data_5DV3 # _entry.id 5DV3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5DV3 WWPDB D_1000213738 # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 5DV6 unspecified PDB . 5DV8 unspecified PDB . 5DVC unspecified PDB . 5DWL unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5DV3 _pdbx_database_status.recvd_initial_deposition_date 2015-09-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _audit_author.name 'Jang, J.Y.' _audit_author.pdbx_ordinal 1 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Human PPARgamma ligand binding dmain complexed with SB1405 in a covalent bonded form' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # _citation_author.citation_id primary _citation_author.name 'Jang, J.Y.' _citation_author.ordinal 1 # _cell.entry_id 5DV3 _cell.length_a 53.947 _cell.length_b 130.892 _cell.length_c 52.593 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5DV3 _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Peroxisome proliferator-activated receptor gamma' 32693.824 1 ? ? 'UNP RESIDUES 223-505' ? 2 polymer syn 'Nuclear receptor coactivator 1' 1905.186 1 2.3.1.48 ? 'UNP RESIDUES 685-700' ? 3 non-polymer syn 'N-[2-(benzyloxy)phenyl]-3-nitrobenzamide' 348.352 1 ? ? ? ? 4 water nat water 18.015 25 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'PPAR-gamma,Nuclear receptor subfamily 1 group C member 3' 2 ;NCoA-1,Class E basic helix-loop-helix protein 74,bHLHe74,Protein Hin-2,RIP160,Renal carcinoma antigen NY-REN-52,Steroid receptor coactivator 1,SRC-1 ; # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GSHMAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPL QEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTR EFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQ LFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY ; ;GSHMAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPL QEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTR EFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQ LFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY ; A ? 2 'polypeptide(L)' no no ERHKILHRLLQEGSPS ERHKILHRLLQEGSPS B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 ALA n 1 6 GLU n 1 7 ILE n 1 8 SER n 1 9 SER n 1 10 ASP n 1 11 ILE n 1 12 ASP n 1 13 GLN n 1 14 LEU n 1 15 ASN n 1 16 PRO n 1 17 GLU n 1 18 SER n 1 19 ALA n 1 20 ASP n 1 21 LEU n 1 22 ARG n 1 23 ALA n 1 24 LEU n 1 25 ALA n 1 26 LYS n 1 27 HIS n 1 28 LEU n 1 29 TYR n 1 30 ASP n 1 31 SER n 1 32 TYR n 1 33 ILE n 1 34 LYS n 1 35 SER n 1 36 PHE n 1 37 PRO n 1 38 LEU n 1 39 THR n 1 40 LYS n 1 41 ALA n 1 42 LYS n 1 43 ALA n 1 44 ARG n 1 45 ALA n 1 46 ILE n 1 47 LEU n 1 48 THR n 1 49 GLY n 1 50 LYS n 1 51 THR n 1 52 THR n 1 53 ASP n 1 54 LYS n 1 55 SER n 1 56 PRO n 1 57 PHE n 1 58 VAL n 1 59 ILE n 1 60 TYR n 1 61 ASP n 1 62 MET n 1 63 ASN n 1 64 SER n 1 65 LEU n 1 66 MET n 1 67 MET n 1 68 GLY n 1 69 GLU n 1 70 ASP n 1 71 LYS n 1 72 ILE n 1 73 LYS n 1 74 PHE n 1 75 LYS n 1 76 HIS n 1 77 ILE n 1 78 THR n 1 79 PRO n 1 80 LEU n 1 81 GLN n 1 82 GLU n 1 83 GLN n 1 84 SER n 1 85 LYS n 1 86 GLU n 1 87 VAL n 1 88 ALA n 1 89 ILE n 1 90 ARG n 1 91 ILE n 1 92 PHE n 1 93 GLN n 1 94 GLY n 1 95 CYS n 1 96 GLN n 1 97 PHE n 1 98 ARG n 1 99 SER n 1 100 VAL n 1 101 GLU n 1 102 ALA n 1 103 VAL n 1 104 GLN n 1 105 GLU n 1 106 ILE n 1 107 THR n 1 108 GLU n 1 109 TYR n 1 110 ALA n 1 111 LYS n 1 112 SER n 1 113 ILE n 1 114 PRO n 1 115 GLY n 1 116 PHE n 1 117 VAL n 1 118 ASN n 1 119 LEU n 1 120 ASP n 1 121 LEU n 1 122 ASN n 1 123 ASP n 1 124 GLN n 1 125 VAL n 1 126 THR n 1 127 LEU n 1 128 LEU n 1 129 LYS n 1 130 TYR n 1 131 GLY n 1 132 VAL n 1 133 HIS n 1 134 GLU n 1 135 ILE n 1 136 ILE n 1 137 TYR n 1 138 THR n 1 139 MET n 1 140 LEU n 1 141 ALA n 1 142 SER n 1 143 LEU n 1 144 MET n 1 145 ASN n 1 146 LYS n 1 147 ASP n 1 148 GLY n 1 149 VAL n 1 150 LEU n 1 151 ILE n 1 152 SER n 1 153 GLU n 1 154 GLY n 1 155 GLN n 1 156 GLY n 1 157 PHE n 1 158 MET n 1 159 THR n 1 160 ARG n 1 161 GLU n 1 162 PHE n 1 163 LEU n 1 164 LYS n 1 165 SER n 1 166 LEU n 1 167 ARG n 1 168 LYS n 1 169 PRO n 1 170 PHE n 1 171 GLY n 1 172 ASP n 1 173 PHE n 1 174 MET n 1 175 GLU n 1 176 PRO n 1 177 LYS n 1 178 PHE n 1 179 GLU n 1 180 PHE n 1 181 ALA n 1 182 VAL n 1 183 LYS n 1 184 PHE n 1 185 ASN n 1 186 ALA n 1 187 LEU n 1 188 GLU n 1 189 LEU n 1 190 ASP n 1 191 ASP n 1 192 SER n 1 193 ASP n 1 194 LEU n 1 195 ALA n 1 196 ILE n 1 197 PHE n 1 198 ILE n 1 199 ALA n 1 200 VAL n 1 201 ILE n 1 202 ILE n 1 203 LEU n 1 204 SER n 1 205 GLY n 1 206 ASP n 1 207 ARG n 1 208 PRO n 1 209 GLY n 1 210 LEU n 1 211 LEU n 1 212 ASN n 1 213 VAL n 1 214 LYS n 1 215 PRO n 1 216 ILE n 1 217 GLU n 1 218 ASP n 1 219 ILE n 1 220 GLN n 1 221 ASP n 1 222 ASN n 1 223 LEU n 1 224 LEU n 1 225 GLN n 1 226 ALA n 1 227 LEU n 1 228 GLU n 1 229 LEU n 1 230 GLN n 1 231 LEU n 1 232 LYS n 1 233 LEU n 1 234 ASN n 1 235 HIS n 1 236 PRO n 1 237 GLU n 1 238 SER n 1 239 SER n 1 240 GLN n 1 241 LEU n 1 242 PHE n 1 243 ALA n 1 244 LYS n 1 245 LEU n 1 246 LEU n 1 247 GLN n 1 248 LYS n 1 249 MET n 1 250 THR n 1 251 ASP n 1 252 LEU n 1 253 ARG n 1 254 GLN n 1 255 ILE n 1 256 VAL n 1 257 THR n 1 258 GLU n 1 259 HIS n 1 260 VAL n 1 261 GLN n 1 262 LEU n 1 263 LEU n 1 264 GLN n 1 265 VAL n 1 266 ILE n 1 267 LYS n 1 268 LYS n 1 269 THR n 1 270 GLU n 1 271 THR n 1 272 ASP n 1 273 MET n 1 274 SER n 1 275 LEU n 1 276 HIS n 1 277 PRO n 1 278 LEU n 1 279 LEU n 1 280 GLN n 1 281 GLU n 1 282 ILE n 1 283 TYR n 1 284 LYS n 1 285 ASP n 1 286 LEU n 1 287 TYR n 2 1 GLU n 2 2 ARG n 2 3 HIS n 2 4 LYS n 2 5 ILE n 2 6 LEU n 2 7 HIS n 2 8 ARG n 2 9 LEU n 2 10 LEU n 2 11 GLN n 2 12 GLU n 2 13 GLY n 2 14 SER n 2 15 PRO n 2 16 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 287 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'PPARG, NR1C3' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'Rosetta2(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET28b(+)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 16 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name Human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.db_code _struct_ref.db_name _struct_ref.details _struct_ref.entity_id _struct_ref.id _struct_ref.seq_align _struct_ref.seq_dif _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_align_end PPARG_HUMAN UNP ? 1 1 ? ? P37231 ? ;AEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQS KEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLK SLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAK LLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY ; 223 ? NCOA1_HUMAN UNP ? 2 2 ? ? Q15788 ? ERHKILHRLLQEGSPS 685 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5DV3 A 5 ? 287 ? P37231 223 ? 505 ? 195 477 2 2 5DV3 B 1 ? 16 ? Q15788 685 ? 700 ? 685 700 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5DV3 GLY A 1 ? UNP P37231 ? ? 'expression tag' 191 1 1 5DV3 SER A 2 ? UNP P37231 ? ? 'expression tag' 192 2 1 5DV3 HIS A 3 ? UNP P37231 ? ? 'expression tag' 193 3 1 5DV3 MET A 4 ? UNP P37231 ? ? 'expression tag' 194 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 B05 non-polymer . 'N-[2-(benzyloxy)phenyl]-3-nitrobenzamide' ? 'C20 H16 N2 O4' 348.352 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5DV3 _exptl.crystals_number ? _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.68 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 54.16 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 297 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2.2M sodium malonate pH 7.0' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 270' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-03-31 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97935 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PAL/PLS BEAMLINE 7A (6B, 6C1)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97935 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline '7A (6B, 6C1)' _diffrn_source.pdbx_synchrotron_site PAL/PLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5DV3 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.75 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10385 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.5 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.0 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 30.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.75 _reflns_shell.d_res_low 2.80 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 5 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 100.0 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 5.1 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 5DV3 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 9668 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 30.00 _refine.ls_d_res_high 2.75 _refine.ls_percent_reflns_obs 99.51 _refine.ls_R_factor_obs 0.20307 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.20168 _refine.ls_R_factor_R_free 0.22995 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.9 _refine.ls_number_reflns_R_free 494 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.954 _refine.correlation_coeff_Fo_to_Fc_free 0.942 _refine.B_iso_mean 78.177 _refine.aniso_B[1][1] 0.24 _refine.aniso_B[2][2] -6.02 _refine.aniso_B[3][3] 5.78 _refine.aniso_B[1][2] -0.00 _refine.aniso_B[1][3] -0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 1.043 _refine.pdbx_overall_ESU_R_Free 0.311 _refine.overall_SU_ML 0.222 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 11.238 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2201 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 26 _refine_hist.number_atoms_solvent 25 _refine_hist.number_atoms_total 2252 _refine_hist.d_res_high 2.75 _refine_hist.d_res_low 30.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.009 0.019 ? 2267 'X-RAY DIFFRACTION' ? r_bond_other_d 0.006 0.020 ? 2267 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.445 2.001 ? 3049 'X-RAY DIFFRACTION' ? r_angle_other_deg 0.912 3.000 ? 5228 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 5.310 5.000 ? 270 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 34.009 25.152 ? 99 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 14.776 15.000 ? 442 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 15.159 15.000 ? 9 'X-RAY DIFFRACTION' ? r_chiral_restr 0.068 0.200 ? 349 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.010 0.020 ? 2468 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.004 0.020 ? 491 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 4.766 7.460 ? 1089 'X-RAY DIFFRACTION' ? r_mcbond_other 4.767 7.457 ? 1088 'X-RAY DIFFRACTION' ? r_mcangle_it 7.298 11.171 ? 1356 'X-RAY DIFFRACTION' ? r_mcangle_other 7.296 11.174 ? 1357 'X-RAY DIFFRACTION' ? r_scbond_it 4.988 8.074 ? 1175 'X-RAY DIFFRACTION' ? r_scbond_other 4.986 8.074 ? 1176 'X-RAY DIFFRACTION' ? r_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_other 8.143 11.866 ? 1693 'X-RAY DIFFRACTION' ? r_long_range_B_refined 11.559 59.209 ? 2615 'X-RAY DIFFRACTION' ? r_long_range_B_other 11.556 59.217 ? 2616 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.750 _refine_ls_shell.d_res_low 2.821 _refine_ls_shell.number_reflns_R_work 679 _refine_ls_shell.R_factor_R_work 0.252 _refine_ls_shell.percent_reflns_obs 100.00 _refine_ls_shell.R_factor_R_free 0.369 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 47 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # _struct.entry_id 5DV3 _struct.title 'Human PPARgamma ligand binding dmain complexed with SB1405 in a covalent bonded form' _struct.pdbx_descriptor 'Peroxisome proliferator-activated receptor gamma, Nuclear receptor coactivator 1 (E.C.2.3.1.48)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5DV3 _struct_keywords.text 'PPARgamma, antagonist, TRANSCRIPTION-TRANSFERASE complex' _struct_keywords.pdbx_keywords TRANSCRIPTION/TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 16 ? PHE A 36 ? PRO A 206 PHE A 226 1 ? 21 HELX_P HELX_P2 AA2 THR A 39 ? THR A 48 ? THR A 229 THR A 238 1 ? 10 HELX_P HELX_P3 AA3 ASP A 61 ? GLY A 68 ? ASP A 251 GLY A 258 1 ? 8 HELX_P HELX_P4 AA4 GLU A 86 ? ILE A 113 ? GLU A 276 ILE A 303 1 ? 28 HELX_P HELX_P5 AA5 ASP A 120 ? MET A 144 ? ASP A 310 MET A 334 1 ? 25 HELX_P HELX_P6 AA6 ARG A 160 ? SER A 165 ? ARG A 350 SER A 355 1 ? 6 HELX_P HELX_P7 AA7 PRO A 169 ? PHE A 173 ? PRO A 359 PHE A 363 5 ? 5 HELX_P HELX_P8 AA8 MET A 174 ? ALA A 186 ? MET A 364 ALA A 376 1 ? 13 HELX_P HELX_P9 AA9 ASP A 190 ? LEU A 203 ? ASP A 380 LEU A 393 1 ? 14 HELX_P HELX_P10 AB1 ASN A 212 ? HIS A 235 ? ASN A 402 HIS A 425 1 ? 24 HELX_P HELX_P11 AB2 GLN A 240 ? GLU A 270 ? GLN A 430 GLU A 460 1 ? 31 HELX_P HELX_P12 AB3 HIS A 276 ? LYS A 284 ? HIS A 466 LYS A 474 1 ? 9 HELX_P HELX_P13 AB4 LYS B 4 ? GLU B 12 ? LYS B 688 GLU B 696 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag none _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 95 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id C _struct_conn.ptnr2_label_comp_id B05 _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id CAV _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 285 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id B05 _struct_conn.ptnr2_auth_seq_id 501 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.693 _struct_conn.pdbx_value_order ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LYS _struct_mon_prot_cis.label_seq_id 168 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LYS _struct_mon_prot_cis.auth_seq_id 358 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 169 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 359 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -4.42 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 57 ? ILE A 59 ? PHE A 247 ILE A 249 AA1 2 GLY A 156 ? THR A 159 ? GLY A 346 THR A 349 AA1 3 GLY A 148 ? ILE A 151 ? GLY A 338 ILE A 341 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 59 ? N ILE A 249 O PHE A 157 ? O PHE A 347 AA1 2 3 O GLY A 156 ? O GLY A 346 N ILE A 151 ? N ILE A 341 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id B05 _struct_site.pdbx_auth_seq_id 501 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 14 _struct_site.details 'binding site for residue B05 A 501' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 14 PHE A 92 ? PHE A 282 . ? 1_555 ? 2 AC1 14 CYS A 95 ? CYS A 285 . ? 1_555 ? 3 AC1 14 GLN A 96 ? GLN A 286 . ? 1_555 ? 4 AC1 14 ARG A 98 ? ARG A 288 . ? 1_555 ? 5 AC1 14 SER A 99 ? SER A 289 . ? 1_555 ? 6 AC1 14 ILE A 136 ? ILE A 326 . ? 1_555 ? 7 AC1 14 LEU A 140 ? LEU A 330 . ? 1_555 ? 8 AC1 14 ILE A 151 ? ILE A 341 . ? 1_555 ? 9 AC1 14 PHE A 173 ? PHE A 363 . ? 1_555 ? 10 AC1 14 LYS A 177 ? LYS A 367 . ? 1_555 ? 11 AC1 14 LEU A 263 ? LEU A 453 . ? 1_555 ? 12 AC1 14 LEU A 279 ? LEU A 469 . ? 1_555 ? 13 AC1 14 TYR A 283 ? TYR A 473 . ? 1_555 ? 14 AC1 14 HOH D . ? HOH A 603 . ? 1_555 ? # _atom_sites.entry_id 5DV3 _atom_sites.fract_transf_matrix[1][1] 0.018537 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.007640 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019014 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 191 ? ? ? A . n A 1 2 SER 2 192 ? ? ? A . n A 1 3 HIS 3 193 ? ? ? A . n A 1 4 MET 4 194 ? ? ? A . n A 1 5 ALA 5 195 ? ? ? A . n A 1 6 GLU 6 196 ? ? ? A . n A 1 7 ILE 7 197 ? ? ? A . n A 1 8 SER 8 198 ? ? ? A . n A 1 9 SER 9 199 ? ? ? A . n A 1 10 ASP 10 200 ? ? ? A . n A 1 11 ILE 11 201 ? ? ? A . n A 1 12 ASP 12 202 ? ? ? A . n A 1 13 GLN 13 203 ? ? ? A . n A 1 14 LEU 14 204 ? ? ? A . n A 1 15 ASN 15 205 ? ? ? A . n A 1 16 PRO 16 206 206 PRO PRO A . n A 1 17 GLU 17 207 207 GLU GLU A . n A 1 18 SER 18 208 208 SER SER A . n A 1 19 ALA 19 209 209 ALA ALA A . n A 1 20 ASP 20 210 210 ASP ASP A . n A 1 21 LEU 21 211 211 LEU LEU A . n A 1 22 ARG 22 212 212 ARG ARG A . n A 1 23 ALA 23 213 213 ALA ALA A . n A 1 24 LEU 24 214 214 LEU LEU A . n A 1 25 ALA 25 215 215 ALA ALA A . n A 1 26 LYS 26 216 216 LYS LYS A . n A 1 27 HIS 27 217 217 HIS HIS A . n A 1 28 LEU 28 218 218 LEU LEU A . n A 1 29 TYR 29 219 219 TYR TYR A . n A 1 30 ASP 30 220 220 ASP ASP A . n A 1 31 SER 31 221 221 SER SER A . n A 1 32 TYR 32 222 222 TYR TYR A . n A 1 33 ILE 33 223 223 ILE ILE A . n A 1 34 LYS 34 224 224 LYS LYS A . n A 1 35 SER 35 225 225 SER SER A . n A 1 36 PHE 36 226 226 PHE PHE A . n A 1 37 PRO 37 227 227 PRO PRO A . n A 1 38 LEU 38 228 228 LEU LEU A . n A 1 39 THR 39 229 229 THR THR A . n A 1 40 LYS 40 230 230 LYS LYS A . n A 1 41 ALA 41 231 231 ALA ALA A . n A 1 42 LYS 42 232 232 LYS LYS A . n A 1 43 ALA 43 233 233 ALA ALA A . n A 1 44 ARG 44 234 234 ARG ARG A . n A 1 45 ALA 45 235 235 ALA ALA A . n A 1 46 ILE 46 236 236 ILE ILE A . n A 1 47 LEU 47 237 237 LEU LEU A . n A 1 48 THR 48 238 238 THR THR A . n A 1 49 GLY 49 239 239 GLY GLY A . n A 1 50 LYS 50 240 240 LYS LYS A . n A 1 51 THR 51 241 241 THR THR A . n A 1 52 THR 52 242 242 THR THR A . n A 1 53 ASP 53 243 243 ASP ASP A . n A 1 54 LYS 54 244 244 LYS LYS A . n A 1 55 SER 55 245 245 SER SER A . n A 1 56 PRO 56 246 246 PRO PRO A . n A 1 57 PHE 57 247 247 PHE PHE A . n A 1 58 VAL 58 248 248 VAL VAL A . n A 1 59 ILE 59 249 249 ILE ILE A . n A 1 60 TYR 60 250 250 TYR TYR A . n A 1 61 ASP 61 251 251 ASP ASP A . n A 1 62 MET 62 252 252 MET MET A . n A 1 63 ASN 63 253 253 ASN ASN A . n A 1 64 SER 64 254 254 SER SER A . n A 1 65 LEU 65 255 255 LEU LEU A . n A 1 66 MET 66 256 256 MET MET A . n A 1 67 MET 67 257 257 MET MET A . n A 1 68 GLY 68 258 258 GLY GLY A . n A 1 69 GLU 69 259 259 GLU GLU A . n A 1 70 ASP 70 260 260 ASP ASP A . n A 1 71 LYS 71 261 261 LYS LYS A . n A 1 72 ILE 72 262 262 ILE ILE A . n A 1 73 LYS 73 263 263 LYS LYS A . n A 1 74 PHE 74 264 264 PHE PHE A . n A 1 75 LYS 75 265 265 LYS LYS A . n A 1 76 HIS 76 266 ? ? ? A . n A 1 77 ILE 77 267 ? ? ? A . n A 1 78 THR 78 268 ? ? ? A . n A 1 79 PRO 79 269 ? ? ? A . n A 1 80 LEU 80 270 ? ? ? A . n A 1 81 GLN 81 271 ? ? ? A . n A 1 82 GLU 82 272 ? ? ? A . n A 1 83 GLN 83 273 ? ? ? A . n A 1 84 SER 84 274 ? ? ? A . n A 1 85 LYS 85 275 275 LYS LYS A . n A 1 86 GLU 86 276 276 GLU GLU A . n A 1 87 VAL 87 277 277 VAL VAL A . n A 1 88 ALA 88 278 278 ALA ALA A . n A 1 89 ILE 89 279 279 ILE ILE A . n A 1 90 ARG 90 280 280 ARG ARG A . n A 1 91 ILE 91 281 281 ILE ILE A . n A 1 92 PHE 92 282 282 PHE PHE A . n A 1 93 GLN 93 283 283 GLN GLN A . n A 1 94 GLY 94 284 284 GLY GLY A . n A 1 95 CYS 95 285 285 CYS CYS A . n A 1 96 GLN 96 286 286 GLN GLN A . n A 1 97 PHE 97 287 287 PHE PHE A . n A 1 98 ARG 98 288 288 ARG ARG A . n A 1 99 SER 99 289 289 SER SER A . n A 1 100 VAL 100 290 290 VAL VAL A . n A 1 101 GLU 101 291 291 GLU GLU A . n A 1 102 ALA 102 292 292 ALA ALA A . n A 1 103 VAL 103 293 293 VAL VAL A . n A 1 104 GLN 104 294 294 GLN GLN A . n A 1 105 GLU 105 295 295 GLU GLU A . n A 1 106 ILE 106 296 296 ILE ILE A . n A 1 107 THR 107 297 297 THR THR A . n A 1 108 GLU 108 298 298 GLU GLU A . n A 1 109 TYR 109 299 299 TYR TYR A . n A 1 110 ALA 110 300 300 ALA ALA A . n A 1 111 LYS 111 301 301 LYS LYS A . n A 1 112 SER 112 302 302 SER SER A . n A 1 113 ILE 113 303 303 ILE ILE A . n A 1 114 PRO 114 304 304 PRO PRO A . n A 1 115 GLY 115 305 305 GLY GLY A . n A 1 116 PHE 116 306 306 PHE PHE A . n A 1 117 VAL 117 307 307 VAL VAL A . n A 1 118 ASN 118 308 308 ASN ASN A . n A 1 119 LEU 119 309 309 LEU LEU A . n A 1 120 ASP 120 310 310 ASP ASP A . n A 1 121 LEU 121 311 311 LEU LEU A . n A 1 122 ASN 122 312 312 ASN ASN A . n A 1 123 ASP 123 313 313 ASP ASP A . n A 1 124 GLN 124 314 314 GLN GLN A . n A 1 125 VAL 125 315 315 VAL VAL A . n A 1 126 THR 126 316 316 THR THR A . n A 1 127 LEU 127 317 317 LEU LEU A . n A 1 128 LEU 128 318 318 LEU LEU A . n A 1 129 LYS 129 319 319 LYS LYS A . n A 1 130 TYR 130 320 320 TYR TYR A . n A 1 131 GLY 131 321 321 GLY GLY A . n A 1 132 VAL 132 322 322 VAL VAL A . n A 1 133 HIS 133 323 323 HIS HIS A . n A 1 134 GLU 134 324 324 GLU GLU A . n A 1 135 ILE 135 325 325 ILE ILE A . n A 1 136 ILE 136 326 326 ILE ILE A . n A 1 137 TYR 137 327 327 TYR TYR A . n A 1 138 THR 138 328 328 THR THR A . n A 1 139 MET 139 329 329 MET MET A . n A 1 140 LEU 140 330 330 LEU LEU A . n A 1 141 ALA 141 331 331 ALA ALA A . n A 1 142 SER 142 332 332 SER SER A . n A 1 143 LEU 143 333 333 LEU LEU A . n A 1 144 MET 144 334 334 MET MET A . n A 1 145 ASN 145 335 335 ASN ASN A . n A 1 146 LYS 146 336 336 LYS LYS A . n A 1 147 ASP 147 337 337 ASP ASP A . n A 1 148 GLY 148 338 338 GLY GLY A . n A 1 149 VAL 149 339 339 VAL VAL A . n A 1 150 LEU 150 340 340 LEU LEU A . n A 1 151 ILE 151 341 341 ILE ILE A . n A 1 152 SER 152 342 342 SER SER A . n A 1 153 GLU 153 343 343 GLU GLU A . n A 1 154 GLY 154 344 344 GLY GLY A . n A 1 155 GLN 155 345 345 GLN GLN A . n A 1 156 GLY 156 346 346 GLY GLY A . n A 1 157 PHE 157 347 347 PHE PHE A . n A 1 158 MET 158 348 348 MET MET A . n A 1 159 THR 159 349 349 THR THR A . n A 1 160 ARG 160 350 350 ARG ARG A . n A 1 161 GLU 161 351 351 GLU GLU A . n A 1 162 PHE 162 352 352 PHE PHE A . n A 1 163 LEU 163 353 353 LEU LEU A . n A 1 164 LYS 164 354 354 LYS LYS A . n A 1 165 SER 165 355 355 SER SER A . n A 1 166 LEU 166 356 356 LEU LEU A . n A 1 167 ARG 167 357 357 ARG ARG A . n A 1 168 LYS 168 358 358 LYS LYS A . n A 1 169 PRO 169 359 359 PRO PRO A . n A 1 170 PHE 170 360 360 PHE PHE A . n A 1 171 GLY 171 361 361 GLY GLY A . n A 1 172 ASP 172 362 362 ASP ASP A . n A 1 173 PHE 173 363 363 PHE PHE A . n A 1 174 MET 174 364 364 MET MET A . n A 1 175 GLU 175 365 365 GLU GLU A . n A 1 176 PRO 176 366 366 PRO PRO A . n A 1 177 LYS 177 367 367 LYS LYS A . n A 1 178 PHE 178 368 368 PHE PHE A . n A 1 179 GLU 179 369 369 GLU GLU A . n A 1 180 PHE 180 370 370 PHE PHE A . n A 1 181 ALA 181 371 371 ALA ALA A . n A 1 182 VAL 182 372 372 VAL VAL A . n A 1 183 LYS 183 373 373 LYS LYS A . n A 1 184 PHE 184 374 374 PHE PHE A . n A 1 185 ASN 185 375 375 ASN ASN A . n A 1 186 ALA 186 376 376 ALA ALA A . n A 1 187 LEU 187 377 377 LEU LEU A . n A 1 188 GLU 188 378 378 GLU GLU A . n A 1 189 LEU 189 379 379 LEU LEU A . n A 1 190 ASP 190 380 380 ASP ASP A . n A 1 191 ASP 191 381 381 ASP ASP A . n A 1 192 SER 192 382 382 SER SER A . n A 1 193 ASP 193 383 383 ASP ASP A . n A 1 194 LEU 194 384 384 LEU LEU A . n A 1 195 ALA 195 385 385 ALA ALA A . n A 1 196 ILE 196 386 386 ILE ILE A . n A 1 197 PHE 197 387 387 PHE PHE A . n A 1 198 ILE 198 388 388 ILE ILE A . n A 1 199 ALA 199 389 389 ALA ALA A . n A 1 200 VAL 200 390 390 VAL VAL A . n A 1 201 ILE 201 391 391 ILE ILE A . n A 1 202 ILE 202 392 392 ILE ILE A . n A 1 203 LEU 203 393 393 LEU LEU A . n A 1 204 SER 204 394 394 SER SER A . n A 1 205 GLY 205 395 395 GLY GLY A . n A 1 206 ASP 206 396 396 ASP ASP A . n A 1 207 ARG 207 397 397 ARG ARG A . n A 1 208 PRO 208 398 398 PRO PRO A . n A 1 209 GLY 209 399 399 GLY GLY A . n A 1 210 LEU 210 400 400 LEU LEU A . n A 1 211 LEU 211 401 401 LEU LEU A . n A 1 212 ASN 212 402 402 ASN ASN A . n A 1 213 VAL 213 403 403 VAL VAL A . n A 1 214 LYS 214 404 404 LYS LYS A . n A 1 215 PRO 215 405 405 PRO PRO A . n A 1 216 ILE 216 406 406 ILE ILE A . n A 1 217 GLU 217 407 407 GLU GLU A . n A 1 218 ASP 218 408 408 ASP ASP A . n A 1 219 ILE 219 409 409 ILE ILE A . n A 1 220 GLN 220 410 410 GLN GLN A . n A 1 221 ASP 221 411 411 ASP ASP A . n A 1 222 ASN 222 412 412 ASN ASN A . n A 1 223 LEU 223 413 413 LEU LEU A . n A 1 224 LEU 224 414 414 LEU LEU A . n A 1 225 GLN 225 415 415 GLN GLN A . n A 1 226 ALA 226 416 416 ALA ALA A . n A 1 227 LEU 227 417 417 LEU LEU A . n A 1 228 GLU 228 418 418 GLU GLU A . n A 1 229 LEU 229 419 419 LEU LEU A . n A 1 230 GLN 230 420 420 GLN GLN A . n A 1 231 LEU 231 421 421 LEU LEU A . n A 1 232 LYS 232 422 422 LYS LYS A . n A 1 233 LEU 233 423 423 LEU LEU A . n A 1 234 ASN 234 424 424 ASN ASN A . n A 1 235 HIS 235 425 425 HIS HIS A . n A 1 236 PRO 236 426 426 PRO PRO A . n A 1 237 GLU 237 427 427 GLU GLU A . n A 1 238 SER 238 428 428 SER SER A . n A 1 239 SER 239 429 429 SER SER A . n A 1 240 GLN 240 430 430 GLN GLN A . n A 1 241 LEU 241 431 431 LEU LEU A . n A 1 242 PHE 242 432 432 PHE PHE A . n A 1 243 ALA 243 433 433 ALA ALA A . n A 1 244 LYS 244 434 434 LYS LYS A . n A 1 245 LEU 245 435 435 LEU LEU A . n A 1 246 LEU 246 436 436 LEU LEU A . n A 1 247 GLN 247 437 437 GLN GLN A . n A 1 248 LYS 248 438 438 LYS LYS A . n A 1 249 MET 249 439 439 MET MET A . n A 1 250 THR 250 440 440 THR THR A . n A 1 251 ASP 251 441 441 ASP ASP A . n A 1 252 LEU 252 442 442 LEU LEU A . n A 1 253 ARG 253 443 443 ARG ARG A . n A 1 254 GLN 254 444 444 GLN GLN A . n A 1 255 ILE 255 445 445 ILE ILE A . n A 1 256 VAL 256 446 446 VAL VAL A . n A 1 257 THR 257 447 447 THR THR A . n A 1 258 GLU 258 448 448 GLU GLU A . n A 1 259 HIS 259 449 449 HIS HIS A . n A 1 260 VAL 260 450 450 VAL VAL A . n A 1 261 GLN 261 451 451 GLN GLN A . n A 1 262 LEU 262 452 452 LEU LEU A . n A 1 263 LEU 263 453 453 LEU LEU A . n A 1 264 GLN 264 454 454 GLN GLN A . n A 1 265 VAL 265 455 455 VAL VAL A . n A 1 266 ILE 266 456 456 ILE ILE A . n A 1 267 LYS 267 457 457 LYS LYS A . n A 1 268 LYS 268 458 458 LYS LYS A . n A 1 269 THR 269 459 459 THR THR A . n A 1 270 GLU 270 460 460 GLU GLU A . n A 1 271 THR 271 461 461 THR THR A . n A 1 272 ASP 272 462 462 ASP ASP A . n A 1 273 MET 273 463 463 MET MET A . n A 1 274 SER 274 464 464 SER SER A . n A 1 275 LEU 275 465 465 LEU LEU A . n A 1 276 HIS 276 466 466 HIS HIS A . n A 1 277 PRO 277 467 467 PRO PRO A . n A 1 278 LEU 278 468 468 LEU LEU A . n A 1 279 LEU 279 469 469 LEU LEU A . n A 1 280 GLN 280 470 470 GLN GLN A . n A 1 281 GLU 281 471 471 GLU GLU A . n A 1 282 ILE 282 472 472 ILE ILE A . n A 1 283 TYR 283 473 473 TYR TYR A . n A 1 284 LYS 284 474 474 LYS LYS A . n A 1 285 ASP 285 475 475 ASP ASP A . n A 1 286 LEU 286 476 476 LEU LEU A . n A 1 287 TYR 287 477 477 TYR TYR A . n B 2 1 GLU 1 685 ? ? ? B . n B 2 2 ARG 2 686 ? ? ? B . n B 2 3 HIS 3 687 687 HIS HIS B . n B 2 4 LYS 4 688 688 LYS LYS B . n B 2 5 ILE 5 689 689 ILE ILE B . n B 2 6 LEU 6 690 690 LEU LEU B . n B 2 7 HIS 7 691 691 HIS HIS B . n B 2 8 ARG 8 692 692 ARG ARG B . n B 2 9 LEU 9 693 693 LEU LEU B . n B 2 10 LEU 10 694 694 LEU LEU B . n B 2 11 GLN 11 695 695 GLN GLN B . n B 2 12 GLU 12 696 696 GLU GLU B . n B 2 13 GLY 13 697 ? ? ? B . n B 2 14 SER 14 698 ? ? ? B . n B 2 15 PRO 15 699 ? ? ? B . n B 2 16 SER 16 700 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 B05 1 501 501 B05 B05 A . D 4 HOH 1 601 623 HOH HOH A . D 4 HOH 2 602 605 HOH HOH A . D 4 HOH 3 603 619 HOH HOH A . D 4 HOH 4 604 616 HOH HOH A . D 4 HOH 5 605 602 HOH HOH A . D 4 HOH 6 606 609 HOH HOH A . D 4 HOH 7 607 606 HOH HOH A . D 4 HOH 8 608 621 HOH HOH A . D 4 HOH 9 609 620 HOH HOH A . D 4 HOH 10 610 603 HOH HOH A . D 4 HOH 11 611 625 HOH HOH A . D 4 HOH 12 612 622 HOH HOH A . D 4 HOH 13 613 624 HOH HOH A . D 4 HOH 14 614 613 HOH HOH A . D 4 HOH 15 615 604 HOH HOH A . D 4 HOH 16 616 614 HOH HOH A . D 4 HOH 17 617 611 HOH HOH A . D 4 HOH 18 618 601 HOH HOH A . D 4 HOH 19 619 610 HOH HOH A . D 4 HOH 20 620 615 HOH HOH A . D 4 HOH 21 621 607 HOH HOH A . D 4 HOH 22 622 608 HOH HOH A . D 4 HOH 23 623 612 HOH HOH A . D 4 HOH 24 624 618 HOH HOH A . E 4 HOH 1 801 617 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1140 ? 1 MORE -9 ? 1 'SSA (A^2)' 13300 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2016-09-21 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0103 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id GLU _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 343 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 37.75 _pdbx_validate_torsion.psi 57.17 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 191 ? A GLY 1 2 1 Y 1 A SER 192 ? A SER 2 3 1 Y 1 A HIS 193 ? A HIS 3 4 1 Y 1 A MET 194 ? A MET 4 5 1 Y 1 A ALA 195 ? A ALA 5 6 1 Y 1 A GLU 196 ? A GLU 6 7 1 Y 1 A ILE 197 ? A ILE 7 8 1 Y 1 A SER 198 ? A SER 8 9 1 Y 1 A SER 199 ? A SER 9 10 1 Y 1 A ASP 200 ? A ASP 10 11 1 Y 1 A ILE 201 ? A ILE 11 12 1 Y 1 A ASP 202 ? A ASP 12 13 1 Y 1 A GLN 203 ? A GLN 13 14 1 Y 1 A LEU 204 ? A LEU 14 15 1 Y 1 A ASN 205 ? A ASN 15 16 1 Y 1 A HIS 266 ? A HIS 76 17 1 Y 1 A ILE 267 ? A ILE 77 18 1 Y 1 A THR 268 ? A THR 78 19 1 Y 1 A PRO 269 ? A PRO 79 20 1 Y 1 A LEU 270 ? A LEU 80 21 1 Y 1 A GLN 271 ? A GLN 81 22 1 Y 1 A GLU 272 ? A GLU 82 23 1 Y 1 A GLN 273 ? A GLN 83 24 1 Y 1 A SER 274 ? A SER 84 25 1 Y 1 B GLU 685 ? B GLU 1 26 1 Y 1 B ARG 686 ? B ARG 2 27 1 Y 1 B GLY 697 ? B GLY 13 28 1 Y 1 B SER 698 ? B SER 14 29 1 Y 1 B PRO 699 ? B PRO 15 30 1 Y 1 B SER 700 ? B SER 16 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'N-[2-(benzyloxy)phenyl]-3-nitrobenzamide' B05 4 water HOH #