 7 6 6 ALA ALA A . n A 1 8 VAL 8 7 7 VAL VAL A . n A 1 9 VAL 9 8 8 VAL VAL A . n A 1 10 ALA 10 9 9 ALA ALA A . n A 1 11 LEU 11 10 10 LEU LEU A . n A 1 12 ILE 12 11 11 ILE ILE A . n A 1 13 ASP 13 12 12 ASP ASP A . n A 1 14 VAL 14 13 13 VAL VAL A . n A 1 15 PHE 15 14 14 PHE PHE A . n A 1 16 HIS 16 15 15 HIS HIS A . n A 1 17 GLN 17 16 16 GLN GLN A . n A 1 18 TYR 18 17 17 TYR TYR A . n A 1 19 SER 19 18 18 SER SER A . n A 1 20 GLY 20 19 19 GLY GLY A . n A 1 21 ARG 21 20 20 ARG ARG A . n A 1 22 GLU 22 21 21 GLU GLU A . n A 1 23 GLY 23 22 22 GLY GLY A . n A 1 24 ASP 24 23 23 ASP ASP A . n A 1 25 LYS 25 24 24 LYS LYS A . n A 1 26 HIS 26 25 25 HIS HIS A . n A 1 27 LYS 27 26 26 LYS LYS A . n A 1 28 LEU 28 27 27 LEU LEU A . n A 1 29 LYS 29 28 28 LYS LYS A . n A 1 30 LYS 30 29 29 LYS LYS A . n A 1 31 SER 31 30 30 SER SER A . n A 1 32 GLU 32 31 31 GLU GLU A . n A 1 33 LEU 33 32 32 LEU LEU A . n A 1 34 LYS 34 33 33 LYS LYS A . n A 1 35 GLU 35 34 34 GLU GLU A . n A 1 36 LEU 36 35 35 LEU LEU A . n A 1 37 ILE 37 36 36 ILE ILE A . n A 1 38 ASN 38 37 37 ASN ASN A . n A 1 39 ASN 39 38 38 ASN ASN A . n A 1 40 GLU 40 39 39 GLU GLU A . n A 1 41 LEU 41 40 40 LEU LEU A . n A 1 42 SER 42 41 41 SER SER A . n A 1 43 HIS 43 42 42 HIS HIS A . n A 1 44 PHE 44 43 43 PHE PHE A . n A 1 45 LEU 45 44 44 LEU LEU A . n A 1 46 GLU 46 45 45 GLU GLU A . n A 1 47 GLU 47 46 46 GLU GLU A . n A 1 48 ILE 48 47 47 ILE ILE A . n A 1 49 LYS 49 48 48 LYS LYS A . n A 1 50 GLU 50 49 49 GLU GLU A . n A 1 51 GLN 51 50 50 GLN GLN A . n A 1 52 GLU 52 51 51 GLU GLU A . n A 1 53 VAL 53 52 52 VAL VAL A . n A 1 54 VAL 54 53 53 VAL VAL A . n A 1 55 ASP 55 54 54 ASP ASP A . n A 1 56 LYS 56 55 55 LYS LYS A . n A 1 57 VAL 57 56 56 VAL VAL A . n A 1 58 MET 58 57 57 MET MET A . n A 1 59 GLU 59 58 58 GLU GLU A . n A 1 60 THR 60 59 59 THR THR A . n A 1 61 LEU 61 60 60 LEU LEU A . n A 1 62 ASP 62 61 61 ASP ASP A . n A 1 63 SER 63 62 62 SER SER A . n A 1 64 ASP 64 63 63 ASP ASP A . n A 1 65 GLY 65 64 64 GLY GLY A . n A 1 66 ASP 66 65 65 ASP ASP A . n A 1 67 GLY 67 66 66 GLY GLY A . n A 1 68 GLU 68 67 67 GLU GLU A . n A 1 69 CYS 69 68 68 CYS CYS A . n A 1 70 ASP 70 69 69 ASP ASP A . n A 1 71 PHE 71 70 70 PHE PHE A . n A 1 72 GLN 72 71 71 GLN GLN A . n A 1 73 GLU 73 72 72 GLU GLU A . n A 1 74 PHE 74 73 73 PHE PHE A . n A 1 75 MET 75 74 74 MET MET A . n A 1 76 ALA 76 75 75 ALA ALA A . n A 1 77 PHE 77 76 76 PHE PHE A . n A 1 78 VAL 78 77 77 VAL VAL A . n A 1 79 ALA 79 78 78 ALA ALA A . n A 1 80 MET 80 79 79 MET MET A . n A 1 81 ILE 81 80 80 ILE ILE A . n A 1 82 THR 82 81 81 THR THR A . n A 1 83 THR 83 82 82 THR THR A . n A 1 84 ALA 84 83 83 ALA ALA A . n A 1 85 CYS 85 84 84 CYS CYS A . n A 1 86 HIS 86 85 85 HIS HIS A . n A 1 87 GLU 87 86 86 GLU GLU A . n A 1 88 PHE 88 87 87 PHE PHE A . n A 1 89 PHE 89 88 88 PHE PHE A . n A 1 90 GLU 90 89 89 GLU GLU A . n A 1 91 HIS 91 90 90 HIS HIS A . n A 1 92 GLU 92 91 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 101 100 CA CA A . C 2 CA 1 102 101 CA CA A . D 3 5D0 1 103 1 5D0 INH A . E 4 HOH 1 201 110 HOH HOH A . E 4 HOH 2 202 44 HOH HOH A . E 4 HOH 3 203 72 HOH HOH A . E 4 HOH 4 204 38 HOH HOH A . E 4 HOH 5 205 59 HOH HOH A . E 4 HOH 6 206 104 HOH HOH A . E 4 HOH 7 207 53 HOH HOH A . E 4 HOH 8 208 81 HOH HOH A . E 4 HOH 9 209 93 HOH HOH A . E 4 HOH 10 210 8 HOH HOH A . E 4 HOH 11 211 58 HOH HOH A . E 4 HOH 12 212 42 HOH HOH A . E 4 HOH 13 213 19 HOH HOH A . E 4 HOH 14 214 80 HOH HOH A . E 4 HOH 15 215 79 HOH HOH A . E 4 HOH 16 216 54 HOH HOH A . E 4 HOH 17 217 70 HOH HOH A . E 4 HOH 18 218 6 HOH HOH A . E 4 HOH 19 219 5 HOH HOH A . E 4 HOH 20 220 10 HOH HOH A . E 4 HOH 21 221 30 HOH HOH A . E 4 HOH 22 222 109 HOH HOH A . E 4 HOH 23 223 36 HOH HOH A . E 4 HOH 24 224 14 HOH HOH A . E 4 HOH 25 225 35 HOH HOH A . E 4 HOH 26 226 34 HOH HOH A . E 4 HOH 27 227 13 HOH HOH A . E 4 HOH 28 228 76 HOH HOH A . E 4 HOH 29 229 26 HOH HOH A . E 4 HOH 30 230 33 HOH HOH A . E 4 HOH 31 231 15 HOH HOH A . E 4 HOH 32 232 69 HOH HOH A . E 4 HOH 33 233 103 HOH HOH A . E 4 HOH 34 234 37 HOH HOH A . E 4 HOH 35 235 16 HOH HOH A . E 4 HOH 36 236 91 HOH HOH A . E 4 HOH 37 237 52 HOH HOH A . E 4 HOH 38 238 64 HOH HOH A . E 4 HOH 39 239 1 HOH HOH A . E 4 HOH 40 240 20 HOH HOH A . E 4 HOH 41 241 48 HOH HOH A . E 4 HOH 42 242 4 HOH HOH A . E 4 HOH 43 243 22 HOH HOH A . E 4 HOH 44 244 105 HOH HOH A . E 4 HOH 45 245 47 HOH HOH A . E 4 HOH 46 246 17 HOH HOH A . E 4 HOH 47 247 51 HOH HOH A . E 4 HOH 48 248 43 HOH HOH A . E 4 HOH 49 249 100 HOH HOH A . E 4 HOH 50 250 2 HOH HOH A . E 4 HOH 51 251 9 HOH HOH A . E 4 HOH 52 252 71 HOH HOH A . E 4 HOH 53 253 49 HOH HOH A . E 4 HOH 54 254 86 HOH HOH A . E 4 HOH 55 255 3 HOH HOH A . E 4 HOH 56 256 25 HOH HOH A . E 4 HOH 57 257 97 HOH HOH A . E 4 HOH 58 258 67 HOH HOH A . E 4 HOH 59 259 65 HOH HOH A . E 4 HOH 60 260 96 HOH HOH A . E 4 HOH 61 261 40 HOH HOH A . E 4 HOH 62 262 28 HOH HOH A . E 4 HOH 63 263 7 HOH HOH A . E 4 HOH 64 264 23 HOH HOH A . E 4 HOH 65 265 41 HOH HOH A . E 4 HOH 66 266 66 HOH HOH A . E 4 HOH 67 267 60 HOH HOH A . E 4 HOH 68 268 29 HOH HOH A . E 4 HOH 69 269 18 HOH HOH A . E 4 HOH 70 270 95 HOH HOH A . E 4 HOH 71 271 78 HOH HOH A . E 4 HOH 72 272 21 HOH HOH A . E 4 HOH 73 273 61 HOH HOH A . E 4 HOH 74 274 88 HOH HOH A . E 4 HOH 75 275 92 HOH HOH A . E 4 HOH 76 276 75 HOH HOH A . E 4 HOH 77 277 62 HOH HOH A . E 4 HOH 78 278 102 HOH HOH A . E 4 HOH 79 279 107 HOH HOH A . E 4 HOH 80 280 99 HOH HOH A . E 4 HOH 81 281 32 HOH HOH A . E 4 HOH 82 282 77 HOH HOH A . E 4 HOH 83 283 27 HOH HOH A . E 4 HOH 84 284 11 HOH HOH A . E 4 HOH 85 285 83 HOH HOH A . E 4 HOH 86 286 55 HOH HOH A . E 4 HOH 87 287 98 HOH HOH A . E 4 HOH 88 288 68 HOH HOH A . E 4 HOH 89 289 85 HOH HOH A . E 4 HOH 90 290 46 HOH HOH A . E 4 HOH 91 291 56 HOH HOH A . E 4 HOH 92 292 73 HOH HOH A . E 4 HOH 93 293 63 HOH HOH A . E 4 HOH 94 294 74 HOH HOH A . E 4 HOH 95 295 87 HOH HOH A . E 4 HOH 96 296 108 HOH HOH A . E 4 HOH 97 297 12 HOH HOH A . E 4 HOH 98 298 90 HOH HOH A . E 4 HOH 99 299 31 HOH HOH A . E 4 HOH 100 300 57 HOH HOH A . E 4 HOH 101 301 50 HOH HOH A . E 4 HOH 102 302 45 HOH HOH A . E 4 HOH 103 303 89 HOH HOH A . E 4 HOH 104 304 94 HOH HOH A . E 4 HOH 105 305 84 HOH HOH A . E 4 HOH 106 306 82 HOH HOH A . E 4 HOH 107 307 24 HOH HOH A . E 4 HOH 108 308 39 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3090 ? 1 MORE -83 ? 1 'SSA (A^2)' 10130 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_554 -y,-x,-z-1/2 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -24.1375000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A 5D0 103 ? D 5D0 . 2 1 A HOH 209 ? E HOH . 3 1 A HOH 274 ? E HOH . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A SER 19 ? A SER 18 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A GLU 22 ? A GLU 21 ? 1_555 100.2 ? 2 O ? A SER 19 ? A SER 18 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A ASP 24 ? A ASP 23 ? 1_555 84.7 ? 3 O ? A GLU 22 ? A GLU 21 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A ASP 24 ? A ASP 23 ? 1_555 84.8 ? 4 O ? A SER 19 ? A SER 18 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A LYS 27 ? A LYS 26 ? 1_555 89.4 ? 5 O ? A GLU 22 ? A GLU 21 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A LYS 27 ? A LYS 26 ? 1_555 166.7 ? 6 O ? A ASP 24 ? A ASP 23 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A LYS 27 ? A LYS 26 ? 1_555 87.1 ? 7 O ? A SER 19 ? A SER 18 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE1 ? A GLU 32 ? A GLU 31 ? 1_555 98.8 ? 8 O ? A GLU 22 ? A GLU 21 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE1 ? A GLU 32 ? A GLU 31 ? 1_555 113.9 ? 9 O ? A ASP 24 ? A ASP 23 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE1 ? A GLU 32 ? A GLU 31 ? 1_555 159.7 ? 10 O ? A LYS 27 ? A LYS 26 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE1 ? A GLU 32 ? A GLU 31 ? 1_555 73.0 ? 11 O ? A SER 19 ? A SER 18 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE2 ? A GLU 32 ? A GLU 31 ? 1_555 75.7 ? 12 O ? A GLU 22 ? A GLU 21 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE2 ? A GLU 32 ? A GLU 31 ? 1_555 74.3 ? 13 O ? A ASP 24 ? A ASP 23 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE2 ? A GLU 32 ? A GLU 31 ? 1_555 148.0 ? 14 O ? A LYS 27 ? A LYS 26 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE2 ? A GLU 32 ? A GLU 31 ? 1_555 117.2 ? 15 OE1 ? A GLU 32 ? A GLU 31 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE2 ? A GLU 32 ? A GLU 31 ? 1_555 50.8 ? 16 O ? A SER 19 ? A SER 18 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? E HOH . ? A HOH 250 ? 1_555 173.7 ? 17 O ? A GLU 22 ? A GLU 21 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? E HOH . ? A HOH 250 ? 1_555 83.8 ? 18 O ? A ASP 24 ? A ASP 23 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? E HOH . ? A HOH 250 ? 1_555 90.9 ? 19 O ? A LYS 27 ? A LYS 26 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? E HOH . ? A HOH 250 ? 1_555 85.9 ? 20 OE1 ? A GLU 32 ? A GLU 31 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? E HOH . ? A HOH 250 ? 1_555 83.9 ? 21 OE2 ? A GLU 32 ? A GLU 31 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? E HOH . ? A HOH 250 ? 1_555 110.2 ? 22 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD1 ? A ASP 64 ? A ASP 63 ? 1_555 79.4 ? 23 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD1 ? A ASP 66 ? A ASP 65 ? 1_555 82.0 ? 24 OD1 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD1 ? A ASP 66 ? A ASP 65 ? 1_555 84.3 ? 25 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? A GLU 68 ? A GLU 67 ? 1_555 88.4 ? 26 OD1 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? A GLU 68 ? A GLU 67 ? 1_555 160.4 ? 27 OD1 ? A ASP 66 ? A ASP 65 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? A GLU 68 ? A GLU 67 ? 1_555 78.8 ? 28 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE1 ? A GLU 73 ? A GLU 72 ? 1_555 117.2 ? 29 OD1 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE1 ? A GLU 73 ? A GLU 72 ? 1_555 122.6 ? 30 OD1 ? A ASP 66 ? A ASP 65 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE1 ? A GLU 73 ? A GLU 72 ? 1_555 147.9 ? 31 O ? A GLU 68 ? A GLU 67 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE1 ? A GLU 73 ? A GLU 72 ? 1_555 76.6 ? 32 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE2 ? A GLU 73 ? A GLU 72 ? 1_555 90.4 ? 33 OD1 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE2 ? A GLU 73 ? A GLU 72 ? 1_555 75.8 ? 34 OD1 ? A ASP 66 ? A ASP 65 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE2 ? A GLU 73 ? A GLU 72 ? 1_555 159.7 ? 35 O ? A GLU 68 ? A GLU 67 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE2 ? A GLU 73 ? A GLU 72 ? 1_555 120.0 ? 36 OE1 ? A GLU 73 ? A GLU 72 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE2 ? A GLU 73 ? A GLU 72 ? 1_555 51.6 ? 37 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? E HOH . ? A HOH 219 ? 1_555 158.5 ? 38 OD1 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? E HOH . ? A HOH 219 ? 1_555 86.9 ? 39 OD1 ? A ASP 66 ? A ASP 65 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? E HOH . ? A HOH 219 ? 1_555 80.2 ? 40 O ? A GLU 68 ? A GLU 67 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? E HOH . ? A HOH 219 ? 1_555 99.8 ? 41 OE1 ? A GLU 73 ? A GLU 72 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? E HOH . ? A HOH 219 ? 1_555 84.1 ? 42 OE2 ? A GLU 73 ? A GLU 72 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? E HOH . ? A HOH 219 ? 1_555 102.3 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-01-20 2 'Structure model' 1 1 2016-02-10 3 'Structure model' 1 2 2017-09-27 4 'Structure model' 1 3 2019-12-04 5 'Structure model' 1 4 2023-09-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Author supporting evidence' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Refinement description' 6 4 'Structure model' 'Author supporting evidence' 7 5 'Structure model' 'Data collection' 8 5 'Structure model' 'Database references' 9 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' citation 2 3 'Structure model' pdbx_audit_support 3 3 'Structure model' pdbx_struct_oper_list 4 3 'Structure model' software 5 4 'Structure model' pdbx_audit_support 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond 8 5 'Structure model' database_2 9 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_citation.journal_id_CSD' 2 3 'Structure model' '_pdbx_audit_support.funding_organization' 3 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 4 4 'Structure model' '_pdbx_audit_support.funding_organization' 5 5 'Structure model' '_database_2.pdbx_DOI' 6 5 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.1.26 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id GLU _pdbx_unobs_or_zero_occ_residues.auth_seq_id 91 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id GLU _pdbx_unobs_or_zero_occ_residues.label_seq_id 92 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 5D0 C1 C N N 1 5D0 C2 C N N 2 5D0 C3 C N N 3 5D0 C8 C Y N 4 5D0 C9 C Y N 5 5D0 C10 C Y N 6 5D0 C11 C Y N 7 5D0 C12 C Y N 8 5D0 C13 C Y N 9 5D0 C14 C Y N 10 5D0 C15 C Y N 11 5D0 C16 C Y N 12 5D0 C19 C Y N 13 5D0 C20 C N N 14 5D0 C21 C N N 15 5D0 N23 N N N 16 5D0 N25 N N N 17 5D0 C27 C N N 18 5D0 C30 C N N 19 5D0 C31 C N N 20 5D0 C4 C N N 21 5D0 C5 C N N 22 5D0 O6 O N N 23 5D0 O7 O N N 24 5D0 C17 C Y N 25 5D0 C18 C Y N 26 5D0 N22 N N N 27 5D0 N24 N N N 28 5D0 C26 C N N 29 5D0 C28 C N N 30 5D0 C29 C N N 31 5D0 H1 H N N 32 5D0 H2 H N N 33 5D0 H3 H N N 34 5D0 H4 H N N 35 5D0 H5 H N N 36 5D0 H6 H N N 37 5D0 H7 H N N 38 5D0 H8 H N N 39 5D0 H9 H N N 40 5D0 H10 H N N 41 5D0 H11 H N N 42 5D0 H12 H N N 43 5D0 H13 H N N 44 5D0 H15 H N N 45 5D0 H17 H N N 46 5D0 H18 H N N 47 5D0 H19 H N N 48 5D0 H20 H N N 49 5D0 H21 H N N 50 5D0 H22 H N N 51 5D0 H23 H N N 52 5D0 H24 H N N 53 5D0 H25 H N N 54 5D0 H26 H N N 55 5D0 H27 H N N 56 5D0 H30 H N N 57 5D0 H31 H N N 58 5D0 H32 H N N 59 5D0 H33 H N N 60 5D0 H34 H N N 61 5D0 H35 H N N 62 5D0 H36 H N N 63 ALA N N N N 64 ALA CA C N S 65 ALA C C N N 66 ALA O O N N 67 ALA CB C N N 68 ALA OXT O N N 69 ALA H H N N 70 ALA H2 H N N 71 ALA HA H N N 72 ALA HB1 H N N 73 ALA HB2 H N N 74 ALA HB3 H N N 75 ALA HXT H N N 76 ARG N N N N 77 ARG CA C N S 78 ARG C C N N 79 ARG O O N N 80 ARG CB C N N 81 ARG CG C N N 82 ARG CD C N N 83 ARG NE N N N 84 ARG CZ C N N 85 ARG NH1 N N N 86 ARG NH2 N N N 87 ARG OXT O N N 88 ARG H H N N 89 ARG H2 H N N 90 ARG HA H N N 91 ARG HB2 H N N 92 ARG HB3 H N N 93 ARG HG2 H N N 94 ARG HG3 H N N 95 ARG HD2 H N N 96 ARG HD3 H N N 97 ARG HE H N N 98 ARG HH11 H N N 99 ARG HH12 H N N 100 ARG HH21 H N N 101 ARG HH22 H N N 102 ARG HXT H N N 103 ASN N N N N 104 ASN CA C N S 105 ASN C C N N 106 ASN O O N N 107 ASN CB C N N 108 ASN CG C N N 109 ASN OD1 O N N 110 ASN ND2 N N N 111 ASN OXT O N N 112 ASN H H N N 113 ASN H2 H N N 114 ASN HA H N N 115 ASN HB2 H N N 116 ASN HB3 H N N 117 ASN HD21 H N N 118 ASN HD22 H N N 119 ASN HXT H N N 120 ASP N N N N 121 ASP CA C N S 122 ASP C C N N 123 ASP O O N N 124 ASP CB C N N 125 ASP CG C N N 126 ASP OD1 O N N 127 ASP OD2 O N N 128 ASP OXT O N N 129 ASP H H N N 130 ASP H2 H N N 131 ASP HA H N N 132 ASP HB2 H N N 133 ASP HB3 H N N 134 ASP HD2 H N N 135 ASP HXT H N N 136 CA CA CA N N 137 CYS N N N N 138 CYS CA C N R 139 CYS C C N N 140 CYS O O N N 141 CYS CB C N N 142 CYS SG S N N 143 CYS OXT O N N 144 CYS H H N N 145 CYS H2 H N N 146 CYS HA H N N 147 CYS HB2 H N N 148 CYS HB3 H N N 149 CYS HG H N N 150 CYS HXT H N N 151 GLN N N N N 152 GLN CA C N S 153 GLN C C N N 154 GLN O O N N 155 GLN CB C N N 156 GLN CG C N N 157 GLN CD C N N 158 GLN OE1 O N N 159 GLN NE2 N N N 160 GLN OXT O N N 161 GLN H H N N 162 GLN H2 H N N 163 GLN HA H N N 164 GLN HB2 H N N 165 GLN HB3 H N N 166 GLN HG2 H N N 167 GLN HG3 H N N 168 GLN HE21 H N N 169 GLN HE22 H N N 170 GLN HXT H N N 171 GLU N N N N 172 GLU CA C N S 173 GLU C C N N 174 GLU O O N N 175 GLU CB C N N 176 GLU CG C N N 177 GLU CD C N N 178 GLU OE1 O N N 179 GLU OE2 O N N 180 GLU OXT O N N 181 GLU H H N N 182 GLU H2 H N N 183 GLU HA H N N 184 GLU HB2 H N N 185 GLU HB3 H N N 186 GLU HG2 H N N 187 GLU HG3 H N N 188 GLU HE2 H N N 189 GLU HXT H N N 190 GLY N N N N 191 GLY CA C N N 192 GLY C C N N 193 GLY O O N N 194 GLY OXT O N N 195 GLY H H N N 196 GLY H2 H N N 197 GLY HA2 H N N 198 GLY HA3 H N N 199 GLY HXT H N N 200 HIS N N N N 201 HIS CA C N S 202 HIS C C N N 203 HIS O O N N 204 HIS CB C N N 205 HIS CG C Y N 206 HIS ND1 N Y N 207 HIS CD2 C Y N 208 HIS CE1 C Y N 209 HIS NE2 N Y N 210 HIS OXT O N N 211 HIS H H N N 212 HIS H2 H N N 213 HIS HA H N N 214 HIS HB2 H N N 215 HIS HB3 H N N 216 HIS HD1 H N N 217 HIS HD2 H N N 218 HIS HE1 H N N 219 HIS HE2 H N N 220 HIS HXT H N N 221 HOH O O N N 222 HOH H1 H N N 223 HOH H2 H N N 224 ILE N N N N 225 ILE CA C N S 226 ILE C C N N 227 ILE O O N N 228 ILE CB C N S 229 ILE CG1 C N N 230 ILE CG2 C N N 231 ILE CD1 C N N 232 ILE OXT O N N 233 ILE H H N N 234 ILE H2 H N N 235 ILE HA H N N 236 ILE HB H N N 237 ILE HG12 H N N 238 ILE HG13 H N N 239 ILE HG21 H N N 240 ILE HG22 H N N 241 ILE HG23 H N N 242 ILE HD11 H N N 243 ILE HD12 H N N 244 ILE HD13 H N N 245 ILE HXT H N N 246 LEU N N N N 247 LEU CA C N S 248 LEU C C N N 249 LEU O O N N 250 LEU CB C N N 251 LEU CG C N N 252 LEU CD1 C N N 253 LEU CD2 C N N 254 LEU OXT O N N 255 LEU H H N N 256 LEU H2 H N N 257 LEU HA H N N 258 LEU HB2 H N N 259 LEU HB3 H N N 260 LEU HG H N N 261 LEU HD11 H N N 262 LEU HD12 H N N 263 LEU HD13 H N N 264 LEU HD21 H N N 265 LEU HD22 H N N 266 LEU HD23 H N N 267 LEU HXT H N N 268 LYS N N N N 269 LYS CA C N S 270 LYS C C N N 271 LYS O O N N 272 LYS CB C N N 273 LYS CG C N N 274 LYS CD C N N 275 LYS CE C N N 276 LYS NZ N N N 277 LYS OXT O N N 278 LYS H H N N 279 LYS H2 H N N 280 LYS HA H N N 281 LYS HB2 H N N 282 LYS HB3 H N N 283 LYS HG2 H N N 284 LYS HG3 H N N 285 LYS HD2 H N N 286 LYS HD3 H N N 287 LYS HE2 H N N 288 LYS HE3 H N N 289 LYS HZ1 H N N 290 LYS HZ2 H N N 291 LYS HZ3 H N N 292 LYS HXT H N N 293 MET N N N N 294 MET CA C N S 295 MET C C N N 296 MET O O N N 297 MET CB C N N 298 MET CG C N N 299 MET SD S N N 300 MET CE C N N 301 MET OXT O N N 302 MET H H N N 303 MET H2 H N N 304 MET HA H N N 305 MET HB2 H N N 306 MET HB3 H N N 307 MET HG2 H N N 308 MET HG3 H N N 309 MET HE1 H N N 310 MET HE2 H N N 311 MET HE3 H N N 312 MET HXT H N N 313 PHE N N N N 314 PHE CA C N S 315 PHE C C N N 316 PHE O O N N 317 PHE CB C N N 318 PHE CG C Y N 319 PHE CD1 C Y N 320 PHE CD2 C Y N 321 PHE CE1 C Y N 322 PHE CE2 C Y N 323 PHE CZ C Y N 324 PHE OXT O N N 325 PHE H H N N 326 PHE H2 H N N 327 PHE HA H N N 328 PHE HB2 H N N 329 PHE HB3 H N N 330 PHE HD1 H N N 331 PHE HD2 H N N 332 PHE HE1 H N N 333 PHE HE2 H N N 334 PHE HZ H N N 335 PHE HXT H N N 336 SER N N N N 337 SER CA C N S 338 SER C C N N 339 SER O O N N 340 SER CB C N N 341 SER OG O N N 342 SER OXT O N N 343 SER H H N N 344 SER H2 H N N 345 SER HA H N N 346 SER HB2 H N N 347 SER HB3 H N N 348 SER HG H N N 349 SER HXT H N N 350 THR N N N N 351 THR CA C N S 352 THR C C N N 353 THR O O N N 354 THR CB C N R 355 THR OG1 O N N 356 THR CG2 C N N 357 THR OXT O N N 358 THR H H N N 359 THR H2 H N N 360 THR HA H N N 361 THR HB H N N 362 THR HG1 H N N 363 THR HG21 H N N 364 THR HG22 H N N 365 THR HG23 H N N 366 THR HXT H N N 367 TYR N N N N 368 TYR CA C N S 369 TYR C C N N 370 TYR O O N N 371 TYR CB C N N 372 TYR CG C Y N 373 TYR CD1 C Y N 374 TYR CD2 C Y N 375 TYR CE1 C Y N 376 TYR CE2 C Y N 377 TYR CZ C Y N 378 TYR OH O N N 379 TYR OXT O N N 380 TYR H H N N 381 TYR H2 H N N 382 TYR HA H N N 383 TYR HB2 H N N 384 TYR HB3 H N N 385 TYR HD1 H N N 386 TYR HD2 H N N 387 TYR HE1 H N N 388 TYR HE2 H N N 389 TYR HH H N N 390 TYR HXT H N N 391 VAL N N N N 392 VAL CA C N S 393 VAL C C N N 394 VAL O O N N 395 VAL CB C N N 396 VAL CG1 C N N 397 VAL CG2 C N N 398 VAL OXT O N N 399 VAL H H N N 400 VAL H2 H N N 401 VAL HA H N N 402 VAL HB H N N 403 VAL HG11 H N N 404 VAL HG12 H N N 405 VAL HG13 H N N 406 VAL HG21 H N N 407 VAL HG22 H N N 408 VAL HG23 H N N 409 VAL HXT H N N 410 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 5D0 C30 C29 sing N N 1 5D0 C30 C31 sing N N 2 5D0 C29 N24 sing N N 3 5D0 C26 N22 sing N N 4 5D0 C26 C27 sing N N 5 5D0 C31 N25 sing N N 6 5D0 N22 C21 doub N N 7 5D0 N24 C20 sing N N 8 5D0 N25 C20 doub N N 9 5D0 C27 C28 sing N N 10 5D0 C20 C11 sing N N 11 5D0 C18 C19 doub Y N 12 5D0 C18 C17 sing Y N 13 5D0 C10 C11 doub Y N 14 5D0 C10 C9 sing Y N 15 5D0 C19 C14 sing Y N 16 5D0 C11 C12 sing Y N 17 5D0 C21 C17 sing N N 18 5D0 C21 N23 sing N N 19 5D0 C9 C8 doub Y N 20 5D0 C17 C16 doub Y N 21 5D0 C28 N23 sing N N 22 5D0 C12 C13 doub Y N 23 5D0 C8 C13 sing Y N 24 5D0 C8 O6 sing N N 25 5D0 C14 O7 sing N N 26 5D0 C14 C15 doub Y N 27 5D0 C3 C2 sing N N 28 5D0 C3 C4 sing N N 29 5D0 C1 O7 sing N N 30 5D0 C1 C2 sing N N 31 5D0 O6 C5 sing N N 32 5D0 C5 C4 sing N N 33 5D0 C16 C15 sing Y N 34 5D0 C1 H1 sing N N 35 5D0 C1 H2 sing N N 36 5D0 C2 H3 sing N N 37 5D0 C2 H4 sing N N 38 5D0 C3 H5 sing N N 39 5D0 C3 H6 sing N N 40 5D0 C9 H7 sing N N 41 5D0 C10 H8 sing N N 42 5D0 C12 H9 sing N N 43 5D0 C13 H10 sing N N 44 5D0 C15 H11 sing N N 45 5D0 C16 H12 sing N N 46 5D0 C19 H13 sing N N 47 5D0 N23 H15 sing N N 48 5D0 C27 H17 sing N N 49 5D0 C27 H18 sing N N 50 5D0 C30 H19 sing N N 51 5D0 C30 H20 sing N N 52 5D0 C31 H21 sing N N 53 5D0 C31 H22 sing N N 54 5D0 C4 H23 sing N N 55 5D0 C4 H24 sing N N 56 5D0 C5 H25 sing N N 57 5D0 C5 H26 sing N N 58 5D0 C18 H27 sing N N 59 5D0 N24 H30 sing N N 60 5D0 C26 H31 sing N N 61 5D0 C26 H32 sing N N 62 5D0 C28 H33 sing N N 63 5D0 C28 H34 sing N N 64 5D0 C29 H35 sing N N 65 5D0 C29 H36 sing N N 66 ALA N CA sing N N 67 ALA N H sing N N 68 ALA N H2 sing N N 69 ALA CA C sing N N 70 ALA CA CB sing N N 71 ALA CA HA sing N N 72 ALA C O doub N N 73 ALA C OXT sing N N 74 ALA CB HB1 sing N N 75 ALA CB HB2 sing N N 76 ALA CB HB3 sing N N 77 ALA OXT HXT sing N N 78 ARG N CA sing N N 79 ARG N H sing N N 80 ARG N H2 sing N N 81 ARG CA C sing N N 82 ARG CA CB sing N N 83 ARG CA HA sing N N 84 ARG C O doub N N 85 ARG C OXT sing N N 86 ARG CB CG sing N N 87 ARG CB HB2 sing N N 88 ARG CB HB3 sing N N 89 ARG CG CD sing N N 90 ARG CG HG2 sing N N 91 ARG CG HG3 sing N N 92 ARG CD NE sing N N 93 ARG CD HD2 sing N N 94 ARG CD HD3 sing N N 95 ARG NE CZ sing N N 96 ARG NE HE sing N N 97 ARG CZ NH1 sing N N 98 ARG CZ NH2 doub N N 99 ARG NH1 HH11 sing N N 100 ARG NH1 HH12 sing N N 101 ARG NH2 HH21 sing N N 102 ARG NH2 HH22 sing N N 103 ARG OXT HXT sing N N 104 ASN N CA sing N N 105 ASN N H sing N N 106 ASN N H2 sing N N 107 ASN CA C sing N N 108 ASN CA CB sing N N 109 ASN CA HA sing N N 110 ASN C O doub N N 111 ASN C OXT sing N N 112 ASN CB CG sing N N 113 ASN CB HB2 sing N N 114 ASN CB HB3 sing N N 115 ASN CG OD1 doub N N 116 ASN CG ND2 sing N N 117 ASN ND2 HD21 sing N N 118 ASN ND2 HD22 sing N N 119 ASN OXT HXT sing N N 120 ASP N CA sing N N 121 ASP N H sing N N 122 ASP N H2 sing N N 123 ASP CA C sing N N 124 ASP CA CB sing N N 125 ASP CA HA sing N N 126 ASP C O doub N N 127 ASP C OXT sing N N 128 ASP CB CG sing N N 129 ASP CB HB2 sing N N 130 ASP CB HB3 sing N N 131 ASP CG OD1 doub N N 132 ASP CG OD2 sing N N 133 ASP OD2 HD2 sing N N 134 ASP OXT HXT sing N N 135 CYS N CA sing N N 136 CYS N H sing N N 137 CYS N H2 sing N N 138 CYS CA C sing N N 139 CYS CA CB sing N N 140 CYS CA HA sing N N 141 CYS C O doub N N 142 CYS C OXT sing N N 143 CYS CB SG sing N N 144 CYS CB HB2 sing N N 145 CYS CB HB3 sing N N 146 CYS SG HG sing N N 147 CYS OXT HXT sing N N 148 GLN N CA sing N N 149 GLN N H sing N N 150 GLN N H2 sing N N 151 GLN CA C sing N N 152 GLN CA CB sing N N 153 GLN CA HA sing N N 154 GLN C O doub N N 155 GLN C OXT sing N N 156 GLN CB CG sing N N 157 GLN CB HB2 sing N N 158 GLN CB HB3 sing N N 159 GLN CG CD sing N N 160 GLN CG HG2 sing N N 161 GLN CG HG3 sing N N 162 GLN CD OE1 doub N N 163 GLN CD NE2 sing N N 164 GLN NE2 HE21 sing N N 165 GLN NE2 HE22 sing N N 166 GLN OXT HXT sing N N 167 GLU N CA sing N N 168 GLU N H sing N N 169 GLU N H2 sing N N 170 GLU CA C sing N N 171 GLU CA CB sing N N 172 GLU CA HA sing N N 173 GLU C O doub N N 174 GLU C OXT sing N N 175 GLU CB CG sing N N 176 GLU CB HB2 sing N N 177 GLU CB HB3 sing N N 178 GLU CG CD sing N N 179 GLU CG HG2 sing N N 180 GLU CG HG3 sing N N 181 GLU CD OE1 doub N N 182 GLU CD OE2 sing N N 183 GLU OE2 HE2 sing N N 184 GLU OXT HXT sing N N 185 GLY N CA sing N N 186 GLY N H sing N N 187 GLY N H2 sing N N 188 GLY CA C sing N N 189 GLY CA HA2 sing N N 190 GLY CA HA3 sing N N 191 GLY C O doub N N 192 GLY C OXT sing N N 193 GLY OXT HXT sing N N 194 HIS N CA sing N N 195 HIS N H sing N N 196 HIS N H2 sing N N 197 HIS CA C sing N N 198 HIS CA CB sing N N 199 HIS CA HA sing N N 200 HIS C O doub N N 201 HIS C OXT sing N N 202 HIS CB CG sing N N 203 HIS CB HB2 sing N N 204 HIS CB HB3 sing N N 205 HIS CG ND1 sing Y N 206 HIS CG CD2 doub Y N 207 HIS ND1 CE1 doub Y N 208 HIS ND1 HD1 sing N N 209 HIS CD2 NE2 sing Y N 210 HIS CD2 HD2 sing N N 211 HIS CE1 NE2 sing Y N 212 HIS CE1 HE1 sing N N 213 HIS NE2 HE2 sing N N 214 HIS OXT HXT sing N N 215 HOH O H1 sing N N 216 HOH O H2 sing N N 217 ILE N CA sing N N 218 ILE N H sing N N 219 ILE N H2 sing N N 220 ILE CA C sing N N 221 ILE CA CB sing N N 222 ILE CA HA sing N N 223 ILE C O doub N N 224 ILE C OXT sing N N 225 ILE CB CG1 sing N N 226 ILE CB CG2 sing N N 227 ILE CB HB sing N N 228 ILE CG1 CD1 sing N N 229 ILE CG1 HG12 sing N N 230 ILE CG1 HG13 sing N N 231 ILE CG2 HG21 sing N N 232 ILE CG2 HG22 sing N N 233 ILE CG2 HG23 sing N N 234 ILE CD1 HD11 sing N N 235 ILE CD1 HD12 sing N N 236 ILE CD1 HD13 sing N N 237 ILE OXT HXT sing N N 238 LEU N CA sing N N 239 LEU N H sing N N 240 LEU N H2 sing N N 241 LEU CA C sing N N 242 LEU CA CB sing N N 243 LEU CA HA sing N N 244 LEU C O doub N N 245 LEU C OXT sing N N 246 LEU CB CG sing N N 247 LEU CB HB2 sing N N 248 LEU CB HB3 sing N N 249 LEU CG CD1 sing N N 250 LEU CG CD2 sing N N 251 LEU CG HG sing N N 252 LEU CD1 HD11 sing N N 253 LEU CD1 HD12 sing N N 254 LEU CD1 HD13 sing N N 255 LEU CD2 HD21 sing N N 256 LEU CD2 HD22 sing N N 257 LEU CD2 HD23 sing N N 258 LEU OXT HXT sing N N 259 LYS N CA sing N N 260 LYS N H sing N N 261 LYS N H2 sing N N 262 LYS CA C sing N N 263 LYS CA CB sing N N 264 LYS CA HA sing N N 265 LYS C O doub N N 266 LYS C OXT sing N N 267 LYS CB CG sing N N 268 LYS CB HB2 sing N N 269 LYS CB HB3 sing N N 270 LYS CG CD sing N N 271 LYS CG HG2 sing N N 272 LYS CG HG3 sing N N 273 LYS CD CE sing N N 274 LYS CD HD2 sing N N 275 LYS CD HD3 sing N N 276 LYS CE NZ sing N N 277 LYS CE HE2 sing N N 278 LYS CE HE3 sing N N 279 LYS NZ HZ1 sing N N 280 LYS NZ HZ2 sing N N 281 LYS NZ HZ3 sing N N 282 LYS OXT HXT sing N N 283 MET N CA sing N N 284 MET N H sing N N 285 MET N H2 sing N N 286 MET CA C sing N N 287 MET CA CB sing N N 288 MET CA HA sing N N 289 MET C O doub N N 290 MET C OXT sing N N 291 MET CB CG sing N N 292 MET CB HB2 sing N N 293 MET CB HB3 sing N N 294 MET CG SD sing N N 295 MET CG HG2 sing N N 296 MET CG HG3 sing N N 297 MET SD CE sing N N 298 MET CE HE1 sing N N 299 MET CE HE2 sing N N 300 MET CE HE3 sing N N 301 MET OXT HXT sing N N 302 PHE N CA sing N N 303 PHE N H sing N N 304 PHE N H2 sing N N 305 PHE CA C sing N N 306 PHE CA CB sing N N 307 PHE CA HA sing N N 308 PHE C O doub N N 309 PHE C OXT sing N N 310 PHE CB CG sing N N 311 PHE CB HB2 sing N N 312 PHE CB HB3 sing N N 313 PHE CG CD1 doub Y N 314 PHE CG CD2 sing Y N 315 PHE CD1 CE1 sing Y N 316 PHE CD1 HD1 sing N N 317 PHE CD2 CE2 doub Y N 318 PHE CD2 HD2 sing N N 319 PHE CE1 CZ doub Y N 320 PHE CE1 HE1 sing N N 321 PHE CE2 CZ sing Y N 322 PHE CE2 HE2 sing N N 323 PHE CZ HZ sing N N 324 PHE OXT HXT sing N N 325 SER N CA sing N N 326 SER N H sing N N 327 SER N H2 sing N N 328 SER CA C sing N N 329 SER CA CB sing N N 330 SER CA HA sing N N 331 SER C O doub N N 332 SER C OXT sing N N 333 SER CB OG sing N N 334 SER CB HB2 sing N N 335 SER CB HB3 sing N N 336 SER OG HG sing N N 337 SER OXT HXT sing N N 338 THR N CA sing N N 339 THR N H sing N N 340 THR N H2 sing N N 341 THR CA C sing N N 342 THR CA CB sing N N 343 THR CA HA sing N N 344 THR C O doub N N 345 THR C OXT sing N N 346 THR CB OG1 sing N N 347 THR CB CG2 sing N N 348 THR CB HB sing N N 349 THR OG1 HG1 sing N N 350 THR CG2 HG21 sing N N 351 THR CG2 HG22 sing N N 352 THR CG2 HG23 sing N N 353 THR OXT HXT sing N N 354 TYR N CA sing N N 355 TYR N H sing N N 356 TYR N H2 sing N N 357 TYR CA C sing N N 358 TYR CA CB sing N N 359 TYR CA HA sing N N 360 TYR C O doub N N 361 TYR C OXT sing N N 362 TYR CB CG sing N N 363 TYR CB HB2 sing N N 364 TYR CB HB3 sing N N 365 TYR CG CD1 doub Y N 366 TYR CG CD2 sing Y N 367 TYR CD1 CE1 sing Y N 368 TYR CD1 HD1 sing N N 369 TYR CD2 CE2 doub Y N 370 TYR CD2 HD2 sing N N 371 TYR CE1 CZ doub Y N 372 TYR CE1 HE1 sing N N 373 TYR CE2 CZ sing Y N 374 TYR CE2 HE2 sing N N 375 TYR CZ OH sing N N 376 TYR OH HH sing N N 377 TYR OXT HXT sing N N 378 VAL N CA sing N N 379 VAL N H sing N N 380 VAL N H2 sing N N 381 VAL CA C sing N N 382 VAL CA CB sing N N 383 VAL CA HA sing N N 384 VAL C O doub N N 385 VAL C OXT sing N N 386 VAL CB CG1 sing N N 387 VAL CB CG2 sing N N 388 VAL CB HB sing N N 389 VAL CG1 HG11 sing N N 390 VAL CG1 HG12 sing N N 391 VAL CG1 HG13 sing N N 392 VAL CG2 HG21 sing N N 393 VAL CG2 HG22 sing N N 394 VAL CG2 HG23 sing N N 395 VAL OXT HXT sing N N 396 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Cancer Institute (NIH/NCI)' 'United States' CA154274 1 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' GM58888 2 'National Institutes of Health/National Cancer Institute (NIH/NCI)' 'United States' CA107331 3 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 "2,2'-[pentane-1,5-diylbis(oxybenzene-4,1-diyl)]di-1,4,5,6-tetrahydropyrimidine" 5D0 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1MHO _pdbx_initial_refinement_model.details ? #