data_5DSU # _entry.id 5DSU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5DSU pdb_00005dsu 10.2210/pdb5dsu/pdb WWPDB D_1000213741 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-01-11 2 'Structure model' 1 1 2017-04-05 3 'Structure model' 1 2 2017-04-12 4 'Structure model' 1 3 2024-01-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp_atom 2 4 'Structure model' chem_comp_bond 3 4 'Structure model' database_2 4 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5DSU _pdbx_database_status.recvd_initial_deposition_date 2015-09-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ababou, A.' 1 'Zaleska, M.' 2 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country NE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Biochim. Biophys. Acta' _citation.journal_id_ASTM BBACAQ _citation.journal_id_CSD 0113 _citation.journal_id_ISSN 0006-3002 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 1865 _citation.language ? _citation.page_first 640 _citation.page_last 651 _citation.title ;On the Ca(2+) binding and conformational change in EF-hand domains: Experimental evidence of Ca(2+)-saturated intermediates of N-domain of calmodulin. ; _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.bbapap.2017.03.003 _citation.pdbx_database_id_PubMed 28288938 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ababou, A.' 1 ? primary 'Zaleska, M.' 2 ? primary 'Pfuhl, M.' 3 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Calmodulin 8791.831 1 ? 'Q41L, K75I' 'UNP residues 3-78' ? 2 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? 3 non-polymer syn 'TRIETHYLENE GLYCOL' 150.173 1 ? ? ? ? 4 water nat water 18.015 56 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name CaM # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MDQLTEEQIAEFKEAFSLYDKDGDGTITTKELGTVMRSLGLNPTEAELQDMINEVDADGNGTIDFPEFLTMMARIMKY _entity_poly.pdbx_seq_one_letter_code_can MDQLTEEQIAEFKEAFSLYDKDGDGTITTKELGTVMRSLGLNPTEAELQDMINEVDADGNGTIDFPEFLTMMARIMKY _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 'TRIETHYLENE GLYCOL' PGE 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 GLN n 1 4 LEU n 1 5 THR n 1 6 GLU n 1 7 GLU n 1 8 GLN n 1 9 ILE n 1 10 ALA n 1 11 GLU n 1 12 PHE n 1 13 LYS n 1 14 GLU n 1 15 ALA n 1 16 PHE n 1 17 SER n 1 18 LEU n 1 19 TYR n 1 20 ASP n 1 21 LYS n 1 22 ASP n 1 23 GLY n 1 24 ASP n 1 25 GLY n 1 26 THR n 1 27 ILE n 1 28 THR n 1 29 THR n 1 30 LYS n 1 31 GLU n 1 32 LEU n 1 33 GLY n 1 34 THR n 1 35 VAL n 1 36 MET n 1 37 ARG n 1 38 SER n 1 39 LEU n 1 40 GLY n 1 41 LEU n 1 42 ASN n 1 43 PRO n 1 44 THR n 1 45 GLU n 1 46 ALA n 1 47 GLU n 1 48 LEU n 1 49 GLN n 1 50 ASP n 1 51 MET n 1 52 ILE n 1 53 ASN n 1 54 GLU n 1 55 VAL n 1 56 ASP n 1 57 ALA n 1 58 ASP n 1 59 GLY n 1 60 ASN n 1 61 GLY n 1 62 THR n 1 63 ILE n 1 64 ASP n 1 65 PHE n 1 66 PRO n 1 67 GLU n 1 68 PHE n 1 69 LEU n 1 70 THR n 1 71 MET n 1 72 MET n 1 73 ALA n 1 74 ARG n 1 75 ILE n 1 76 MET n 1 77 LYS n 1 78 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 78 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CALM1, CALM, CAM, CAM1, CALM2, CAM2, CAMB, CALM3, CALML2, CAM3, CAMC, CAMIII' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET3A _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PGE non-polymer . 'TRIETHYLENE GLYCOL' ? 'C6 H14 O4' 150.173 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ASP 2 2 ? ? ? A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 MET 36 36 36 MET MET A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 MET 51 51 51 MET MET A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 PHE 68 68 68 PHE PHE A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 MET 71 71 71 MET MET A . n A 1 72 MET 72 72 72 MET MET A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 MET 76 76 76 MET MET A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 TYR 78 78 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 101 78 CA CA A . C 2 CA 1 102 79 CA CA A . D 3 PGE 1 103 80 PGE PEG A . E 4 HOH 1 201 83 HOH HOH A . E 4 HOH 2 202 130 HOH HOH A . E 4 HOH 3 203 132 HOH HOH A . E 4 HOH 4 204 108 HOH HOH A . E 4 HOH 5 205 88 HOH HOH A . E 4 HOH 6 206 136 HOH HOH A . E 4 HOH 7 207 104 HOH HOH A . E 4 HOH 8 208 87 HOH HOH A . E 4 HOH 9 209 94 HOH HOH A . E 4 HOH 10 210 115 HOH HOH A . E 4 HOH 11 211 122 HOH HOH A . E 4 HOH 12 212 109 HOH HOH A . E 4 HOH 13 213 92 HOH HOH A . E 4 HOH 14 214 103 HOH HOH A . E 4 HOH 15 215 91 HOH HOH A . E 4 HOH 16 216 111 HOH HOH A . E 4 HOH 17 217 106 HOH HOH A . E 4 HOH 18 218 86 HOH HOH A . E 4 HOH 19 219 82 HOH HOH A . E 4 HOH 20 220 85 HOH HOH A . E 4 HOH 21 221 84 HOH HOH A . E 4 HOH 22 222 81 HOH HOH A . E 4 HOH 23 223 114 HOH HOH A . E 4 HOH 24 224 97 HOH HOH A . E 4 HOH 25 225 131 HOH HOH A . E 4 HOH 26 226 121 HOH HOH A . E 4 HOH 27 227 107 HOH HOH A . E 4 HOH 28 228 93 HOH HOH A . E 4 HOH 29 229 129 HOH HOH A . E 4 HOH 30 230 119 HOH HOH A . E 4 HOH 31 231 96 HOH HOH A . E 4 HOH 32 232 135 HOH HOH A . E 4 HOH 33 233 105 HOH HOH A . E 4 HOH 34 234 123 HOH HOH A . E 4 HOH 35 235 125 HOH HOH A . E 4 HOH 36 236 127 HOH HOH A . E 4 HOH 37 237 99 HOH HOH A . E 4 HOH 38 238 133 HOH HOH A . E 4 HOH 39 239 120 HOH HOH A . E 4 HOH 40 240 95 HOH HOH A . E 4 HOH 41 241 117 HOH HOH A . E 4 HOH 42 242 90 HOH HOH A . E 4 HOH 43 243 89 HOH HOH A . E 4 HOH 44 244 134 HOH HOH A . E 4 HOH 45 245 124 HOH HOH A . E 4 HOH 46 246 100 HOH HOH A . E 4 HOH 47 247 101 HOH HOH A . E 4 HOH 48 248 110 HOH HOH A . E 4 HOH 49 249 128 HOH HOH A . E 4 HOH 50 250 102 HOH HOH A . E 4 HOH 51 251 98 HOH HOH A . E 4 HOH 52 252 126 HOH HOH A . E 4 HOH 53 253 112 HOH HOH A . E 4 HOH 54 254 116 HOH HOH A . E 4 HOH 55 255 113 HOH HOH A . E 4 HOH 56 256 118 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.8.2_1309 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5DSU _cell.details ? _cell.formula_units_Z ? _cell.length_a 38.400 _cell.length_a_esd ? _cell.length_b 38.400 _cell.length_b_esd ? _cell.length_c 81.200 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5DSU _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5DSU _exptl.crystals_number ? _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.97 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 37.43 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 290 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '37% PEG 400, 100 mM HEPES, 250 MM CaCl2' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2011-04-09 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID29' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.00 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID29 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5DSU _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.93 _reflns.d_resolution_low 20.992 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 5544 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.7 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 6.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.d_res_high 1.93 _reflns_shell.d_res_low 2.17 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_sigI_obs 2.1 _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_gt ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_gt ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_redundancy 3.6 _reflns_shell.pdbx_rejects ? _reflns_shell.percent_possible_all 95 _reflns_shell.percent_possible_gt ? _reflns_shell.percent_possible_obs ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5DSU _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.930 _refine.ls_d_res_low 20.992 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 5544 _refine.ls_number_reflns_R_free 252 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.14 _refine.ls_percent_reflns_R_free 4.55 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2303 _refine.ls_R_factor_R_free 0.2641 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2285 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.99 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1CLL _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.30 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 1.10 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 30.39 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.17 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 583 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 12 _refine_hist.number_atoms_solvent 56 _refine_hist.number_atoms_total 651 _refine_hist.d_res_high 1.930 _refine_hist.d_res_low 20.992 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.012 ? 599 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.312 ? 800 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 18.653 ? 231 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.084 ? 91 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 105 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.9300 2.4310 . . 119 2583 99.00 . . . 0.3478 . 0.2619 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4310 20.9936 . . 133 2709 99.00 . . . 0.2413 . 0.2179 . . . . . . . . . . # _struct.entry_id 5DSU _struct.title 'Crystal structure of double mutant of N-domain of human calmodulin' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5DSU _struct_keywords.text 'Ca2+ binding protein EF-hand domain, signaling protein' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CALM_HUMAN _struct_ref.pdbx_db_accession P62158 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code DQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMK _struct_ref.pdbx_align_begin 3 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5DSU _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 77 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P62158 _struct_ref_seq.db_align_beg 3 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 78 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 77 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5DSU MET A 1 ? UNP P62158 ? ? 'initiating methionine' 1 1 1 5DSU TYR A 19 ? UNP P62158 PHE 20 'engineered mutation' 19 2 1 5DSU LEU A 41 ? UNP P62158 GLN 42 'engineered mutation' 41 3 1 5DSU ILE A 75 ? UNP P62158 LYS 76 'engineered mutation' 75 4 1 5DSU TYR A 78 ? UNP P62158 ? ? 'expression tag' 78 5 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 440 ? 1 MORE -24 ? 1 'SSA (A^2)' 5260 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 5 ? ASP A 20 ? THR A 5 ASP A 20 1 ? 16 HELX_P HELX_P2 AA2 THR A 28 ? LEU A 39 ? THR A 28 LEU A 39 1 ? 12 HELX_P HELX_P3 AA3 THR A 44 ? ASP A 56 ? THR A 44 ASP A 56 1 ? 13 HELX_P HELX_P4 AA4 ASP A 64 ? LYS A 77 ? ASP A 64 LYS A 77 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 20 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 20 A CA 101 1_555 ? ? ? ? ? ? ? 2.162 ? ? metalc2 metalc ? ? A ASP 22 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 22 A CA 101 1_555 ? ? ? ? ? ? ? 2.508 ? ? metalc3 metalc ? ? A ASP 24 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 24 A CA 101 1_555 ? ? ? ? ? ? ? 2.333 ? ? metalc4 metalc ? ? A THR 26 O ? ? ? 1_555 B CA . CA ? ? A THR 26 A CA 101 1_555 ? ? ? ? ? ? ? 2.333 ? ? metalc5 metalc ? ? A GLU 31 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 31 A CA 101 1_555 ? ? ? ? ? ? ? 2.842 ? ? metalc6 metalc ? ? A GLU 31 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 31 A CA 101 1_555 ? ? ? ? ? ? ? 2.710 ? ? metalc7 metalc ? ? A ASP 56 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 56 A CA 102 1_555 ? ? ? ? ? ? ? 2.277 ? ? metalc8 metalc ? ? A ASP 58 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 58 A CA 102 1_555 ? ? ? ? ? ? ? 2.506 ? ? metalc9 metalc ? ? A ASN 60 OD1 ? ? ? 1_555 C CA . CA ? ? A ASN 60 A CA 102 1_555 ? ? ? ? ? ? ? 2.299 ? ? metalc10 metalc ? ? A THR 62 O ? ? ? 1_555 C CA . CA ? ? A THR 62 A CA 102 1_555 ? ? ? ? ? ? ? 2.384 ? ? metalc11 metalc ? ? A GLU 67 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 67 A CA 102 1_555 ? ? ? ? ? ? ? 2.559 ? ? metalc12 metalc ? ? A GLU 67 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 67 A CA 102 1_555 ? ? ? ? ? ? ? 2.627 ? ? metalc13 metalc ? ? B CA . CA ? ? ? 1_555 E HOH . O ? ? A CA 101 A HOH 211 1_555 ? ? ? ? ? ? ? 2.275 ? ? metalc14 metalc ? ? C CA . CA ? ? ? 1_555 E HOH . O ? ? A CA 102 A HOH 237 1_555 ? ? ? ? ? ? ? 2.657 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 20 ? A ASP 20 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OD1 ? A ASP 22 ? A ASP 22 ? 1_555 79.8 ? 2 OD1 ? A ASP 20 ? A ASP 20 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OD1 ? A ASP 24 ? A ASP 24 ? 1_555 99.9 ? 3 OD1 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OD1 ? A ASP 24 ? A ASP 24 ? 1_555 81.4 ? 4 OD1 ? A ASP 20 ? A ASP 20 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A THR 26 ? A THR 26 ? 1_555 88.9 ? 5 OD1 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A THR 26 ? A THR 26 ? 1_555 163.6 ? 6 OD1 ? A ASP 24 ? A ASP 24 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A THR 26 ? A THR 26 ? 1_555 88.9 ? 7 OD1 ? A ASP 20 ? A ASP 20 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE1 ? A GLU 31 ? A GLU 31 ? 1_555 81.7 ? 8 OD1 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE1 ? A GLU 31 ? A GLU 31 ? 1_555 70.2 ? 9 OD1 ? A ASP 24 ? A ASP 24 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE1 ? A GLU 31 ? A GLU 31 ? 1_555 150.9 ? 10 O ? A THR 26 ? A THR 26 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE1 ? A GLU 31 ? A GLU 31 ? 1_555 120.2 ? 11 OD1 ? A ASP 20 ? A ASP 20 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE2 ? A GLU 31 ? A GLU 31 ? 1_555 99.2 ? 12 OD1 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE2 ? A GLU 31 ? A GLU 31 ? 1_555 115.5 ? 13 OD1 ? A ASP 24 ? A ASP 24 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE2 ? A GLU 31 ? A GLU 31 ? 1_555 156.5 ? 14 O ? A THR 26 ? A THR 26 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE2 ? A GLU 31 ? A GLU 31 ? 1_555 77.9 ? 15 OE1 ? A GLU 31 ? A GLU 31 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE2 ? A GLU 31 ? A GLU 31 ? 1_555 46.5 ? 16 OD1 ? A ASP 20 ? A ASP 20 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? E HOH . ? A HOH 211 ? 1_555 160.0 ? 17 OD1 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? E HOH . ? A HOH 211 ? 1_555 82.8 ? 18 OD1 ? A ASP 24 ? A ASP 24 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? E HOH . ? A HOH 211 ? 1_555 87.1 ? 19 O ? A THR 26 ? A THR 26 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? E HOH . ? A HOH 211 ? 1_555 110.1 ? 20 OE1 ? A GLU 31 ? A GLU 31 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? E HOH . ? A HOH 211 ? 1_555 83.2 ? 21 OE2 ? A GLU 31 ? A GLU 31 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? E HOH . ? A HOH 211 ? 1_555 79.6 ? 22 OD1 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD1 ? A ASP 58 ? A ASP 58 ? 1_555 83.0 ? 23 OD1 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD1 ? A ASN 60 ? A ASN 60 ? 1_555 89.4 ? 24 OD1 ? A ASP 58 ? A ASP 58 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD1 ? A ASN 60 ? A ASN 60 ? 1_555 76.5 ? 25 OD1 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? A THR 62 ? A THR 62 ? 1_555 92.7 ? 26 OD1 ? A ASP 58 ? A ASP 58 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? A THR 62 ? A THR 62 ? 1_555 155.1 ? 27 OD1 ? A ASN 60 ? A ASN 60 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? A THR 62 ? A THR 62 ? 1_555 79.0 ? 28 OD1 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE1 ? A GLU 67 ? A GLU 67 ? 1_555 105.2 ? 29 OD1 ? A ASP 58 ? A ASP 58 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE1 ? A GLU 67 ? A GLU 67 ? 1_555 126.7 ? 30 OD1 ? A ASN 60 ? A ASN 60 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE1 ? A GLU 67 ? A GLU 67 ? 1_555 153.3 ? 31 O ? A THR 62 ? A THR 62 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE1 ? A GLU 67 ? A GLU 67 ? 1_555 78.1 ? 32 OD1 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE2 ? A GLU 67 ? A GLU 67 ? 1_555 92.3 ? 33 OD1 ? A ASP 58 ? A ASP 58 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE2 ? A GLU 67 ? A GLU 67 ? 1_555 77.3 ? 34 OD1 ? A ASN 60 ? A ASN 60 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE2 ? A GLU 67 ? A GLU 67 ? 1_555 153.4 ? 35 O ? A THR 62 ? A THR 62 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE2 ? A GLU 67 ? A GLU 67 ? 1_555 127.4 ? 36 OE1 ? A GLU 67 ? A GLU 67 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE2 ? A GLU 67 ? A GLU 67 ? 1_555 50.2 ? 37 OD1 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? E HOH . ? A HOH 237 ? 1_555 167.2 ? 38 OD1 ? A ASP 58 ? A ASP 58 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? E HOH . ? A HOH 237 ? 1_555 101.0 ? 39 OD1 ? A ASN 60 ? A ASN 60 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? E HOH . ? A HOH 237 ? 1_555 79.8 ? 40 O ? A THR 62 ? A THR 62 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? E HOH . ? A HOH 237 ? 1_555 78.6 ? 41 OE1 ? A GLU 67 ? A GLU 67 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? E HOH . ? A HOH 237 ? 1_555 82.3 ? 42 OE2 ? A GLU 67 ? A GLU 67 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? E HOH . ? A HOH 237 ? 1_555 100.4 ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 101 ? 6 'binding site for residue CA A 101' AC2 Software A CA 102 ? 6 'binding site for residue CA A 102' AC3 Software A PGE 103 ? 4 'binding site for residue PGE A 103' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 ASP A 20 ? ASP A 20 . ? 1_555 ? 2 AC1 6 ASP A 22 ? ASP A 22 . ? 1_555 ? 3 AC1 6 ASP A 24 ? ASP A 24 . ? 1_555 ? 4 AC1 6 THR A 26 ? THR A 26 . ? 1_555 ? 5 AC1 6 GLU A 31 ? GLU A 31 . ? 1_555 ? 6 AC1 6 HOH E . ? HOH A 211 . ? 1_555 ? 7 AC2 6 ASP A 56 ? ASP A 56 . ? 1_555 ? 8 AC2 6 ASP A 58 ? ASP A 58 . ? 1_555 ? 9 AC2 6 ASN A 60 ? ASN A 60 . ? 1_555 ? 10 AC2 6 THR A 62 ? THR A 62 . ? 1_555 ? 11 AC2 6 GLU A 67 ? GLU A 67 . ? 1_555 ? 12 AC2 6 HOH E . ? HOH A 237 . ? 1_555 ? 13 AC3 4 TYR A 19 ? TYR A 19 . ? 1_555 ? 14 AC3 4 LEU A 39 ? LEU A 39 . ? 6_554 ? 15 AC3 4 MET A 72 ? MET A 72 . ? 1_555 ? 16 AC3 4 ILE A 75 ? ILE A 75 . ? 6_554 ? # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 203 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 226 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 2_444 _pdbx_validate_symm_contact.dist 2.18 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ASP 2 ? A ASP 2 3 1 Y 1 A TYR 78 ? A TYR 78 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 GLN N N N N 75 GLN CA C N S 76 GLN C C N N 77 GLN O O N N 78 GLN CB C N N 79 GLN CG C N N 80 GLN CD C N N 81 GLN OE1 O N N 82 GLN NE2 N N N 83 GLN OXT O N N 84 GLN H H N N 85 GLN H2 H N N 86 GLN HA H N N 87 GLN HB2 H N N 88 GLN HB3 H N N 89 GLN HG2 H N N 90 GLN HG3 H N N 91 GLN HE21 H N N 92 GLN HE22 H N N 93 GLN HXT H N N 94 GLU N N N N 95 GLU CA C N S 96 GLU C C N N 97 GLU O O N N 98 GLU CB C N N 99 GLU CG C N N 100 GLU CD C N N 101 GLU OE1 O N N 102 GLU OE2 O N N 103 GLU OXT O N N 104 GLU H H N N 105 GLU H2 H N N 106 GLU HA H N N 107 GLU HB2 H N N 108 GLU HB3 H N N 109 GLU HG2 H N N 110 GLU HG3 H N N 111 GLU HE2 H N N 112 GLU HXT H N N 113 GLY N N N N 114 GLY CA C N N 115 GLY C C N N 116 GLY O O N N 117 GLY OXT O N N 118 GLY H H N N 119 GLY H2 H N N 120 GLY HA2 H N N 121 GLY HA3 H N N 122 GLY HXT H N N 123 HOH O O N N 124 HOH H1 H N N 125 HOH H2 H N N 126 ILE N N N N 127 ILE CA C N S 128 ILE C C N N 129 ILE O O N N 130 ILE CB C N S 131 ILE CG1 C N N 132 ILE CG2 C N N 133 ILE CD1 C N N 134 ILE OXT O N N 135 ILE H H N N 136 ILE H2 H N N 137 ILE HA H N N 138 ILE HB H N N 139 ILE HG12 H N N 140 ILE HG13 H N N 141 ILE HG21 H N N 142 ILE HG22 H N N 143 ILE HG23 H N N 144 ILE HD11 H N N 145 ILE HD12 H N N 146 ILE HD13 H N N 147 ILE HXT H N N 148 LEU N N N N 149 LEU CA C N S 150 LEU C C N N 151 LEU O O N N 152 LEU CB C N N 153 LEU CG C N N 154 LEU CD1 C N N 155 LEU CD2 C N N 156 LEU OXT O N N 157 LEU H H N N 158 LEU H2 H N N 159 LEU HA H N N 160 LEU HB2 H N N 161 LEU HB3 H N N 162 LEU HG H N N 163 LEU HD11 H N N 164 LEU HD12 H N N 165 LEU HD13 H N N 166 LEU HD21 H N N 167 LEU HD22 H N N 168 LEU HD23 H N N 169 LEU HXT H N N 170 LYS N N N N 171 LYS CA C N S 172 LYS C C N N 173 LYS O O N N 174 LYS CB C N N 175 LYS CG C N N 176 LYS CD C N N 177 LYS CE C N N 178 LYS NZ N N N 179 LYS OXT O N N 180 LYS H H N N 181 LYS H2 H N N 182 LYS HA H N N 183 LYS HB2 H N N 184 LYS HB3 H N N 185 LYS HG2 H N N 186 LYS HG3 H N N 187 LYS HD2 H N N 188 LYS HD3 H N N 189 LYS HE2 H N N 190 LYS HE3 H N N 191 LYS HZ1 H N N 192 LYS HZ2 H N N 193 LYS HZ3 H N N 194 LYS HXT H N N 195 MET N N N N 196 MET CA C N S 197 MET C C N N 198 MET O O N N 199 MET CB C N N 200 MET CG C N N 201 MET SD S N N 202 MET CE C N N 203 MET OXT O N N 204 MET H H N N 205 MET H2 H N N 206 MET HA H N N 207 MET HB2 H N N 208 MET HB3 H N N 209 MET HG2 H N N 210 MET HG3 H N N 211 MET HE1 H N N 212 MET HE2 H N N 213 MET HE3 H N N 214 MET HXT H N N 215 PGE C1 C N N 216 PGE O1 O N N 217 PGE C2 C N N 218 PGE O2 O N N 219 PGE C3 C N N 220 PGE C4 C N N 221 PGE O4 O N N 222 PGE C6 C N N 223 PGE C5 C N N 224 PGE O3 O N N 225 PGE H1 H N N 226 PGE H12 H N N 227 PGE HO1 H N N 228 PGE H2 H N N 229 PGE H22 H N N 230 PGE H3 H N N 231 PGE H32 H N N 232 PGE H4 H N N 233 PGE H42 H N N 234 PGE HO4 H N N 235 PGE H6 H N N 236 PGE H62 H N N 237 PGE H5 H N N 238 PGE H52 H N N 239 PHE N N N N 240 PHE CA C N S 241 PHE C C N N 242 PHE O O N N 243 PHE CB C N N 244 PHE CG C Y N 245 PHE CD1 C Y N 246 PHE CD2 C Y N 247 PHE CE1 C Y N 248 PHE CE2 C Y N 249 PHE CZ C Y N 250 PHE OXT O N N 251 PHE H H N N 252 PHE H2 H N N 253 PHE HA H N N 254 PHE HB2 H N N 255 PHE HB3 H N N 256 PHE HD1 H N N 257 PHE HD2 H N N 258 PHE HE1 H N N 259 PHE HE2 H N N 260 PHE HZ H N N 261 PHE HXT H N N 262 PRO N N N N 263 PRO CA C N S 264 PRO C C N N 265 PRO O O N N 266 PRO CB C N N 267 PRO CG C N N 268 PRO CD C N N 269 PRO OXT O N N 270 PRO H H N N 271 PRO HA H N N 272 PRO HB2 H N N 273 PRO HB3 H N N 274 PRO HG2 H N N 275 PRO HG3 H N N 276 PRO HD2 H N N 277 PRO HD3 H N N 278 PRO HXT H N N 279 SER N N N N 280 SER CA C N S 281 SER C C N N 282 SER O O N N 283 SER CB C N N 284 SER OG O N N 285 SER OXT O N N 286 SER H H N N 287 SER H2 H N N 288 SER HA H N N 289 SER HB2 H N N 290 SER HB3 H N N 291 SER HG H N N 292 SER HXT H N N 293 THR N N N N 294 THR CA C N S 295 THR C C N N 296 THR O O N N 297 THR CB C N R 298 THR OG1 O N N 299 THR CG2 C N N 300 THR OXT O N N 301 THR H H N N 302 THR H2 H N N 303 THR HA H N N 304 THR HB H N N 305 THR HG1 H N N 306 THR HG21 H N N 307 THR HG22 H N N 308 THR HG23 H N N 309 THR HXT H N N 310 TYR N N N N 311 TYR CA C N S 312 TYR C C N N 313 TYR O O N N 314 TYR CB C N N 315 TYR CG C Y N 316 TYR CD1 C Y N 317 TYR CD2 C Y N 318 TYR CE1 C Y N 319 TYR CE2 C Y N 320 TYR CZ C Y N 321 TYR OH O N N 322 TYR OXT O N N 323 TYR H H N N 324 TYR H2 H N N 325 TYR HA H N N 326 TYR HB2 H N N 327 TYR HB3 H N N 328 TYR HD1 H N N 329 TYR HD2 H N N 330 TYR HE1 H N N 331 TYR HE2 H N N 332 TYR HH H N N 333 TYR HXT H N N 334 VAL N N N N 335 VAL CA C N S 336 VAL C C N N 337 VAL O O N N 338 VAL CB C N N 339 VAL CG1 C N N 340 VAL CG2 C N N 341 VAL OXT O N N 342 VAL H H N N 343 VAL H2 H N N 344 VAL HA H N N 345 VAL HB H N N 346 VAL HG11 H N N 347 VAL HG12 H N N 348 VAL HG13 H N N 349 VAL HG21 H N N 350 VAL HG22 H N N 351 VAL HG23 H N N 352 VAL HXT H N N 353 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HOH O H1 sing N N 116 HOH O H2 sing N N 117 ILE N CA sing N N 118 ILE N H sing N N 119 ILE N H2 sing N N 120 ILE CA C sing N N 121 ILE CA CB sing N N 122 ILE CA HA sing N N 123 ILE C O doub N N 124 ILE C OXT sing N N 125 ILE CB CG1 sing N N 126 ILE CB CG2 sing N N 127 ILE CB HB sing N N 128 ILE CG1 CD1 sing N N 129 ILE CG1 HG12 sing N N 130 ILE CG1 HG13 sing N N 131 ILE CG2 HG21 sing N N 132 ILE CG2 HG22 sing N N 133 ILE CG2 HG23 sing N N 134 ILE CD1 HD11 sing N N 135 ILE CD1 HD12 sing N N 136 ILE CD1 HD13 sing N N 137 ILE OXT HXT sing N N 138 LEU N CA sing N N 139 LEU N H sing N N 140 LEU N H2 sing N N 141 LEU CA C sing N N 142 LEU CA CB sing N N 143 LEU CA HA sing N N 144 LEU C O doub N N 145 LEU C OXT sing N N 146 LEU CB CG sing N N 147 LEU CB HB2 sing N N 148 LEU CB HB3 sing N N 149 LEU CG CD1 sing N N 150 LEU CG CD2 sing N N 151 LEU CG HG sing N N 152 LEU CD1 HD11 sing N N 153 LEU CD1 HD12 sing N N 154 LEU CD1 HD13 sing N N 155 LEU CD2 HD21 sing N N 156 LEU CD2 HD22 sing N N 157 LEU CD2 HD23 sing N N 158 LEU OXT HXT sing N N 159 LYS N CA sing N N 160 LYS N H sing N N 161 LYS N H2 sing N N 162 LYS CA C sing N N 163 LYS CA CB sing N N 164 LYS CA HA sing N N 165 LYS C O doub N N 166 LYS C OXT sing N N 167 LYS CB CG sing N N 168 LYS CB HB2 sing N N 169 LYS CB HB3 sing N N 170 LYS CG CD sing N N 171 LYS CG HG2 sing N N 172 LYS CG HG3 sing N N 173 LYS CD CE sing N N 174 LYS CD HD2 sing N N 175 LYS CD HD3 sing N N 176 LYS CE NZ sing N N 177 LYS CE HE2 sing N N 178 LYS CE HE3 sing N N 179 LYS NZ HZ1 sing N N 180 LYS NZ HZ2 sing N N 181 LYS NZ HZ3 sing N N 182 LYS OXT HXT sing N N 183 MET N CA sing N N 184 MET N H sing N N 185 MET N H2 sing N N 186 MET CA C sing N N 187 MET CA CB sing N N 188 MET CA HA sing N N 189 MET C O doub N N 190 MET C OXT sing N N 191 MET CB CG sing N N 192 MET CB HB2 sing N N 193 MET CB HB3 sing N N 194 MET CG SD sing N N 195 MET CG HG2 sing N N 196 MET CG HG3 sing N N 197 MET SD CE sing N N 198 MET CE HE1 sing N N 199 MET CE HE2 sing N N 200 MET CE HE3 sing N N 201 MET OXT HXT sing N N 202 PGE C1 O1 sing N N 203 PGE C1 C2 sing N N 204 PGE C1 H1 sing N N 205 PGE C1 H12 sing N N 206 PGE O1 HO1 sing N N 207 PGE C2 O2 sing N N 208 PGE C2 H2 sing N N 209 PGE C2 H22 sing N N 210 PGE O2 C3 sing N N 211 PGE C3 C4 sing N N 212 PGE C3 H3 sing N N 213 PGE C3 H32 sing N N 214 PGE C4 O3 sing N N 215 PGE C4 H4 sing N N 216 PGE C4 H42 sing N N 217 PGE O4 C6 sing N N 218 PGE O4 HO4 sing N N 219 PGE C6 C5 sing N N 220 PGE C6 H6 sing N N 221 PGE C6 H62 sing N N 222 PGE C5 O3 sing N N 223 PGE C5 H5 sing N N 224 PGE C5 H52 sing N N 225 PHE N CA sing N N 226 PHE N H sing N N 227 PHE N H2 sing N N 228 PHE CA C sing N N 229 PHE CA CB sing N N 230 PHE CA HA sing N N 231 PHE C O doub N N 232 PHE C OXT sing N N 233 PHE CB CG sing N N 234 PHE CB HB2 sing N N 235 PHE CB HB3 sing N N 236 PHE CG CD1 doub Y N 237 PHE CG CD2 sing Y N 238 PHE CD1 CE1 sing Y N 239 PHE CD1 HD1 sing N N 240 PHE CD2 CE2 doub Y N 241 PHE CD2 HD2 sing N N 242 PHE CE1 CZ doub Y N 243 PHE CE1 HE1 sing N N 244 PHE CE2 CZ sing Y N 245 PHE CE2 HE2 sing N N 246 PHE CZ HZ sing N N 247 PHE OXT HXT sing N N 248 PRO N CA sing N N 249 PRO N CD sing N N 250 PRO N H sing N N 251 PRO CA C sing N N 252 PRO CA CB sing N N 253 PRO CA HA sing N N 254 PRO C O doub N N 255 PRO C OXT sing N N 256 PRO CB CG sing N N 257 PRO CB HB2 sing N N 258 PRO CB HB3 sing N N 259 PRO CG CD sing N N 260 PRO CG HG2 sing N N 261 PRO CG HG3 sing N N 262 PRO CD HD2 sing N N 263 PRO CD HD3 sing N N 264 PRO OXT HXT sing N N 265 SER N CA sing N N 266 SER N H sing N N 267 SER N H2 sing N N 268 SER CA C sing N N 269 SER CA CB sing N N 270 SER CA HA sing N N 271 SER C O doub N N 272 SER C OXT sing N N 273 SER CB OG sing N N 274 SER CB HB2 sing N N 275 SER CB HB3 sing N N 276 SER OG HG sing N N 277 SER OXT HXT sing N N 278 THR N CA sing N N 279 THR N H sing N N 280 THR N H2 sing N N 281 THR CA C sing N N 282 THR CA CB sing N N 283 THR CA HA sing N N 284 THR C O doub N N 285 THR C OXT sing N N 286 THR CB OG1 sing N N 287 THR CB CG2 sing N N 288 THR CB HB sing N N 289 THR OG1 HG1 sing N N 290 THR CG2 HG21 sing N N 291 THR CG2 HG22 sing N N 292 THR CG2 HG23 sing N N 293 THR OXT HXT sing N N 294 TYR N CA sing N N 295 TYR N H sing N N 296 TYR N H2 sing N N 297 TYR CA C sing N N 298 TYR CA CB sing N N 299 TYR CA HA sing N N 300 TYR C O doub N N 301 TYR C OXT sing N N 302 TYR CB CG sing N N 303 TYR CB HB2 sing N N 304 TYR CB HB3 sing N N 305 TYR CG CD1 doub Y N 306 TYR CG CD2 sing Y N 307 TYR CD1 CE1 sing Y N 308 TYR CD1 HD1 sing N N 309 TYR CD2 CE2 doub Y N 310 TYR CD2 HD2 sing N N 311 TYR CE1 CZ doub Y N 312 TYR CE1 HE1 sing N N 313 TYR CE2 CZ sing Y N 314 TYR CE2 HE2 sing N N 315 TYR CZ OH sing N N 316 TYR OH HH sing N N 317 TYR OXT HXT sing N N 318 VAL N CA sing N N 319 VAL N H sing N N 320 VAL N H2 sing N N 321 VAL CA C sing N N 322 VAL CA CB sing N N 323 VAL CA HA sing N N 324 VAL C O doub N N 325 VAL C OXT sing N N 326 VAL CB CG1 sing N N 327 VAL CB CG2 sing N N 328 VAL CB HB sing N N 329 VAL CG1 HG11 sing N N 330 VAL CG1 HG12 sing N N 331 VAL CG1 HG13 sing N N 332 VAL CG2 HG21 sing N N 333 VAL CG2 HG22 sing N N 334 VAL CG2 HG23 sing N N 335 VAL OXT HXT sing N N 336 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1CLL _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 5DSU _atom_sites.fract_transf_matrix[1][1] 0.026042 _atom_sites.fract_transf_matrix[1][2] 0.015035 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.030070 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012315 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA N O S # loop_