data_5ECT
# 
_entry.id   5ECT 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.383 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   5ECT         pdb_00005ect 10.2210/pdb5ect/pdb 
WWPDB D_1000206672 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-11-02 
2 'Structure model' 1 1 2016-12-21 
3 'Structure model' 1 2 2024-01-10 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Data collection'        
3 3 'Structure model' 'Database references'    
4 3 'Structure model' 'Derived calculations'   
5 3 'Structure model' 'Refinement description' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' chem_comp_atom                
2 3 'Structure model' chem_comp_bond                
3 3 'Structure model' database_2                    
4 3 'Structure model' pdbx_initial_refinement_model 
5 3 'Structure model' pdbx_struct_conn_angle        
6 3 'Structure model' struct_conn                   
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  3 'Structure model' '_database_2.pdbx_DOI'                      
2  3 'Structure model' '_database_2.pdbx_database_accession'       
3  3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 
4  3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_symmetry'    
5  3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 
6  3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry'    
7  3 'Structure model' '_pdbx_struct_conn_angle.value'             
8  3 'Structure model' '_struct_conn.pdbx_dist_value'              
9  3 'Structure model' '_struct_conn.ptnr2_auth_seq_id'            
10 3 'Structure model' '_struct_conn.ptnr2_symmetry'               
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5ECT 
_pdbx_database_status.recvd_initial_deposition_date   2015-10-20 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB '4GCY contains the H21W variant of the same protein.'                                           4GCY unspecified 
PDB '3LOJ contains the H145A variant of the same protein.'                                          3LOJ unspecified 
PDB '3I93 contains the T138STOP variant of the same protein.'                                       3I93 unspecified 
PDB '3HZA contains the H145W variant of the same protein.'                                          3HZA unspecified 
PDB '3H6D contains the D28N variant of the same protein.'                                           3H6D unspecified 
PDB '2PY4 contains the wild type form of the same protein complexed with Mg2+ and dUPnPP'           2PY4 unspecified 
PDB '1SJN contains the wild type form of the same protein complexed with Mg2+ and dUPnPP'           1SJN unspecified 
PDB '1SIX contains the wild type form of the same protein complexed with Mg2+ and dUPnPP'           1SIX unspecified 
PDB '1MQ7 contains the wild type form of the same protein'                                          1MQ7 unspecified 
PDB '1SNF contains the wild type form of the same protein complexed with Mg2+ and dUPMP'            1SNF unspecified 
PDB '1SLH contains the wild type form of the same protein complexed with Mg2+ and dUPDP'            1SLH unspecified 
PDB '1SMC contains the wild type form of the same protein complexed with dUPnPP in absence of Mg2+' 1SMC unspecified 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nagy, G.N.'     1 
'Leveles, I.'    2 
'Harmat, V.'     3 
'Vertessy, G.B.' 4 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'J. Am. Chem. Soc.' 
_citation.journal_id_ASTM           JACSAT 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1520-5126 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            138 
_citation.language                  ? 
_citation.page_first                15035 
_citation.page_last                 15045 
_citation.title                     
'Structural Characterization of Arginine Fingers: Identification of an Arginine Finger for the Pyrophosphatase dUTPases.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1021/jacs.6b09012 
_citation.pdbx_database_id_PubMed   27740761 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Nagy, G.N.'     1  ? 
primary 'Suardiaz, R.'   2  ? 
primary 'Lopata, A.'     3  ? 
primary 'Ozohanics, O.'  4  ? 
primary 'Vekey, K.'      5  ? 
primary 'Brooks, B.R.'   6  ? 
primary 'Leveles, I.'    7  ? 
primary 'Toth, J.'       8  ? 
primary 'Vertessy, B.G.' 9  ? 
primary 'Rosta, E.'      10 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 
;Deoxyuridine 5'-triphosphate nucleotidohydrolase
;
16985.291 1   3.6.1.23 G143STOP ? ? 
2 non-polymer syn 
;2'-DEOXYURIDINE 5'-ALPHA,BETA-IMIDO-TRIPHOSPHATE
;
467.157   1   ?        ?        ? ? 
3 non-polymer syn 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL           122.143   1   ?        ?        ? ? 
4 non-polymer syn 'MAGNESIUM ION'                                    24.305    1   ?        ?        ? ? 
5 non-polymer syn GLYCEROL                                           92.094    1   ?        ?        ? ? 
6 water       nat water                                              18.015    127 ?        ?        ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'dUTPase,dUTP pyrophosphatase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGSSHHHHHHSSGLVPRGSHMSTTLAIVRLDPGLPLPSRAHDGDAGVDLYSAEDVELAPGRRALVRTGVAVAVPFGMVGL
VHPRSGLATRVGLSIVNSPGTIDAGYRGEIKVALINLDPAAPIVVHRGDRIAQLLVQRVELVELVEVSSFDEAGLASTSR
GD
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSSHHHHHHSSGLVPRGSHMSTTLAIVRLDPGLPLPSRAHDGDAGVDLYSAEDVELAPGRRALVRTGVAVAVPFGMVGL
VHPRSGLATRVGLSIVNSPGTIDAGYRGEIKVALINLDPAAPIVVHRGDRIAQLLVQRVELVELVEVSSFDEAGLASTSR
GD
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 
;2'-DEOXYURIDINE 5'-ALPHA,BETA-IMIDO-TRIPHOSPHATE
;
DUP 
3 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL           TRS 
4 'MAGNESIUM ION'                                    MG  
5 GLYCEROL                                           GOL 
6 water                                              HOH 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  HIS n 
1 21  MET n 
1 22  SER n 
1 23  THR n 
1 24  THR n 
1 25  LEU n 
1 26  ALA n 
1 27  ILE n 
1 28  VAL n 
1 29  ARG n 
1 30  LEU n 
1 31  ASP n 
1 32  PRO n 
1 33  GLY n 
1 34  LEU n 
1 35  PRO n 
1 36  LEU n 
1 37  PRO n 
1 38  SER n 
1 39  ARG n 
1 40  ALA n 
1 41  HIS n 
1 42  ASP n 
1 43  GLY n 
1 44  ASP n 
1 45  ALA n 
1 46  GLY n 
1 47  VAL n 
1 48  ASP n 
1 49  LEU n 
1 50  TYR n 
1 51  SER n 
1 52  ALA n 
1 53  GLU n 
1 54  ASP n 
1 55  VAL n 
1 56  GLU n 
1 57  LEU n 
1 58  ALA n 
1 59  PRO n 
1 60  GLY n 
1 61  ARG n 
1 62  ARG n 
1 63  ALA n 
1 64  LEU n 
1 65  VAL n 
1 66  ARG n 
1 67  THR n 
1 68  GLY n 
1 69  VAL n 
1 70  ALA n 
1 71  VAL n 
1 72  ALA n 
1 73  VAL n 
1 74  PRO n 
1 75  PHE n 
1 76  GLY n 
1 77  MET n 
1 78  VAL n 
1 79  GLY n 
1 80  LEU n 
1 81  VAL n 
1 82  HIS n 
1 83  PRO n 
1 84  ARG n 
1 85  SER n 
1 86  GLY n 
1 87  LEU n 
1 88  ALA n 
1 89  THR n 
1 90  ARG n 
1 91  VAL n 
1 92  GLY n 
1 93  LEU n 
1 94  SER n 
1 95  ILE n 
1 96  VAL n 
1 97  ASN n 
1 98  SER n 
1 99  PRO n 
1 100 GLY n 
1 101 THR n 
1 102 ILE n 
1 103 ASP n 
1 104 ALA n 
1 105 GLY n 
1 106 TYR n 
1 107 ARG n 
1 108 GLY n 
1 109 GLU n 
1 110 ILE n 
1 111 LYS n 
1 112 VAL n 
1 113 ALA n 
1 114 LEU n 
1 115 ILE n 
1 116 ASN n 
1 117 LEU n 
1 118 ASP n 
1 119 PRO n 
1 120 ALA n 
1 121 ALA n 
1 122 PRO n 
1 123 ILE n 
1 124 VAL n 
1 125 VAL n 
1 126 HIS n 
1 127 ARG n 
1 128 GLY n 
1 129 ASP n 
1 130 ARG n 
1 131 ILE n 
1 132 ALA n 
1 133 GLN n 
1 134 LEU n 
1 135 LEU n 
1 136 VAL n 
1 137 GLN n 
1 138 ARG n 
1 139 VAL n 
1 140 GLU n 
1 141 LEU n 
1 142 VAL n 
1 143 GLU n 
1 144 LEU n 
1 145 VAL n 
1 146 GLU n 
1 147 VAL n 
1 148 SER n 
1 149 SER n 
1 150 PHE n 
1 151 ASP n 
1 152 GLU n 
1 153 ALA n 
1 154 GLY n 
1 155 LEU n 
1 156 ALA n 
1 157 SER n 
1 158 THR n 
1 159 SER n 
1 160 ARG n 
1 161 GLY n 
1 162 ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   162 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'dut, Rv2697c, MTCY05A6.18c' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mycobacterium tuberculosis' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1773 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET15b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                            ?                               'C3 H7 N O2'       
89.093  
ARG 'L-peptide linking' y ARGININE                                           ?                               'C6 H15 N4 O2 1'   
175.209 
ASN 'L-peptide linking' y ASPARAGINE                                         ?                               'C4 H8 N2 O3'      
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                    ?                               'C4 H7 N O4'       
133.103 
DUP non-polymer         . 
;2'-DEOXYURIDINE 5'-ALPHA,BETA-IMIDO-TRIPHOSPHATE
;
?                               'C9 H16 N3 O13 P3' 467.157 
GLN 'L-peptide linking' y GLUTAMINE                                          ?                               'C5 H10 N2 O3'     
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                    ?                               'C5 H9 N O4'       
147.129 
GLY 'peptide linking'   y GLYCINE                                            ?                               'C2 H5 N O2'       
75.067  
GOL non-polymer         . GLYCEROL                                           'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'         
92.094  
HIS 'L-peptide linking' y HISTIDINE                                          ?                               'C6 H10 N3 O2 1'   
156.162 
HOH non-polymer         . WATER                                              ?                               'H2 O'             
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                         ?                               'C6 H13 N O2'      
131.173 
LEU 'L-peptide linking' y LEUCINE                                            ?                               'C6 H13 N O2'      
131.173 
LYS 'L-peptide linking' y LYSINE                                             ?                               'C6 H15 N2 O2 1'   
147.195 
MET 'L-peptide linking' y METHIONINE                                         ?                               'C5 H11 N O2 S'    
149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                    ?                               'Mg 2'             
24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                      ?                               'C9 H11 N O2'      
165.189 
PRO 'L-peptide linking' y PROLINE                                            ?                               'C5 H9 N O2'       
115.130 
SER 'L-peptide linking' y SERINE                                             ?                               'C3 H7 N O3'       
105.093 
THR 'L-peptide linking' y THREONINE                                          ?                               'C4 H9 N O3'       
119.119 
TRS non-polymer         . 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL           'TRIS BUFFER'                   'C4 H12 N O3 1'    
122.143 
TYR 'L-peptide linking' y TYROSINE                                           ?                               'C9 H11 N O3'      
181.189 
VAL 'L-peptide linking' y VALINE                                             ?                               'C5 H11 N O2'      
117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -19 ?   ?   ?   A . n 
A 1 2   GLY 2   -18 ?   ?   ?   A . n 
A 1 3   SER 3   -17 ?   ?   ?   A . n 
A 1 4   SER 4   -16 ?   ?   ?   A . n 
A 1 5   HIS 5   -15 ?   ?   ?   A . n 
A 1 6   HIS 6   -14 ?   ?   ?   A . n 
A 1 7   HIS 7   -13 ?   ?   ?   A . n 
A 1 8   HIS 8   -12 ?   ?   ?   A . n 
A 1 9   HIS 9   -11 ?   ?   ?   A . n 
A 1 10  HIS 10  -10 ?   ?   ?   A . n 
A 1 11  SER 11  -9  ?   ?   ?   A . n 
A 1 12  SER 12  -8  -8  SER SER A . n 
A 1 13  GLY 13  -7  -7  GLY GLY A . n 
A 1 14  LEU 14  -6  -6  LEU LEU A . n 
A 1 15  VAL 15  -5  -5  VAL VAL A . n 
A 1 16  PRO 16  -4  -4  PRO PRO A . n 
A 1 17  ARG 17  -3  -3  ARG ARG A . n 
A 1 18  GLY 18  -2  -2  GLY GLY A . n 
A 1 19  SER 19  -1  -1  SER SER A . n 
A 1 20  HIS 20  0   0   HIS HIS A . n 
A 1 21  MET 21  1   1   MET MET A . n 
A 1 22  SER 22  2   2   SER SER A . n 
A 1 23  THR 23  3   3   THR THR A . n 
A 1 24  THR 24  4   4   THR THR A . n 
A 1 25  LEU 25  5   5   LEU LEU A . n 
A 1 26  ALA 26  6   6   ALA ALA A . n 
A 1 27  ILE 27  7   7   ILE ILE A . n 
A 1 28  VAL 28  8   8   VAL VAL A . n 
A 1 29  ARG 29  9   9   ARG ARG A . n 
A 1 30  LEU 30  10  10  LEU LEU A . n 
A 1 31  ASP 31  11  11  ASP ASP A . n 
A 1 32  PRO 32  12  12  PRO PRO A . n 
A 1 33  GLY 33  13  13  GLY GLY A . n 
A 1 34  LEU 34  14  14  LEU LEU A . n 
A 1 35  PRO 35  15  15  PRO PRO A . n 
A 1 36  LEU 36  16  16  LEU LEU A . n 
A 1 37  PRO 37  17  17  PRO PRO A . n 
A 1 38  SER 38  18  18  SER SER A . n 
A 1 39  ARG 39  19  19  ARG ARG A . n 
A 1 40  ALA 40  20  20  ALA ALA A . n 
A 1 41  HIS 41  21  21  HIS HIS A . n 
A 1 42  ASP 42  22  22  ASP ASP A . n 
A 1 43  GLY 43  23  23  GLY GLY A . n 
A 1 44  ASP 44  24  24  ASP ASP A . n 
A 1 45  ALA 45  25  25  ALA ALA A . n 
A 1 46  GLY 46  26  26  GLY GLY A . n 
A 1 47  VAL 47  27  27  VAL VAL A . n 
A 1 48  ASP 48  28  28  ASP ASP A . n 
A 1 49  LEU 49  29  29  LEU LEU A . n 
A 1 50  TYR 50  30  30  TYR TYR A . n 
A 1 51  SER 51  31  31  SER SER A . n 
A 1 52  ALA 52  32  32  ALA ALA A . n 
A 1 53  GLU 53  33  33  GLU GLU A . n 
A 1 54  ASP 54  34  34  ASP ASP A . n 
A 1 55  VAL 55  35  35  VAL VAL A . n 
A 1 56  GLU 56  36  36  GLU GLU A . n 
A 1 57  LEU 57  37  37  LEU LEU A . n 
A 1 58  ALA 58  38  38  ALA ALA A . n 
A 1 59  PRO 59  39  39  PRO PRO A . n 
A 1 60  GLY 60  40  40  GLY GLY A . n 
A 1 61  ARG 61  41  41  ARG ARG A . n 
A 1 62  ARG 62  42  42  ARG ARG A . n 
A 1 63  ALA 63  43  43  ALA ALA A . n 
A 1 64  LEU 64  44  44  LEU LEU A . n 
A 1 65  VAL 65  45  45  VAL VAL A . n 
A 1 66  ARG 66  46  46  ARG ARG A . n 
A 1 67  THR 67  47  47  THR THR A . n 
A 1 68  GLY 68  48  48  GLY GLY A . n 
A 1 69  VAL 69  49  49  VAL VAL A . n 
A 1 70  ALA 70  50  50  ALA ALA A . n 
A 1 71  VAL 71  51  51  VAL VAL A . n 
A 1 72  ALA 72  52  52  ALA ALA A . n 
A 1 73  VAL 73  53  53  VAL VAL A . n 
A 1 74  PRO 74  54  54  PRO PRO A . n 
A 1 75  PHE 75  55  55  PHE PHE A . n 
A 1 76  GLY 76  56  56  GLY GLY A . n 
A 1 77  MET 77  57  57  MET MET A . n 
A 1 78  VAL 78  58  58  VAL VAL A . n 
A 1 79  GLY 79  59  59  GLY GLY A . n 
A 1 80  LEU 80  60  60  LEU LEU A . n 
A 1 81  VAL 81  61  61  VAL VAL A . n 
A 1 82  HIS 82  62  62  HIS HIS A . n 
A 1 83  PRO 83  63  63  PRO PRO A . n 
A 1 84  ARG 84  64  64  ARG ARG A . n 
A 1 85  SER 85  65  65  SER SER A . n 
A 1 86  GLY 86  66  66  GLY GLY A . n 
A 1 87  LEU 87  67  67  LEU LEU A . n 
A 1 88  ALA 88  68  68  ALA ALA A . n 
A 1 89  THR 89  69  69  THR THR A . n 
A 1 90  ARG 90  70  70  ARG ARG A . n 
A 1 91  VAL 91  71  71  VAL VAL A . n 
A 1 92  GLY 92  72  72  GLY GLY A . n 
A 1 93  LEU 93  73  73  LEU LEU A . n 
A 1 94  SER 94  74  74  SER SER A . n 
A 1 95  ILE 95  75  75  ILE ILE A . n 
A 1 96  VAL 96  76  76  VAL VAL A . n 
A 1 97  ASN 97  77  77  ASN ASN A . n 
A 1 98  SER 98  78  78  SER SER A . n 
A 1 99  PRO 99  79  79  PRO PRO A . n 
A 1 100 GLY 100 80  80  GLY GLY A . n 
A 1 101 THR 101 81  81  THR THR A . n 
A 1 102 ILE 102 82  82  ILE ILE A . n 
A 1 103 ASP 103 83  83  ASP ASP A . n 
A 1 104 ALA 104 84  84  ALA ALA A . n 
A 1 105 GLY 105 85  85  GLY GLY A . n 
A 1 106 TYR 106 86  86  TYR TYR A . n 
A 1 107 ARG 107 87  87  ARG ARG A . n 
A 1 108 GLY 108 88  88  GLY GLY A . n 
A 1 109 GLU 109 89  89  GLU GLU A . n 
A 1 110 ILE 110 90  90  ILE ILE A . n 
A 1 111 LYS 111 91  91  LYS LYS A . n 
A 1 112 VAL 112 92  92  VAL VAL A . n 
A 1 113 ALA 113 93  93  ALA ALA A . n 
A 1 114 LEU 114 94  94  LEU LEU A . n 
A 1 115 ILE 115 95  95  ILE ILE A . n 
A 1 116 ASN 116 96  96  ASN ASN A . n 
A 1 117 LEU 117 97  97  LEU LEU A . n 
A 1 118 ASP 118 98  98  ASP ASP A . n 
A 1 119 PRO 119 99  99  PRO PRO A . n 
A 1 120 ALA 120 100 100 ALA ALA A . n 
A 1 121 ALA 121 101 101 ALA ALA A . n 
A 1 122 PRO 122 102 102 PRO PRO A . n 
A 1 123 ILE 123 103 103 ILE ILE A . n 
A 1 124 VAL 124 104 104 VAL VAL A . n 
A 1 125 VAL 125 105 105 VAL VAL A . n 
A 1 126 HIS 126 106 106 HIS HIS A . n 
A 1 127 ARG 127 107 107 ARG ARG A . n 
A 1 128 GLY 128 108 108 GLY GLY A . n 
A 1 129 ASP 129 109 109 ASP ASP A . n 
A 1 130 ARG 130 110 110 ARG ARG A . n 
A 1 131 ILE 131 111 111 ILE ILE A . n 
A 1 132 ALA 132 112 112 ALA ALA A . n 
A 1 133 GLN 133 113 113 GLN GLN A . n 
A 1 134 LEU 134 114 114 LEU LEU A . n 
A 1 135 LEU 135 115 115 LEU LEU A . n 
A 1 136 VAL 136 116 116 VAL VAL A . n 
A 1 137 GLN 137 117 117 GLN GLN A . n 
A 1 138 ARG 138 118 118 ARG ARG A . n 
A 1 139 VAL 139 119 119 VAL VAL A . n 
A 1 140 GLU 140 120 120 GLU GLU A . n 
A 1 141 LEU 141 121 121 LEU LEU A . n 
A 1 142 VAL 142 122 122 VAL VAL A . n 
A 1 143 GLU 143 123 123 GLU GLU A . n 
A 1 144 LEU 144 124 124 LEU LEU A . n 
A 1 145 VAL 145 125 125 VAL VAL A . n 
A 1 146 GLU 146 126 126 GLU GLU A . n 
A 1 147 VAL 147 127 127 VAL VAL A . n 
A 1 148 SER 148 128 128 SER SER A . n 
A 1 149 SER 149 129 129 SER SER A . n 
A 1 150 PHE 150 130 130 PHE PHE A . n 
A 1 151 ASP 151 131 131 ASP ASP A . n 
A 1 152 GLU 152 132 132 GLU GLU A . n 
A 1 153 ALA 153 133 133 ALA ALA A . n 
A 1 154 GLY 154 134 ?   ?   ?   A . n 
A 1 155 LEU 155 135 ?   ?   ?   A . n 
A 1 156 ALA 156 136 ?   ?   ?   A . n 
A 1 157 SER 157 137 ?   ?   ?   A . n 
A 1 158 THR 158 138 138 THR THR A . n 
A 1 159 SER 159 139 139 SER SER A . n 
A 1 160 ARG 160 140 140 ARG ARG A . n 
A 1 161 GLY 161 141 141 GLY GLY A . n 
A 1 162 ASP 162 142 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 DUP 1   201 777 DUP DUP A . 
C 3 TRS 1   202 201 TRS TRS A . 
D 4 MG  1   203 1   MG  MG  A . 
E 5 GOL 1   204 202 GOL GOL A . 
F 6 HOH 1   301 142 HOH HOH A . 
F 6 HOH 2   302 47  HOH HOH A . 
F 6 HOH 3   303 129 HOH HOH A . 
F 6 HOH 4   304 77  HOH HOH A . 
F 6 HOH 5   305 16  HOH HOH A . 
F 6 HOH 6   306 113 HOH HOH A . 
F 6 HOH 7   307 115 HOH HOH A . 
F 6 HOH 8   308 5   HOH HOH A . 
F 6 HOH 9   309 70  HOH HOH A . 
F 6 HOH 10  310 135 HOH HOH A . 
F 6 HOH 11  311 103 HOH HOH A . 
F 6 HOH 12  312 29  HOH HOH A . 
F 6 HOH 13  313 73  HOH HOH A . 
F 6 HOH 14  314 78  HOH HOH A . 
F 6 HOH 15  315 106 HOH HOH A . 
F 6 HOH 16  316 110 HOH HOH A . 
F 6 HOH 17  317 159 HOH HOH A . 
F 6 HOH 18  318 38  HOH HOH A . 
F 6 HOH 19  319 25  HOH HOH A . 
F 6 HOH 20  320 102 HOH HOH A . 
F 6 HOH 21  321 83  HOH HOH A . 
F 6 HOH 22  322 105 HOH HOH A . 
F 6 HOH 23  323 76  HOH HOH A . 
F 6 HOH 24  324 48  HOH HOH A . 
F 6 HOH 25  325 100 HOH HOH A . 
F 6 HOH 26  326 15  HOH HOH A . 
F 6 HOH 27  327 155 HOH HOH A . 
F 6 HOH 28  328 35  HOH HOH A . 
F 6 HOH 29  329 36  HOH HOH A . 
F 6 HOH 30  330 166 HOH HOH A . 
F 6 HOH 31  331 1   HOH HOH A . 
F 6 HOH 32  332 98  HOH HOH A . 
F 6 HOH 33  333 92  HOH HOH A . 
F 6 HOH 34  334 11  HOH HOH A . 
F 6 HOH 35  335 34  HOH HOH A . 
F 6 HOH 36  336 116 HOH HOH A . 
F 6 HOH 37  337 18  HOH HOH A . 
F 6 HOH 38  338 23  HOH HOH A . 
F 6 HOH 39  339 128 HOH HOH A . 
F 6 HOH 40  340 31  HOH HOH A . 
F 6 HOH 41  341 39  HOH HOH A . 
F 6 HOH 42  342 19  HOH HOH A . 
F 6 HOH 43  343 95  HOH HOH A . 
F 6 HOH 44  344 107 HOH HOH A . 
F 6 HOH 45  345 13  HOH HOH A . 
F 6 HOH 46  346 12  HOH HOH A . 
F 6 HOH 47  347 46  HOH HOH A . 
F 6 HOH 48  348 17  HOH HOH A . 
F 6 HOH 49  349 72  HOH HOH A . 
F 6 HOH 50  350 26  HOH HOH A . 
F 6 HOH 51  351 117 HOH HOH A . 
F 6 HOH 52  352 108 HOH HOH A . 
F 6 HOH 53  353 109 HOH HOH A . 
F 6 HOH 54  354 141 HOH HOH A . 
F 6 HOH 55  355 30  HOH HOH A . 
F 6 HOH 56  356 27  HOH HOH A . 
F 6 HOH 57  357 144 HOH HOH A . 
F 6 HOH 58  358 71  HOH HOH A . 
F 6 HOH 59  359 94  HOH HOH A . 
F 6 HOH 60  360 130 HOH HOH A . 
F 6 HOH 61  361 133 HOH HOH A . 
F 6 HOH 62  362 32  HOH HOH A . 
F 6 HOH 63  363 160 HOH HOH A . 
F 6 HOH 64  364 14  HOH HOH A . 
F 6 HOH 65  365 122 HOH HOH A . 
F 6 HOH 66  366 3   HOH HOH A . 
F 6 HOH 67  367 28  HOH HOH A . 
F 6 HOH 68  368 134 HOH HOH A . 
F 6 HOH 69  369 131 HOH HOH A . 
F 6 HOH 70  370 81  HOH HOH A . 
F 6 HOH 71  371 33  HOH HOH A . 
F 6 HOH 72  372 10  HOH HOH A . 
F 6 HOH 73  373 85  HOH HOH A . 
F 6 HOH 74  374 74  HOH HOH A . 
F 6 HOH 75  375 97  HOH HOH A . 
F 6 HOH 76  376 154 HOH HOH A . 
F 6 HOH 77  377 164 HOH HOH A . 
F 6 HOH 78  378 9   HOH HOH A . 
F 6 HOH 79  379 88  HOH HOH A . 
F 6 HOH 80  380 43  HOH HOH A . 
F 6 HOH 81  381 138 HOH HOH A . 
F 6 HOH 82  382 101 HOH HOH A . 
F 6 HOH 83  383 89  HOH HOH A . 
F 6 HOH 84  384 163 HOH HOH A . 
F 6 HOH 85  385 50  HOH HOH A . 
F 6 HOH 86  386 149 HOH HOH A . 
F 6 HOH 87  387 96  HOH HOH A . 
F 6 HOH 88  388 6   HOH HOH A . 
F 6 HOH 89  389 104 HOH HOH A . 
F 6 HOH 90  390 170 HOH HOH A . 
F 6 HOH 91  391 143 HOH HOH A . 
F 6 HOH 92  392 145 HOH HOH A . 
F 6 HOH 93  393 79  HOH HOH A . 
F 6 HOH 94  394 22  HOH HOH A . 
F 6 HOH 95  395 24  HOH HOH A . 
F 6 HOH 96  396 91  HOH HOH A . 
F 6 HOH 97  397 151 HOH HOH A . 
F 6 HOH 98  398 161 HOH HOH A . 
F 6 HOH 99  399 139 HOH HOH A . 
F 6 HOH 100 400 21  HOH HOH A . 
F 6 HOH 101 401 137 HOH HOH A . 
F 6 HOH 102 402 82  HOH HOH A . 
F 6 HOH 103 403 4   HOH HOH A . 
F 6 HOH 104 404 132 HOH HOH A . 
F 6 HOH 105 405 87  HOH HOH A . 
F 6 HOH 106 406 150 HOH HOH A . 
F 6 HOH 107 407 42  HOH HOH A . 
F 6 HOH 108 408 157 HOH HOH A . 
F 6 HOH 109 409 93  HOH HOH A . 
F 6 HOH 110 410 20  HOH HOH A . 
F 6 HOH 111 411 146 HOH HOH A . 
F 6 HOH 112 412 99  HOH HOH A . 
F 6 HOH 113 413 80  HOH HOH A . 
F 6 HOH 114 414 118 HOH HOH A . 
F 6 HOH 115 415 156 HOH HOH A . 
F 6 HOH 116 416 136 HOH HOH A . 
F 6 HOH 117 417 114 HOH HOH A . 
F 6 HOH 118 418 165 HOH HOH A . 
F 6 HOH 119 419 169 HOH HOH A . 
F 6 HOH 120 420 75  HOH HOH A . 
F 6 HOH 121 421 152 HOH HOH A . 
F 6 HOH 122 422 168 HOH HOH A . 
F 6 HOH 123 423 167 HOH HOH A . 
F 6 HOH 124 424 158 HOH HOH A . 
F 6 HOH 125 425 84  HOH HOH A . 
F 6 HOH 126 426 153 HOH HOH A . 
F 6 HOH 127 427 119 HOH HOH A . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A SER -8  ? OG  ? A SER 12  OG  
2  1 Y 1 A ARG -3  ? CB  ? A ARG 17  CB  
3  1 Y 1 A ARG -3  ? CG  ? A ARG 17  CG  
4  1 Y 1 A ARG -3  ? CD  ? A ARG 17  CD  
5  1 Y 1 A ARG -3  ? NE  ? A ARG 17  NE  
6  1 Y 1 A ARG -3  ? CZ  ? A ARG 17  CZ  
7  1 Y 1 A ARG -3  ? NH1 ? A ARG 17  NH1 
8  1 Y 1 A ARG -3  ? NH2 ? A ARG 17  NH2 
9  1 Y 1 A SER -1  ? OG  ? A SER 19  OG  
10 1 Y 1 A MET 1   ? CG  ? A MET 21  CG  
11 1 Y 1 A MET 1   ? SD  ? A MET 21  SD  
12 1 Y 1 A MET 1   ? CE  ? A MET 21  CE  
13 1 Y 1 A ARG 46  ? CZ  ? A ARG 66  CZ  
14 1 Y 1 A ARG 46  ? NH1 ? A ARG 66  NH1 
15 1 Y 1 A ARG 46  ? NH2 ? A ARG 66  NH2 
16 1 Y 1 A ASP 131 ? CG  ? A ASP 151 CG  
17 1 Y 1 A ASP 131 ? OD1 ? A ASP 151 OD1 
18 1 Y 1 A ASP 131 ? OD2 ? A ASP 151 OD2 
19 1 Y 1 A GLU 132 ? CG  ? A GLU 152 CG  
20 1 Y 1 A GLU 132 ? CD  ? A GLU 152 CD  
21 1 Y 1 A GLU 132 ? OE1 ? A GLU 152 OE1 
22 1 Y 1 A GLU 132 ? OE2 ? A GLU 152 OE2 
23 1 N 1 A TRS 202 ? C2  ? C TRS 1   C2  
24 1 N 1 A TRS 202 ? C3  ? C TRS 1   C3  
25 1 N 1 A TRS 202 ? O2  ? C TRS 1   O2  
26 1 N 1 A TRS 202 ? O3  ? C TRS 1   O3  
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0049 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .        2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .        3 
? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot   ? ? ? .        4 
? phasing          ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? .        5 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5ECT 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     54.780 
_cell.length_a_esd                 ? 
_cell.length_b                     54.780 
_cell.length_b_esd                 ? 
_cell.length_c                     84.079 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        6 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5ECT 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                173 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 63' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5ECT 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.15 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         42.75 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '1.5 M ammonium sulfate, 0.1M Tris/HCl, 12% glycerol' 
_exptl_crystal_grow.pdbx_pH_range   7.5-8.5 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 225 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-02-06 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.8729 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ESRF BEAMLINE ID23-2' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.8729 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ID23-2 
_diffrn_source.pdbx_synchrotron_site       ESRF 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5ECT 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.3 
_reflns.d_resolution_low                 26.05 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       34842 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.10 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.3 
_reflns.pdbx_Rmerge_I_obs                0.028 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            21.23 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.3 
_reflns_shell.d_res_low                   1.344 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.95 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        99.27 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             3.3 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            -0.00 
_refine.aniso_B[1][2]                            -0.00 
_refine.aniso_B[1][3]                            -0.00 
_refine.aniso_B[2][2]                            -0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.aniso_B[3][3]                            0.01 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               21.974 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.986 
_refine.correlation_coeff_Fo_to_Fc_free          0.978 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5ECT 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.30 
_refine.ls_d_res_low                             26.04 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     33008 
_refine.ls_number_reflns_R_free                  1813 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.10 
_refine.ls_percent_reflns_R_free                 5.2 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.12441 
_refine.ls_R_factor_R_free                       0.15679 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.12267 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_starting_model                      3HZA 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.039 
_refine.pdbx_overall_ESU_R_Free                  0.040 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             2.007 
_refine.overall_SU_ML                            0.035 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        1050 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         39 
_refine_hist.number_atoms_solvent             127 
_refine_hist.number_atoms_total               1216 
_refine_hist.d_res_high                       1.30 
_refine_hist.d_res_low                        26.04 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.019  0.019  1126 ? r_bond_refined_d             ? ? 
'X-RAY DIFFRACTION' ? 0.001  0.020  1115 ? r_bond_other_d               ? ? 
'X-RAY DIFFRACTION' ? 1.899  2.026  1541 ? r_angle_refined_deg          ? ? 
'X-RAY DIFFRACTION' ? 1.249  3.000  2548 ? r_angle_other_deg            ? ? 
'X-RAY DIFFRACTION' ? 6.720  5.000  150  ? r_dihedral_angle_1_deg       ? ? 
'X-RAY DIFFRACTION' ? 32.469 21.282 39   ? r_dihedral_angle_2_deg       ? ? 
'X-RAY DIFFRACTION' ? 10.289 15.000 167  ? r_dihedral_angle_3_deg       ? ? 
'X-RAY DIFFRACTION' ? 18.487 15.000 13   ? r_dihedral_angle_4_deg       ? ? 
'X-RAY DIFFRACTION' ? 0.120  0.200  187  ? r_chiral_restr               ? ? 
'X-RAY DIFFRACTION' ? 0.009  0.021  1250 ? r_gen_planes_refined         ? ? 
'X-RAY DIFFRACTION' ? 0.005  0.020  235  ? r_gen_planes_other           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbd_refined                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbd_other                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbtor_refined              ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbtor_other                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_xyhbond_nbd_refined        ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_xyhbond_nbd_other          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_metal_ion_refined          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_metal_ion_other            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_vdw_refined       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_vdw_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_hbond_refined     ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_hbond_other       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_metal_ion_refined ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_metal_ion_other   ? ? 
'X-RAY DIFFRACTION' ? 5.658  2.132  589  ? r_mcbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 5.712  2.133  587  ? r_mcbond_other               ? ? 
'X-RAY DIFFRACTION' ? 7.339  3.180  733  ? r_mcangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 7.404  3.189  734  ? r_mcangle_other              ? ? 
'X-RAY DIFFRACTION' ? 4.511  2.200  535  ? r_scbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 4.495  2.200  535  ? r_scbond_other               ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_scangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 5.170  3.228  804  ? r_scangle_other              ? ? 
'X-RAY DIFFRACTION' ? 7.140  17.251 1174 ? r_long_range_B_refined       ? ? 
'X-RAY DIFFRACTION' ? 7.146  17.281 1175 ? r_long_range_B_other         ? ? 
'X-RAY DIFFRACTION' ? 5.038  3.000  2236 ? r_rigid_bond_restr           ? ? 
'X-RAY DIFFRACTION' ? 27.470 5.000  52   ? r_sphericity_free            ? ? 
'X-RAY DIFFRACTION' ? 16.086 5.000  2296 ? r_sphericity_bonded          ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       1.300 
_refine_ls_shell.d_res_low                        1.334 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             112 
_refine_ls_shell.number_reflns_R_work             2459 
_refine_ls_shell.percent_reflns_obs               99.27 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.281 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.269 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     5ECT 
_struct.title                        'Mycobacterium tuberculosis dUTPase G143STOP mutant' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5ECT 
_struct_keywords.text            'HYDROLASE, JELLY-ROLL, TRIMER' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    DUT_MYCTU 
_struct_ref.pdbx_db_accession          P9WNS5 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSTTLAIVRLDPGLPLPSRAHDGDAGVDLYSAEDVELAPGRRALVRTGVAVAVPFGMVGLVHPRSGLATRVGLSIVNSPG
TIDAGYRGEIKVALINLDPAAPIVVHRGDRIAQLLVQRVELVELVEVSSFDEAGLASTSRGD
;
_struct_ref.pdbx_align_begin           1 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              5ECT 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 21 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 162 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P9WNS5 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  142 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       142 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5ECT MET A 1  ? UNP P9WNS5 ? ? 'initiating methionine' -19 1  
1 5ECT GLY A 2  ? UNP P9WNS5 ? ? 'expression tag'        -18 2  
1 5ECT SER A 3  ? UNP P9WNS5 ? ? 'expression tag'        -17 3  
1 5ECT SER A 4  ? UNP P9WNS5 ? ? 'expression tag'        -16 4  
1 5ECT HIS A 5  ? UNP P9WNS5 ? ? 'expression tag'        -15 5  
1 5ECT HIS A 6  ? UNP P9WNS5 ? ? 'expression tag'        -14 6  
1 5ECT HIS A 7  ? UNP P9WNS5 ? ? 'expression tag'        -13 7  
1 5ECT HIS A 8  ? UNP P9WNS5 ? ? 'expression tag'        -12 8  
1 5ECT HIS A 9  ? UNP P9WNS5 ? ? 'expression tag'        -11 9  
1 5ECT HIS A 10 ? UNP P9WNS5 ? ? 'expression tag'        -10 10 
1 5ECT SER A 11 ? UNP P9WNS5 ? ? 'expression tag'        -9  11 
1 5ECT SER A 12 ? UNP P9WNS5 ? ? 'expression tag'        -8  12 
1 5ECT GLY A 13 ? UNP P9WNS5 ? ? 'expression tag'        -7  13 
1 5ECT LEU A 14 ? UNP P9WNS5 ? ? 'expression tag'        -6  14 
1 5ECT VAL A 15 ? UNP P9WNS5 ? ? 'expression tag'        -5  15 
1 5ECT PRO A 16 ? UNP P9WNS5 ? ? 'expression tag'        -4  16 
1 5ECT ARG A 17 ? UNP P9WNS5 ? ? 'expression tag'        -3  17 
1 5ECT GLY A 18 ? UNP P9WNS5 ? ? 'expression tag'        -2  18 
1 5ECT SER A 19 ? UNP P9WNS5 ? ? 'expression tag'        -1  19 
1 5ECT HIS A 20 ? UNP P9WNS5 ? ? 'expression tag'        0   20 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 14700 ? 
1 MORE         -81   ? 
1 'SSA (A^2)'  17290 ? 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000  0.0000000000  0.0000000000 0.0000000000   0.0000000000  
1.0000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_565 -y,x-y+1,z  -0.5000000000 -0.8660254038 0.0000000000 -27.3900000000 0.8660254038  
-0.5000000000 0.0000000000 47.4408716193 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
3 'crystal symmetry operation' 3_455 -x+y-1,-x,z -0.5000000000 0.8660254038  0.0000000000 -54.7800000000 -0.8660254038 
-0.5000000000 0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 PRO A 16 ? HIS A 20 ? PRO A -4 HIS A 0  5 ? 5 
HELX_P HELX_P2 AA2 ARG A 84 ? GLY A 92 ? ARG A 64 GLY A 72 1 ? 9 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1 metalc ? ? B DUP . O2A ? ? ? 1_555 D MG  . MG ? ? A DUP 201 A MG  203 1_555 ? ? ? ? ? ? ? 2.056 ? ? 
metalc2 metalc ? ? B DUP . O2B ? ? ? 1_555 D MG  . MG ? ? A DUP 201 A MG  203 1_555 ? ? ? ? ? ? ? 2.099 ? ? 
metalc3 metalc ? ? B DUP . O1G ? ? ? 1_555 D MG  . MG ? ? A DUP 201 A MG  203 1_555 ? ? ? ? ? ? ? 2.030 ? ? 
metalc4 metalc ? ? D MG  . MG  ? ? ? 1_555 F HOH . O  ? ? A MG  203 A HOH 305 3_455 ? ? ? ? ? ? ? 2.063 ? ? 
metalc5 metalc ? ? D MG  . MG  ? ? ? 1_555 F HOH . O  ? ? A MG  203 A HOH 372 1_555 ? ? ? ? ? ? ? 2.087 ? ? 
metalc6 metalc ? ? D MG  . MG  ? ? ? 1_555 F HOH . O  ? ? A MG  203 A HOH 378 1_555 ? ? ? ? ? ? ? 2.149 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O2A ? B DUP . ? A DUP 201 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O2B ? B DUP . ? A DUP 201 ? 1_555 87.4  ? 
2  O2A ? B DUP . ? A DUP 201 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O1G ? B DUP . ? A DUP 201 ? 1_555 94.6  ? 
3  O2B ? B DUP . ? A DUP 201 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O1G ? B DUP . ? A DUP 201 ? 1_555 87.7  ? 
4  O2A ? B DUP . ? A DUP 201 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O   ? F HOH . ? A HOH 305 ? 3_455 172.9 ? 
5  O2B ? B DUP . ? A DUP 201 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O   ? F HOH . ? A HOH 305 ? 3_455 89.2  ? 
6  O1G ? B DUP . ? A DUP 201 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O   ? F HOH . ? A HOH 305 ? 3_455 91.5  ? 
7  O2A ? B DUP . ? A DUP 201 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O   ? F HOH . ? A HOH 372 ? 1_555 89.3  ? 
8  O2B ? B DUP . ? A DUP 201 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O   ? F HOH . ? A HOH 372 ? 1_555 93.4  ? 
9  O1G ? B DUP . ? A DUP 201 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O   ? F HOH . ? A HOH 372 ? 1_555 176.0 ? 
10 O   ? F HOH . ? A HOH 305 ? 3_455 MG ? D MG . ? A MG 203 ? 1_555 O   ? F HOH . ? A HOH 372 ? 1_555 84.7  ? 
11 O2A ? B DUP . ? A DUP 201 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O   ? F HOH . ? A HOH 378 ? 1_555 88.5  ? 
12 O2B ? B DUP . ? A DUP 201 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O   ? F HOH . ? A HOH 378 ? 1_555 175.9 ? 
13 O1G ? B DUP . ? A DUP 201 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O   ? F HOH . ? A HOH 378 ? 1_555 93.3  ? 
14 O   ? F HOH . ? A HOH 305 ? 3_455 MG ? D MG . ? A MG 203 ? 1_555 O   ? F HOH . ? A HOH 378 ? 1_555 94.8  ? 
15 O   ? F HOH . ? A HOH 372 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O   ? F HOH . ? A HOH 378 ? 1_555 85.9  ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           98 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            78 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    99 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     79 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -7.23 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 4 ? 
AA3 ? 2 ? 
AA4 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ALA A 26  ? ARG A 29  ? ALA A 6   ARG A 9   
AA1 2 VAL A 69  ? ALA A 72  ? VAL A 49  ALA A 52  
AA2 1 VAL A 47  ? TYR A 50  ? VAL A 27  TYR A 30  
AA2 2 ARG A 130 ? ARG A 138 ? ARG A 110 ARG A 118 
AA2 3 MET A 77  ? HIS A 82  ? MET A 57  HIS A 62  
AA2 4 GLY A 100 ? ILE A 102 ? GLY A 80  ILE A 82  
AA3 1 VAL A 55  ? LEU A 57  ? VAL A 35  LEU A 37  
AA3 2 ILE A 123 ? VAL A 125 ? ILE A 103 VAL A 105 
AA4 1 ARG A 62  ? ARG A 66  ? ARG A 42  ARG A 46  
AA4 2 LYS A 111 ? ASN A 116 ? LYS A 91  ASN A 96  
AA4 3 LEU A 93  ? ILE A 95  ? LEU A 73  ILE A 75  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N VAL A 28  ? N VAL A 8   O ALA A 70  ? O ALA A 50  
AA2 1 2 N VAL A 47  ? N VAL A 27  O LEU A 134 ? O LEU A 114 
AA2 2 3 O GLN A 133 ? O GLN A 113 N HIS A 82  ? N HIS A 62  
AA2 3 4 N GLY A 79  ? N GLY A 59  O ILE A 102 ? O ILE A 82  
AA3 1 2 N VAL A 55  ? N VAL A 35  O VAL A 125 ? O VAL A 105 
AA4 1 2 N VAL A 65  ? N VAL A 45  O VAL A 112 ? O VAL A 92  
AA4 2 3 O ILE A 115 ? O ILE A 95  N SER A 94  ? N SER A 74  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A DUP 201 ? 26 'binding site for residue DUP A 201' 
AC2 Software A TRS 202 ? 7  'binding site for residue TRS A 202' 
AC3 Software A MG  203 ? 4  'binding site for residue MG A 203'  
AC4 Software A GOL 204 ? 5  'binding site for residue GOL A 204' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 26 ARG A 84  ? ARG A 64  . ? 3_455 ? 
2  AC1 26 SER A 85  ? SER A 65  . ? 3_455 ? 
3  AC1 26 GLY A 86  ? GLY A 66  . ? 3_455 ? 
4  AC1 26 ASN A 97  ? ASN A 77  . ? 1_555 ? 
5  AC1 26 GLY A 100 ? GLY A 80  . ? 1_555 ? 
6  AC1 26 THR A 101 ? THR A 81  . ? 1_555 ? 
7  AC1 26 ILE A 102 ? ILE A 82  . ? 1_555 ? 
8  AC1 26 ASP A 103 ? ASP A 83  . ? 1_555 ? 
9  AC1 26 TYR A 106 ? TYR A 86  . ? 1_555 ? 
10 AC1 26 ILE A 110 ? ILE A 90  . ? 1_555 ? 
11 AC1 26 LYS A 111 ? LYS A 91  . ? 1_555 ? 
12 AC1 26 GLN A 133 ? GLN A 113 . ? 3_455 ? 
13 AC1 26 ARG A 160 ? ARG A 140 . ? 2_565 ? 
14 AC1 26 MG  D .   ? MG  A 203 . ? 1_555 ? 
15 AC1 26 HOH F .   ? HOH A 304 . ? 1_555 ? 
16 AC1 26 HOH F .   ? HOH A 305 . ? 3_455 ? 
17 AC1 26 HOH F .   ? HOH A 322 . ? 1_555 ? 
18 AC1 26 HOH F .   ? HOH A 324 . ? 1_555 ? 
19 AC1 26 HOH F .   ? HOH A 329 . ? 1_555 ? 
20 AC1 26 HOH F .   ? HOH A 334 . ? 1_555 ? 
21 AC1 26 HOH F .   ? HOH A 362 . ? 3_455 ? 
22 AC1 26 HOH F .   ? HOH A 364 . ? 3_455 ? 
23 AC1 26 HOH F .   ? HOH A 372 . ? 1_555 ? 
24 AC1 26 HOH F .   ? HOH A 378 . ? 1_555 ? 
25 AC1 26 HOH F .   ? HOH A 381 . ? 1_555 ? 
26 AC1 26 HOH F .   ? HOH A 414 . ? 2_565 ? 
27 AC2 7  SER A 94  ? SER A 74  . ? 3_455 ? 
28 AC2 7  SER A 94  ? SER A 74  . ? 2_565 ? 
29 AC2 7  ILE A 95  ? ILE A 75  . ? 3_455 ? 
30 AC2 7  VAL A 96  ? VAL A 76  . ? 3_455 ? 
31 AC2 7  HOH F .   ? HOH A 344 . ? 2_565 ? 
32 AC2 7  HOH F .   ? HOH A 344 . ? 1_555 ? 
33 AC2 7  HOH F .   ? HOH A 344 . ? 3_455 ? 
34 AC3 4  DUP B .   ? DUP A 201 . ? 1_555 ? 
35 AC3 4  HOH F .   ? HOH A 305 . ? 3_455 ? 
36 AC3 4  HOH F .   ? HOH A 372 . ? 1_555 ? 
37 AC3 4  HOH F .   ? HOH A 378 . ? 1_555 ? 
38 AC4 5  ARG A 84  ? ARG A 64  . ? 2_565 ? 
39 AC4 5  ASP A 129 ? ASP A 109 . ? 2_565 ? 
40 AC4 5  ARG A 130 ? ARG A 110 . ? 2_565 ? 
41 AC4 5  HOH F .   ? HOH A 302 . ? 2_565 ? 
42 AC4 5  HOH F .   ? HOH A 380 . ? 2_565 ? 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    C 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    TRS 
_pdbx_validate_symm_contact.auth_seq_id_1     202 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    C1 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    TRS 
_pdbx_validate_symm_contact.auth_seq_id_2     202 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   2_565 
_pdbx_validate_symm_contact.dist              1.62 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    ALA 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     100 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -141.37 
_pdbx_validate_torsion.psi             -25.86 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A TRS 202 ? C TRS . 
2 1 A TRS 202 ? C TRS . 
3 1 A HOH 311 ? F HOH . 
4 1 A HOH 349 ? F HOH . 
5 1 A HOH 402 ? F HOH . 
6 1 A HOH 408 ? F HOH . 
7 1 A HOH 415 ? F HOH . 
8 1 A HOH 419 ? F HOH . 
9 1 A HOH 425 ? F HOH . 
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 423 ? 5.92 .    
2 1 O ? A HOH 424 ? 6.16 .    
3 1 O ? A HOH 425 ? 6.53 .    
4 1 O ? A HOH 426 ? .    6.99 
5 1 O ? A HOH 427 ? 9.89 .    
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -19 ? A MET 1   
2  1 Y 1 A GLY -18 ? A GLY 2   
3  1 Y 1 A SER -17 ? A SER 3   
4  1 Y 1 A SER -16 ? A SER 4   
5  1 Y 1 A HIS -15 ? A HIS 5   
6  1 Y 1 A HIS -14 ? A HIS 6   
7  1 Y 1 A HIS -13 ? A HIS 7   
8  1 Y 1 A HIS -12 ? A HIS 8   
9  1 Y 1 A HIS -11 ? A HIS 9   
10 1 Y 1 A HIS -10 ? A HIS 10  
11 1 Y 1 A SER -9  ? A SER 11  
12 1 Y 1 A GLY 134 ? A GLY 154 
13 1 Y 1 A LEU 135 ? A LEU 155 
14 1 Y 1 A ALA 136 ? A ALA 156 
15 1 Y 1 A SER 137 ? A SER 157 
16 1 Y 1 A ASP 142 ? A ASP 162 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N      N  N N 1   
ALA CA     C  N S 2   
ALA C      C  N N 3   
ALA O      O  N N 4   
ALA CB     C  N N 5   
ALA OXT    O  N N 6   
ALA H      H  N N 7   
ALA H2     H  N N 8   
ALA HA     H  N N 9   
ALA HB1    H  N N 10  
ALA HB2    H  N N 11  
ALA HB3    H  N N 12  
ALA HXT    H  N N 13  
ARG N      N  N N 14  
ARG CA     C  N S 15  
ARG C      C  N N 16  
ARG O      O  N N 17  
ARG CB     C  N N 18  
ARG CG     C  N N 19  
ARG CD     C  N N 20  
ARG NE     N  N N 21  
ARG CZ     C  N N 22  
ARG NH1    N  N N 23  
ARG NH2    N  N N 24  
ARG OXT    O  N N 25  
ARG H      H  N N 26  
ARG H2     H  N N 27  
ARG HA     H  N N 28  
ARG HB2    H  N N 29  
ARG HB3    H  N N 30  
ARG HG2    H  N N 31  
ARG HG3    H  N N 32  
ARG HD2    H  N N 33  
ARG HD3    H  N N 34  
ARG HE     H  N N 35  
ARG HH11   H  N N 36  
ARG HH12   H  N N 37  
ARG HH21   H  N N 38  
ARG HH22   H  N N 39  
ARG HXT    H  N N 40  
ASN N      N  N N 41  
ASN CA     C  N S 42  
ASN C      C  N N 43  
ASN O      O  N N 44  
ASN CB     C  N N 45  
ASN CG     C  N N 46  
ASN OD1    O  N N 47  
ASN ND2    N  N N 48  
ASN OXT    O  N N 49  
ASN H      H  N N 50  
ASN H2     H  N N 51  
ASN HA     H  N N 52  
ASN HB2    H  N N 53  
ASN HB3    H  N N 54  
ASN HD21   H  N N 55  
ASN HD22   H  N N 56  
ASN HXT    H  N N 57  
ASP N      N  N N 58  
ASP CA     C  N S 59  
ASP C      C  N N 60  
ASP O      O  N N 61  
ASP CB     C  N N 62  
ASP CG     C  N N 63  
ASP OD1    O  N N 64  
ASP OD2    O  N N 65  
ASP OXT    O  N N 66  
ASP H      H  N N 67  
ASP H2     H  N N 68  
ASP HA     H  N N 69  
ASP HB2    H  N N 70  
ASP HB3    H  N N 71  
ASP HD2    H  N N 72  
ASP HXT    H  N N 73  
DUP O4     O  N N 74  
DUP C4     C  Y N 75  
DUP C5     C  Y N 76  
DUP C6     C  Y N 77  
DUP N3     N  Y N 78  
DUP C2     C  Y N 79  
DUP O2     O  N N 80  
DUP N1     N  Y N 81  
DUP "C1'"  C  N R 82  
DUP "C2'"  C  N N 83  
DUP "C3'"  C  N S 84  
DUP "O3'"  O  N N 85  
DUP "O4'"  O  N N 86  
DUP "C4'"  C  N R 87  
DUP "C5'"  C  N N 88  
DUP "O5'"  O  N N 89  
DUP PA     P  N S 90  
DUP O1A    O  N N 91  
DUP O2A    O  N N 92  
DUP N3A    N  N N 93  
DUP PB     P  N R 94  
DUP O1B    O  N N 95  
DUP O2B    O  N N 96  
DUP O3B    O  N N 97  
DUP PG     P  N N 98  
DUP O2G    O  N N 99  
DUP O1G    O  N N 100 
DUP O3G    O  N N 101 
DUP H5     H  N N 102 
DUP H6     H  N N 103 
DUP HN3    H  N N 104 
DUP "H1'"  H  N N 105 
DUP "H2'1" H  N N 106 
DUP "H2'2" H  N N 107 
DUP H1     H  N N 108 
DUP "H3'"  H  N N 109 
DUP "H4'"  H  N N 110 
DUP "H5'1" H  N N 111 
DUP "H5'2" H  N N 112 
DUP H2A    H  N N 113 
DUP H3A    H  N N 114 
DUP H2B    H  N N 115 
DUP H1G    H  N N 116 
DUP H3G    H  N N 117 
GLN N      N  N N 118 
GLN CA     C  N S 119 
GLN C      C  N N 120 
GLN O      O  N N 121 
GLN CB     C  N N 122 
GLN CG     C  N N 123 
GLN CD     C  N N 124 
GLN OE1    O  N N 125 
GLN NE2    N  N N 126 
GLN OXT    O  N N 127 
GLN H      H  N N 128 
GLN H2     H  N N 129 
GLN HA     H  N N 130 
GLN HB2    H  N N 131 
GLN HB3    H  N N 132 
GLN HG2    H  N N 133 
GLN HG3    H  N N 134 
GLN HE21   H  N N 135 
GLN HE22   H  N N 136 
GLN HXT    H  N N 137 
GLU N      N  N N 138 
GLU CA     C  N S 139 
GLU C      C  N N 140 
GLU O      O  N N 141 
GLU CB     C  N N 142 
GLU CG     C  N N 143 
GLU CD     C  N N 144 
GLU OE1    O  N N 145 
GLU OE2    O  N N 146 
GLU OXT    O  N N 147 
GLU H      H  N N 148 
GLU H2     H  N N 149 
GLU HA     H  N N 150 
GLU HB2    H  N N 151 
GLU HB3    H  N N 152 
GLU HG2    H  N N 153 
GLU HG3    H  N N 154 
GLU HE2    H  N N 155 
GLU HXT    H  N N 156 
GLY N      N  N N 157 
GLY CA     C  N N 158 
GLY C      C  N N 159 
GLY O      O  N N 160 
GLY OXT    O  N N 161 
GLY H      H  N N 162 
GLY H2     H  N N 163 
GLY HA2    H  N N 164 
GLY HA3    H  N N 165 
GLY HXT    H  N N 166 
GOL C1     C  N N 167 
GOL O1     O  N N 168 
GOL C2     C  N N 169 
GOL O2     O  N N 170 
GOL C3     C  N N 171 
GOL O3     O  N N 172 
GOL H11    H  N N 173 
GOL H12    H  N N 174 
GOL HO1    H  N N 175 
GOL H2     H  N N 176 
GOL HO2    H  N N 177 
GOL H31    H  N N 178 
GOL H32    H  N N 179 
GOL HO3    H  N N 180 
HIS N      N  N N 181 
HIS CA     C  N S 182 
HIS C      C  N N 183 
HIS O      O  N N 184 
HIS CB     C  N N 185 
HIS CG     C  Y N 186 
HIS ND1    N  Y N 187 
HIS CD2    C  Y N 188 
HIS CE1    C  Y N 189 
HIS NE2    N  Y N 190 
HIS OXT    O  N N 191 
HIS H      H  N N 192 
HIS H2     H  N N 193 
HIS HA     H  N N 194 
HIS HB2    H  N N 195 
HIS HB3    H  N N 196 
HIS HD1    H  N N 197 
HIS HD2    H  N N 198 
HIS HE1    H  N N 199 
HIS HE2    H  N N 200 
HIS HXT    H  N N 201 
HOH O      O  N N 202 
HOH H1     H  N N 203 
HOH H2     H  N N 204 
ILE N      N  N N 205 
ILE CA     C  N S 206 
ILE C      C  N N 207 
ILE O      O  N N 208 
ILE CB     C  N S 209 
ILE CG1    C  N N 210 
ILE CG2    C  N N 211 
ILE CD1    C  N N 212 
ILE OXT    O  N N 213 
ILE H      H  N N 214 
ILE H2     H  N N 215 
ILE HA     H  N N 216 
ILE HB     H  N N 217 
ILE HG12   H  N N 218 
ILE HG13   H  N N 219 
ILE HG21   H  N N 220 
ILE HG22   H  N N 221 
ILE HG23   H  N N 222 
ILE HD11   H  N N 223 
ILE HD12   H  N N 224 
ILE HD13   H  N N 225 
ILE HXT    H  N N 226 
LEU N      N  N N 227 
LEU CA     C  N S 228 
LEU C      C  N N 229 
LEU O      O  N N 230 
LEU CB     C  N N 231 
LEU CG     C  N N 232 
LEU CD1    C  N N 233 
LEU CD2    C  N N 234 
LEU OXT    O  N N 235 
LEU H      H  N N 236 
LEU H2     H  N N 237 
LEU HA     H  N N 238 
LEU HB2    H  N N 239 
LEU HB3    H  N N 240 
LEU HG     H  N N 241 
LEU HD11   H  N N 242 
LEU HD12   H  N N 243 
LEU HD13   H  N N 244 
LEU HD21   H  N N 245 
LEU HD22   H  N N 246 
LEU HD23   H  N N 247 
LEU HXT    H  N N 248 
LYS N      N  N N 249 
LYS CA     C  N S 250 
LYS C      C  N N 251 
LYS O      O  N N 252 
LYS CB     C  N N 253 
LYS CG     C  N N 254 
LYS CD     C  N N 255 
LYS CE     C  N N 256 
LYS NZ     N  N N 257 
LYS OXT    O  N N 258 
LYS H      H  N N 259 
LYS H2     H  N N 260 
LYS HA     H  N N 261 
LYS HB2    H  N N 262 
LYS HB3    H  N N 263 
LYS HG2    H  N N 264 
LYS HG3    H  N N 265 
LYS HD2    H  N N 266 
LYS HD3    H  N N 267 
LYS HE2    H  N N 268 
LYS HE3    H  N N 269 
LYS HZ1    H  N N 270 
LYS HZ2    H  N N 271 
LYS HZ3    H  N N 272 
LYS HXT    H  N N 273 
MET N      N  N N 274 
MET CA     C  N S 275 
MET C      C  N N 276 
MET O      O  N N 277 
MET CB     C  N N 278 
MET CG     C  N N 279 
MET SD     S  N N 280 
MET CE     C  N N 281 
MET OXT    O  N N 282 
MET H      H  N N 283 
MET H2     H  N N 284 
MET HA     H  N N 285 
MET HB2    H  N N 286 
MET HB3    H  N N 287 
MET HG2    H  N N 288 
MET HG3    H  N N 289 
MET HE1    H  N N 290 
MET HE2    H  N N 291 
MET HE3    H  N N 292 
MET HXT    H  N N 293 
MG  MG     MG N N 294 
PHE N      N  N N 295 
PHE CA     C  N S 296 
PHE C      C  N N 297 
PHE O      O  N N 298 
PHE CB     C  N N 299 
PHE CG     C  Y N 300 
PHE CD1    C  Y N 301 
PHE CD2    C  Y N 302 
PHE CE1    C  Y N 303 
PHE CE2    C  Y N 304 
PHE CZ     C  Y N 305 
PHE OXT    O  N N 306 
PHE H      H  N N 307 
PHE H2     H  N N 308 
PHE HA     H  N N 309 
PHE HB2    H  N N 310 
PHE HB3    H  N N 311 
PHE HD1    H  N N 312 
PHE HD2    H  N N 313 
PHE HE1    H  N N 314 
PHE HE2    H  N N 315 
PHE HZ     H  N N 316 
PHE HXT    H  N N 317 
PRO N      N  N N 318 
PRO CA     C  N S 319 
PRO C      C  N N 320 
PRO O      O  N N 321 
PRO CB     C  N N 322 
PRO CG     C  N N 323 
PRO CD     C  N N 324 
PRO OXT    O  N N 325 
PRO H      H  N N 326 
PRO HA     H  N N 327 
PRO HB2    H  N N 328 
PRO HB3    H  N N 329 
PRO HG2    H  N N 330 
PRO HG3    H  N N 331 
PRO HD2    H  N N 332 
PRO HD3    H  N N 333 
PRO HXT    H  N N 334 
SER N      N  N N 335 
SER CA     C  N S 336 
SER C      C  N N 337 
SER O      O  N N 338 
SER CB     C  N N 339 
SER OG     O  N N 340 
SER OXT    O  N N 341 
SER H      H  N N 342 
SER H2     H  N N 343 
SER HA     H  N N 344 
SER HB2    H  N N 345 
SER HB3    H  N N 346 
SER HG     H  N N 347 
SER HXT    H  N N 348 
THR N      N  N N 349 
THR CA     C  N S 350 
THR C      C  N N 351 
THR O      O  N N 352 
THR CB     C  N R 353 
THR OG1    O  N N 354 
THR CG2    C  N N 355 
THR OXT    O  N N 356 
THR H      H  N N 357 
THR H2     H  N N 358 
THR HA     H  N N 359 
THR HB     H  N N 360 
THR HG1    H  N N 361 
THR HG21   H  N N 362 
THR HG22   H  N N 363 
THR HG23   H  N N 364 
THR HXT    H  N N 365 
TRS C      C  N N 366 
TRS C1     C  N N 367 
TRS C2     C  N N 368 
TRS C3     C  N N 369 
TRS N      N  N N 370 
TRS O1     O  N N 371 
TRS O2     O  N N 372 
TRS O3     O  N N 373 
TRS H11    H  N N 374 
TRS H12    H  N N 375 
TRS H21    H  N N 376 
TRS H22    H  N N 377 
TRS H31    H  N N 378 
TRS H32    H  N N 379 
TRS HN1    H  N N 380 
TRS HN2    H  N N 381 
TRS HN3    H  N N 382 
TRS HO1    H  N N 383 
TRS HO2    H  N N 384 
TRS HO3    H  N N 385 
TYR N      N  N N 386 
TYR CA     C  N S 387 
TYR C      C  N N 388 
TYR O      O  N N 389 
TYR CB     C  N N 390 
TYR CG     C  Y N 391 
TYR CD1    C  Y N 392 
TYR CD2    C  Y N 393 
TYR CE1    C  Y N 394 
TYR CE2    C  Y N 395 
TYR CZ     C  Y N 396 
TYR OH     O  N N 397 
TYR OXT    O  N N 398 
TYR H      H  N N 399 
TYR H2     H  N N 400 
TYR HA     H  N N 401 
TYR HB2    H  N N 402 
TYR HB3    H  N N 403 
TYR HD1    H  N N 404 
TYR HD2    H  N N 405 
TYR HE1    H  N N 406 
TYR HE2    H  N N 407 
TYR HH     H  N N 408 
TYR HXT    H  N N 409 
VAL N      N  N N 410 
VAL CA     C  N S 411 
VAL C      C  N N 412 
VAL O      O  N N 413 
VAL CB     C  N N 414 
VAL CG1    C  N N 415 
VAL CG2    C  N N 416 
VAL OXT    O  N N 417 
VAL H      H  N N 418 
VAL H2     H  N N 419 
VAL HA     H  N N 420 
VAL HB     H  N N 421 
VAL HG11   H  N N 422 
VAL HG12   H  N N 423 
VAL HG13   H  N N 424 
VAL HG21   H  N N 425 
VAL HG22   H  N N 426 
VAL HG23   H  N N 427 
VAL HXT    H  N N 428 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N     CA     sing N N 1   
ALA N     H      sing N N 2   
ALA N     H2     sing N N 3   
ALA CA    C      sing N N 4   
ALA CA    CB     sing N N 5   
ALA CA    HA     sing N N 6   
ALA C     O      doub N N 7   
ALA C     OXT    sing N N 8   
ALA CB    HB1    sing N N 9   
ALA CB    HB2    sing N N 10  
ALA CB    HB3    sing N N 11  
ALA OXT   HXT    sing N N 12  
ARG N     CA     sing N N 13  
ARG N     H      sing N N 14  
ARG N     H2     sing N N 15  
ARG CA    C      sing N N 16  
ARG CA    CB     sing N N 17  
ARG CA    HA     sing N N 18  
ARG C     O      doub N N 19  
ARG C     OXT    sing N N 20  
ARG CB    CG     sing N N 21  
ARG CB    HB2    sing N N 22  
ARG CB    HB3    sing N N 23  
ARG CG    CD     sing N N 24  
ARG CG    HG2    sing N N 25  
ARG CG    HG3    sing N N 26  
ARG CD    NE     sing N N 27  
ARG CD    HD2    sing N N 28  
ARG CD    HD3    sing N N 29  
ARG NE    CZ     sing N N 30  
ARG NE    HE     sing N N 31  
ARG CZ    NH1    sing N N 32  
ARG CZ    NH2    doub N N 33  
ARG NH1   HH11   sing N N 34  
ARG NH1   HH12   sing N N 35  
ARG NH2   HH21   sing N N 36  
ARG NH2   HH22   sing N N 37  
ARG OXT   HXT    sing N N 38  
ASN N     CA     sing N N 39  
ASN N     H      sing N N 40  
ASN N     H2     sing N N 41  
ASN CA    C      sing N N 42  
ASN CA    CB     sing N N 43  
ASN CA    HA     sing N N 44  
ASN C     O      doub N N 45  
ASN C     OXT    sing N N 46  
ASN CB    CG     sing N N 47  
ASN CB    HB2    sing N N 48  
ASN CB    HB3    sing N N 49  
ASN CG    OD1    doub N N 50  
ASN CG    ND2    sing N N 51  
ASN ND2   HD21   sing N N 52  
ASN ND2   HD22   sing N N 53  
ASN OXT   HXT    sing N N 54  
ASP N     CA     sing N N 55  
ASP N     H      sing N N 56  
ASP N     H2     sing N N 57  
ASP CA    C      sing N N 58  
ASP CA    CB     sing N N 59  
ASP CA    HA     sing N N 60  
ASP C     O      doub N N 61  
ASP C     OXT    sing N N 62  
ASP CB    CG     sing N N 63  
ASP CB    HB2    sing N N 64  
ASP CB    HB3    sing N N 65  
ASP CG    OD1    doub N N 66  
ASP CG    OD2    sing N N 67  
ASP OD2   HD2    sing N N 68  
ASP OXT   HXT    sing N N 69  
DUP O4    C4     doub N N 70  
DUP C4    C5     sing Y N 71  
DUP C4    N3     sing Y N 72  
DUP C5    C6     doub Y N 73  
DUP C5    H5     sing N N 74  
DUP C6    N1     sing Y N 75  
DUP C6    H6     sing N N 76  
DUP N3    C2     sing Y N 77  
DUP N3    HN3    sing N N 78  
DUP C2    O2     doub N N 79  
DUP C2    N1     sing Y N 80  
DUP N1    "C1'"  sing N N 81  
DUP "C1'" "C2'"  sing N N 82  
DUP "C1'" "O4'"  sing N N 83  
DUP "C1'" "H1'"  sing N N 84  
DUP "C2'" "C3'"  sing N N 85  
DUP "C2'" "H2'1" sing N N 86  
DUP "C2'" "H2'2" sing N N 87  
DUP "C3'" "O3'"  sing N N 88  
DUP "C3'" "C4'"  sing N N 89  
DUP "C3'" H1     sing N N 90  
DUP "O3'" "H3'"  sing N N 91  
DUP "O4'" "C4'"  sing N N 92  
DUP "C4'" "C5'"  sing N N 93  
DUP "C4'" "H4'"  sing N N 94  
DUP "C5'" "O5'"  sing N N 95  
DUP "C5'" "H5'1" sing N N 96  
DUP "C5'" "H5'2" sing N N 97  
DUP "O5'" PA     sing N N 98  
DUP PA    O1A    doub N N 99  
DUP PA    O2A    sing N N 100 
DUP PA    N3A    sing N N 101 
DUP O2A   H2A    sing N N 102 
DUP N3A   PB     sing N N 103 
DUP N3A   H3A    sing N N 104 
DUP PB    O1B    doub N N 105 
DUP PB    O2B    sing N N 106 
DUP PB    O3B    sing N N 107 
DUP O2B   H2B    sing N N 108 
DUP O3B   PG     sing N N 109 
DUP PG    O2G    doub N N 110 
DUP PG    O1G    sing N N 111 
DUP PG    O3G    sing N N 112 
DUP O1G   H1G    sing N N 113 
DUP O3G   H3G    sing N N 114 
GLN N     CA     sing N N 115 
GLN N     H      sing N N 116 
GLN N     H2     sing N N 117 
GLN CA    C      sing N N 118 
GLN CA    CB     sing N N 119 
GLN CA    HA     sing N N 120 
GLN C     O      doub N N 121 
GLN C     OXT    sing N N 122 
GLN CB    CG     sing N N 123 
GLN CB    HB2    sing N N 124 
GLN CB    HB3    sing N N 125 
GLN CG    CD     sing N N 126 
GLN CG    HG2    sing N N 127 
GLN CG    HG3    sing N N 128 
GLN CD    OE1    doub N N 129 
GLN CD    NE2    sing N N 130 
GLN NE2   HE21   sing N N 131 
GLN NE2   HE22   sing N N 132 
GLN OXT   HXT    sing N N 133 
GLU N     CA     sing N N 134 
GLU N     H      sing N N 135 
GLU N     H2     sing N N 136 
GLU CA    C      sing N N 137 
GLU CA    CB     sing N N 138 
GLU CA    HA     sing N N 139 
GLU C     O      doub N N 140 
GLU C     OXT    sing N N 141 
GLU CB    CG     sing N N 142 
GLU CB    HB2    sing N N 143 
GLU CB    HB3    sing N N 144 
GLU CG    CD     sing N N 145 
GLU CG    HG2    sing N N 146 
GLU CG    HG3    sing N N 147 
GLU CD    OE1    doub N N 148 
GLU CD    OE2    sing N N 149 
GLU OE2   HE2    sing N N 150 
GLU OXT   HXT    sing N N 151 
GLY N     CA     sing N N 152 
GLY N     H      sing N N 153 
GLY N     H2     sing N N 154 
GLY CA    C      sing N N 155 
GLY CA    HA2    sing N N 156 
GLY CA    HA3    sing N N 157 
GLY C     O      doub N N 158 
GLY C     OXT    sing N N 159 
GLY OXT   HXT    sing N N 160 
GOL C1    O1     sing N N 161 
GOL C1    C2     sing N N 162 
GOL C1    H11    sing N N 163 
GOL C1    H12    sing N N 164 
GOL O1    HO1    sing N N 165 
GOL C2    O2     sing N N 166 
GOL C2    C3     sing N N 167 
GOL C2    H2     sing N N 168 
GOL O2    HO2    sing N N 169 
GOL C3    O3     sing N N 170 
GOL C3    H31    sing N N 171 
GOL C3    H32    sing N N 172 
GOL O3    HO3    sing N N 173 
HIS N     CA     sing N N 174 
HIS N     H      sing N N 175 
HIS N     H2     sing N N 176 
HIS CA    C      sing N N 177 
HIS CA    CB     sing N N 178 
HIS CA    HA     sing N N 179 
HIS C     O      doub N N 180 
HIS C     OXT    sing N N 181 
HIS CB    CG     sing N N 182 
HIS CB    HB2    sing N N 183 
HIS CB    HB3    sing N N 184 
HIS CG    ND1    sing Y N 185 
HIS CG    CD2    doub Y N 186 
HIS ND1   CE1    doub Y N 187 
HIS ND1   HD1    sing N N 188 
HIS CD2   NE2    sing Y N 189 
HIS CD2   HD2    sing N N 190 
HIS CE1   NE2    sing Y N 191 
HIS CE1   HE1    sing N N 192 
HIS NE2   HE2    sing N N 193 
HIS OXT   HXT    sing N N 194 
HOH O     H1     sing N N 195 
HOH O     H2     sing N N 196 
ILE N     CA     sing N N 197 
ILE N     H      sing N N 198 
ILE N     H2     sing N N 199 
ILE CA    C      sing N N 200 
ILE CA    CB     sing N N 201 
ILE CA    HA     sing N N 202 
ILE C     O      doub N N 203 
ILE C     OXT    sing N N 204 
ILE CB    CG1    sing N N 205 
ILE CB    CG2    sing N N 206 
ILE CB    HB     sing N N 207 
ILE CG1   CD1    sing N N 208 
ILE CG1   HG12   sing N N 209 
ILE CG1   HG13   sing N N 210 
ILE CG2   HG21   sing N N 211 
ILE CG2   HG22   sing N N 212 
ILE CG2   HG23   sing N N 213 
ILE CD1   HD11   sing N N 214 
ILE CD1   HD12   sing N N 215 
ILE CD1   HD13   sing N N 216 
ILE OXT   HXT    sing N N 217 
LEU N     CA     sing N N 218 
LEU N     H      sing N N 219 
LEU N     H2     sing N N 220 
LEU CA    C      sing N N 221 
LEU CA    CB     sing N N 222 
LEU CA    HA     sing N N 223 
LEU C     O      doub N N 224 
LEU C     OXT    sing N N 225 
LEU CB    CG     sing N N 226 
LEU CB    HB2    sing N N 227 
LEU CB    HB3    sing N N 228 
LEU CG    CD1    sing N N 229 
LEU CG    CD2    sing N N 230 
LEU CG    HG     sing N N 231 
LEU CD1   HD11   sing N N 232 
LEU CD1   HD12   sing N N 233 
LEU CD1   HD13   sing N N 234 
LEU CD2   HD21   sing N N 235 
LEU CD2   HD22   sing N N 236 
LEU CD2   HD23   sing N N 237 
LEU OXT   HXT    sing N N 238 
LYS N     CA     sing N N 239 
LYS N     H      sing N N 240 
LYS N     H2     sing N N 241 
LYS CA    C      sing N N 242 
LYS CA    CB     sing N N 243 
LYS CA    HA     sing N N 244 
LYS C     O      doub N N 245 
LYS C     OXT    sing N N 246 
LYS CB    CG     sing N N 247 
LYS CB    HB2    sing N N 248 
LYS CB    HB3    sing N N 249 
LYS CG    CD     sing N N 250 
LYS CG    HG2    sing N N 251 
LYS CG    HG3    sing N N 252 
LYS CD    CE     sing N N 253 
LYS CD    HD2    sing N N 254 
LYS CD    HD3    sing N N 255 
LYS CE    NZ     sing N N 256 
LYS CE    HE2    sing N N 257 
LYS CE    HE3    sing N N 258 
LYS NZ    HZ1    sing N N 259 
LYS NZ    HZ2    sing N N 260 
LYS NZ    HZ3    sing N N 261 
LYS OXT   HXT    sing N N 262 
MET N     CA     sing N N 263 
MET N     H      sing N N 264 
MET N     H2     sing N N 265 
MET CA    C      sing N N 266 
MET CA    CB     sing N N 267 
MET CA    HA     sing N N 268 
MET C     O      doub N N 269 
MET C     OXT    sing N N 270 
MET CB    CG     sing N N 271 
MET CB    HB2    sing N N 272 
MET CB    HB3    sing N N 273 
MET CG    SD     sing N N 274 
MET CG    HG2    sing N N 275 
MET CG    HG3    sing N N 276 
MET SD    CE     sing N N 277 
MET CE    HE1    sing N N 278 
MET CE    HE2    sing N N 279 
MET CE    HE3    sing N N 280 
MET OXT   HXT    sing N N 281 
PHE N     CA     sing N N 282 
PHE N     H      sing N N 283 
PHE N     H2     sing N N 284 
PHE CA    C      sing N N 285 
PHE CA    CB     sing N N 286 
PHE CA    HA     sing N N 287 
PHE C     O      doub N N 288 
PHE C     OXT    sing N N 289 
PHE CB    CG     sing N N 290 
PHE CB    HB2    sing N N 291 
PHE CB    HB3    sing N N 292 
PHE CG    CD1    doub Y N 293 
PHE CG    CD2    sing Y N 294 
PHE CD1   CE1    sing Y N 295 
PHE CD1   HD1    sing N N 296 
PHE CD2   CE2    doub Y N 297 
PHE CD2   HD2    sing N N 298 
PHE CE1   CZ     doub Y N 299 
PHE CE1   HE1    sing N N 300 
PHE CE2   CZ     sing Y N 301 
PHE CE2   HE2    sing N N 302 
PHE CZ    HZ     sing N N 303 
PHE OXT   HXT    sing N N 304 
PRO N     CA     sing N N 305 
PRO N     CD     sing N N 306 
PRO N     H      sing N N 307 
PRO CA    C      sing N N 308 
PRO CA    CB     sing N N 309 
PRO CA    HA     sing N N 310 
PRO C     O      doub N N 311 
PRO C     OXT    sing N N 312 
PRO CB    CG     sing N N 313 
PRO CB    HB2    sing N N 314 
PRO CB    HB3    sing N N 315 
PRO CG    CD     sing N N 316 
PRO CG    HG2    sing N N 317 
PRO CG    HG3    sing N N 318 
PRO CD    HD2    sing N N 319 
PRO CD    HD3    sing N N 320 
PRO OXT   HXT    sing N N 321 
SER N     CA     sing N N 322 
SER N     H      sing N N 323 
SER N     H2     sing N N 324 
SER CA    C      sing N N 325 
SER CA    CB     sing N N 326 
SER CA    HA     sing N N 327 
SER C     O      doub N N 328 
SER C     OXT    sing N N 329 
SER CB    OG     sing N N 330 
SER CB    HB2    sing N N 331 
SER CB    HB3    sing N N 332 
SER OG    HG     sing N N 333 
SER OXT   HXT    sing N N 334 
THR N     CA     sing N N 335 
THR N     H      sing N N 336 
THR N     H2     sing N N 337 
THR CA    C      sing N N 338 
THR CA    CB     sing N N 339 
THR CA    HA     sing N N 340 
THR C     O      doub N N 341 
THR C     OXT    sing N N 342 
THR CB    OG1    sing N N 343 
THR CB    CG2    sing N N 344 
THR CB    HB     sing N N 345 
THR OG1   HG1    sing N N 346 
THR CG2   HG21   sing N N 347 
THR CG2   HG22   sing N N 348 
THR CG2   HG23   sing N N 349 
THR OXT   HXT    sing N N 350 
TRS C     C1     sing N N 351 
TRS C     C2     sing N N 352 
TRS C     C3     sing N N 353 
TRS C     N      sing N N 354 
TRS C1    O1     sing N N 355 
TRS C1    H11    sing N N 356 
TRS C1    H12    sing N N 357 
TRS C2    O2     sing N N 358 
TRS C2    H21    sing N N 359 
TRS C2    H22    sing N N 360 
TRS C3    O3     sing N N 361 
TRS C3    H31    sing N N 362 
TRS C3    H32    sing N N 363 
TRS N     HN1    sing N N 364 
TRS N     HN2    sing N N 365 
TRS N     HN3    sing N N 366 
TRS O1    HO1    sing N N 367 
TRS O2    HO2    sing N N 368 
TRS O3    HO3    sing N N 369 
TYR N     CA     sing N N 370 
TYR N     H      sing N N 371 
TYR N     H2     sing N N 372 
TYR CA    C      sing N N 373 
TYR CA    CB     sing N N 374 
TYR CA    HA     sing N N 375 
TYR C     O      doub N N 376 
TYR C     OXT    sing N N 377 
TYR CB    CG     sing N N 378 
TYR CB    HB2    sing N N 379 
TYR CB    HB3    sing N N 380 
TYR CG    CD1    doub Y N 381 
TYR CG    CD2    sing Y N 382 
TYR CD1   CE1    sing Y N 383 
TYR CD1   HD1    sing N N 384 
TYR CD2   CE2    doub Y N 385 
TYR CD2   HD2    sing N N 386 
TYR CE1   CZ     doub Y N 387 
TYR CE1   HE1    sing N N 388 
TYR CE2   CZ     sing Y N 389 
TYR CE2   HE2    sing N N 390 
TYR CZ    OH     sing N N 391 
TYR OH    HH     sing N N 392 
TYR OXT   HXT    sing N N 393 
VAL N     CA     sing N N 394 
VAL N     H      sing N N 395 
VAL N     H2     sing N N 396 
VAL CA    C      sing N N 397 
VAL CA    CB     sing N N 398 
VAL CA    HA     sing N N 399 
VAL C     O      doub N N 400 
VAL C     OXT    sing N N 401 
VAL CB    CG1    sing N N 402 
VAL CB    CG2    sing N N 403 
VAL CB    HB     sing N N 404 
VAL CG1   HG11   sing N N 405 
VAL CG1   HG12   sing N N 406 
VAL CG1   HG13   sing N N 407 
VAL CG2   HG21   sing N N 408 
VAL CG2   HG22   sing N N 409 
VAL CG2   HG23   sing N N 410 
VAL OXT   HXT    sing N N 411 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'Hungarian Scientific Research Fund' Hungary 'NK 84008' 1 
'Hungarian Scientific Research Fund' Hungary K109486    2 
Biostruct-X                          Hungary 283570     3 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   3HZA 
_pdbx_initial_refinement_model.details          ? 
# 
_atom_sites.entry_id                    5ECT 
_atom_sites.fract_transf_matrix[1][1]   0.018255 
_atom_sites.fract_transf_matrix[1][2]   0.010539 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.021079 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011894 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_