data_5ECT # _entry.id 5ECT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5ECT pdb_00005ect 10.2210/pdb5ect/pdb WWPDB D_1000206672 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-11-02 2 'Structure model' 1 1 2016-12-21 3 'Structure model' 1 2 2024-01-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' chem_comp_atom 2 3 'Structure model' chem_comp_bond 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_initial_refinement_model 5 3 'Structure model' pdbx_struct_conn_angle 6 3 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 4 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_symmetry' 5 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 6 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry' 7 3 'Structure model' '_pdbx_struct_conn_angle.value' 8 3 'Structure model' '_struct_conn.pdbx_dist_value' 9 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 10 3 'Structure model' '_struct_conn.ptnr2_symmetry' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5ECT _pdbx_database_status.recvd_initial_deposition_date 2015-10-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB '4GCY contains the H21W variant of the same protein.' 4GCY unspecified PDB '3LOJ contains the H145A variant of the same protein.' 3LOJ unspecified PDB '3I93 contains the T138STOP variant of the same protein.' 3I93 unspecified PDB '3HZA contains the H145W variant of the same protein.' 3HZA unspecified PDB '3H6D contains the D28N variant of the same protein.' 3H6D unspecified PDB '2PY4 contains the wild type form of the same protein complexed with Mg2+ and dUPnPP' 2PY4 unspecified PDB '1SJN contains the wild type form of the same protein complexed with Mg2+ and dUPnPP' 1SJN unspecified PDB '1SIX contains the wild type form of the same protein complexed with Mg2+ and dUPnPP' 1SIX unspecified PDB '1MQ7 contains the wild type form of the same protein' 1MQ7 unspecified PDB '1SNF contains the wild type form of the same protein complexed with Mg2+ and dUPMP' 1SNF unspecified PDB '1SLH contains the wild type form of the same protein complexed with Mg2+ and dUPDP' 1SLH unspecified PDB '1SMC contains the wild type form of the same protein complexed with dUPnPP in absence of Mg2+' 1SMC unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Nagy, G.N.' 1 'Leveles, I.' 2 'Harmat, V.' 3 'Vertessy, G.B.' 4 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Am. Chem. Soc.' _citation.journal_id_ASTM JACSAT _citation.journal_id_CSD ? _citation.journal_id_ISSN 1520-5126 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 138 _citation.language ? _citation.page_first 15035 _citation.page_last 15045 _citation.title 'Structural Characterization of Arginine Fingers: Identification of an Arginine Finger for the Pyrophosphatase dUTPases.' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/jacs.6b09012 _citation.pdbx_database_id_PubMed 27740761 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Nagy, G.N.' 1 ? primary 'Suardiaz, R.' 2 ? primary 'Lopata, A.' 3 ? primary 'Ozohanics, O.' 4 ? primary 'Vekey, K.' 5 ? primary 'Brooks, B.R.' 6 ? primary 'Leveles, I.' 7 ? primary 'Toth, J.' 8 ? primary 'Vertessy, B.G.' 9 ? primary 'Rosta, E.' 10 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man ;Deoxyuridine 5'-triphosphate nucleotidohydrolase ; 16985.291 1 3.6.1.23 G143STOP ? ? 2 non-polymer syn ;2'-DEOXYURIDINE 5'-ALPHA,BETA-IMIDO-TRIPHOSPHATE ; 467.157 1 ? ? ? ? 3 non-polymer syn 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL 122.143 1 ? ? ? ? 4 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 5 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 6 water nat water 18.015 127 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'dUTPase,dUTP pyrophosphatase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMSTTLAIVRLDPGLPLPSRAHDGDAGVDLYSAEDVELAPGRRALVRTGVAVAVPFGMVGL VHPRSGLATRVGLSIVNSPGTIDAGYRGEIKVALINLDPAAPIVVHRGDRIAQLLVQRVELVELVEVSSFDEAGLASTSR GD ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMSTTLAIVRLDPGLPLPSRAHDGDAGVDLYSAEDVELAPGRRALVRTGVAVAVPFGMVGL VHPRSGLATRVGLSIVNSPGTIDAGYRGEIKVALINLDPAAPIVVHRGDRIAQLLVQRVELVELVEVSSFDEAGLASTSR GD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;2'-DEOXYURIDINE 5'-ALPHA,BETA-IMIDO-TRIPHOSPHATE ; DUP 3 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL TRS 4 'MAGNESIUM ION' MG 5 GLYCEROL GOL 6 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 SER n 1 23 THR n 1 24 THR n 1 25 LEU n 1 26 ALA n 1 27 ILE n 1 28 VAL n 1 29 ARG n 1 30 LEU n 1 31 ASP n 1 32 PRO n 1 33 GLY n 1 34 LEU n 1 35 PRO n 1 36 LEU n 1 37 PRO n 1 38 SER n 1 39 ARG n 1 40 ALA n 1 41 HIS n 1 42 ASP n 1 43 GLY n 1 44 ASP n 1 45 ALA n 1 46 GLY n 1 47 VAL n 1 48 ASP n 1 49 LEU n 1 50 TYR n 1 51 SER n 1 52 ALA n 1 53 GLU n 1 54 ASP n 1 55 VAL n 1 56 GLU n 1 57 LEU n 1 58 ALA n 1 59 PRO n 1 60 GLY n 1 61 ARG n 1 62 ARG n 1 63 ALA n 1 64 LEU n 1 65 VAL n 1 66 ARG n 1 67 THR n 1 68 GLY n 1 69 VAL n 1 70 ALA n 1 71 VAL n 1 72 ALA n 1 73 VAL n 1 74 PRO n 1 75 PHE n 1 76 GLY n 1 77 MET n 1 78 VAL n 1 79 GLY n 1 80 LEU n 1 81 VAL n 1 82 HIS n 1 83 PRO n 1 84 ARG n 1 85 SER n 1 86 GLY n 1 87 LEU n 1 88 ALA n 1 89 THR n 1 90 ARG n 1 91 VAL n 1 92 GLY n 1 93 LEU n 1 94 SER n 1 95 ILE n 1 96 VAL n 1 97 ASN n 1 98 SER n 1 99 PRO n 1 100 GLY n 1 101 THR n 1 102 ILE n 1 103 ASP n 1 104 ALA n 1 105 GLY n 1 106 TYR n 1 107 ARG n 1 108 GLY n 1 109 GLU n 1 110 ILE n 1 111 LYS n 1 112 VAL n 1 113 ALA n 1 114 LEU n 1 115 ILE n 1 116 ASN n 1 117 LEU n 1 118 ASP n 1 119 PRO n 1 120 ALA n 1 121 ALA n 1 122 PRO n 1 123 ILE n 1 124 VAL n 1 125 VAL n 1 126 HIS n 1 127 ARG n 1 128 GLY n 1 129 ASP n 1 130 ARG n 1 131 ILE n 1 132 ALA n 1 133 GLN n 1 134 LEU n 1 135 LEU n 1 136 VAL n 1 137 GLN n 1 138 ARG n 1 139 VAL n 1 140 GLU n 1 141 LEU n 1 142 VAL n 1 143 GLU n 1 144 LEU n 1 145 VAL n 1 146 GLU n 1 147 VAL n 1 148 SER n 1 149 SER n 1 150 PHE n 1 151 ASP n 1 152 GLU n 1 153 ALA n 1 154 GLY n 1 155 LEU n 1 156 ALA n 1 157 SER n 1 158 THR n 1 159 SER n 1 160 ARG n 1 161 GLY n 1 162 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 162 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'dut, Rv2697c, MTCY05A6.18c' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycobacterium tuberculosis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1773 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET15b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 DUP non-polymer . ;2'-DEOXYURIDINE 5'-ALPHA,BETA-IMIDO-TRIPHOSPHATE ; ? 'C9 H16 N3 O13 P3' 467.157 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRS non-polymer . 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL 'TRIS BUFFER' 'C4 H12 N O3 1' 122.143 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -19 ? ? ? A . n A 1 2 GLY 2 -18 ? ? ? A . n A 1 3 SER 3 -17 ? ? ? A . n A 1 4 SER 4 -16 ? ? ? A . n A 1 5 HIS 5 -15 ? ? ? A . n A 1 6 HIS 6 -14 ? ? ? A . n A 1 7 HIS 7 -13 ? ? ? A . n A 1 8 HIS 8 -12 ? ? ? A . n A 1 9 HIS 9 -11 ? ? ? A . n A 1 10 HIS 10 -10 ? ? ? A . n A 1 11 SER 11 -9 ? ? ? A . n A 1 12 SER 12 -8 -8 SER SER A . n A 1 13 GLY 13 -7 -7 GLY GLY A . n A 1 14 LEU 14 -6 -6 LEU LEU A . n A 1 15 VAL 15 -5 -5 VAL VAL A . n A 1 16 PRO 16 -4 -4 PRO PRO A . n A 1 17 ARG 17 -3 -3 ARG ARG A . n A 1 18 GLY 18 -2 -2 GLY GLY A . n A 1 19 SER 19 -1 -1 SER SER A . n A 1 20 HIS 20 0 0 HIS HIS A . n A 1 21 MET 21 1 1 MET MET A . n A 1 22 SER 22 2 2 SER SER A . n A 1 23 THR 23 3 3 THR THR A . n A 1 24 THR 24 4 4 THR THR A . n A 1 25 LEU 25 5 5 LEU LEU A . n A 1 26 ALA 26 6 6 ALA ALA A . n A 1 27 ILE 27 7 7 ILE ILE A . n A 1 28 VAL 28 8 8 VAL VAL A . n A 1 29 ARG 29 9 9 ARG ARG A . n A 1 30 LEU 30 10 10 LEU LEU A . n A 1 31 ASP 31 11 11 ASP ASP A . n A 1 32 PRO 32 12 12 PRO PRO A . n A 1 33 GLY 33 13 13 GLY GLY A . n A 1 34 LEU 34 14 14 LEU LEU A . n A 1 35 PRO 35 15 15 PRO PRO A . n A 1 36 LEU 36 16 16 LEU LEU A . n A 1 37 PRO 37 17 17 PRO PRO A . n A 1 38 SER 38 18 18 SER SER A . n A 1 39 ARG 39 19 19 ARG ARG A . n A 1 40 ALA 40 20 20 ALA ALA A . n A 1 41 HIS 41 21 21 HIS HIS A . n A 1 42 ASP 42 22 22 ASP ASP A . n A 1 43 GLY 43 23 23 GLY GLY A . n A 1 44 ASP 44 24 24 ASP ASP A . n A 1 45 ALA 45 25 25 ALA ALA A . n A 1 46 GLY 46 26 26 GLY GLY A . n A 1 47 VAL 47 27 27 VAL VAL A . n A 1 48 ASP 48 28 28 ASP ASP A . n A 1 49 LEU 49 29 29 LEU LEU A . n A 1 50 TYR 50 30 30 TYR TYR A . n A 1 51 SER 51 31 31 SER SER A . n A 1 52 ALA 52 32 32 ALA ALA A . n A 1 53 GLU 53 33 33 GLU GLU A . n A 1 54 ASP 54 34 34 ASP ASP A . n A 1 55 VAL 55 35 35 VAL VAL A . n A 1 56 GLU 56 36 36 GLU GLU A . n A 1 57 LEU 57 37 37 LEU LEU A . n A 1 58 ALA 58 38 38 ALA ALA A . n A 1 59 PRO 59 39 39 PRO PRO A . n A 1 60 GLY 60 40 40 GLY GLY A . n A 1 61 ARG 61 41 41 ARG ARG A . n A 1 62 ARG 62 42 42 ARG ARG A . n A 1 63 ALA 63 43 43 ALA ALA A . n A 1 64 LEU 64 44 44 LEU LEU A . n A 1 65 VAL 65 45 45 VAL VAL A . n A 1 66 ARG 66 46 46 ARG ARG A . n A 1 67 THR 67 47 47 THR THR A . n A 1 68 GLY 68 48 48 GLY GLY A . n A 1 69 VAL 69 49 49 VAL VAL A . n A 1 70 ALA 70 50 50 ALA ALA A . n A 1 71 VAL 71 51 51 VAL VAL A . n A 1 72 ALA 72 52 52 ALA ALA A . n A 1 73 VAL 73 53 53 VAL VAL A . n A 1 74 PRO 74 54 54 PRO PRO A . n A 1 75 PHE 75 55 55 PHE PHE A . n A 1 76 GLY 76 56 56 GLY GLY A . n A 1 77 MET 77 57 57 MET MET A . n A 1 78 VAL 78 58 58 VAL VAL A . n A 1 79 GLY 79 59 59 GLY GLY A . n A 1 80 LEU 80 60 60 LEU LEU A . n A 1 81 VAL 81 61 61 VAL VAL A . n A 1 82 HIS 82 62 62 HIS HIS A . n A 1 83 PRO 83 63 63 PRO PRO A . n A 1 84 ARG 84 64 64 ARG ARG A . n A 1 85 SER 85 65 65 SER SER A . n A 1 86 GLY 86 66 66 GLY GLY A . n A 1 87 LEU 87 67 67 LEU LEU A . n A 1 88 ALA 88 68 68 ALA ALA A . n A 1 89 THR 89 69 69 THR THR A . n A 1 90 ARG 90 70 70 ARG ARG A . n A 1 91 VAL 91 71 71 VAL VAL A . n A 1 92 GLY 92 72 72 GLY GLY A . n A 1 93 LEU 93 73 73 LEU LEU A . n A 1 94 SER 94 74 74 SER SER A . n A 1 95 ILE 95 75 75 ILE ILE A . n A 1 96 VAL 96 76 76 VAL VAL A . n A 1 97 ASN 97 77 77 ASN ASN A . n A 1 98 SER 98 78 78 SER SER A . n A 1 99 PRO 99 79 79 PRO PRO A . n A 1 100 GLY 100 80 80 GLY GLY A . n A 1 101 THR 101 81 81 THR THR A . n A 1 102 ILE 102 82 82 ILE ILE A . n A 1 103 ASP 103 83 83 ASP ASP A . n A 1 104 ALA 104 84 84 ALA ALA A . n A 1 105 GLY 105 85 85 GLY GLY A . n A 1 106 TYR 106 86 86 TYR TYR A . n A 1 107 ARG 107 87 87 ARG ARG A . n A 1 108 GLY 108 88 88 GLY GLY A . n A 1 109 GLU 109 89 89 GLU GLU A . n A 1 110 ILE 110 90 90 ILE ILE A . n A 1 111 LYS 111 91 91 LYS LYS A . n A 1 112 VAL 112 92 92 VAL VAL A . n A 1 113 ALA 113 93 93 ALA ALA A . n A 1 114 LEU 114 94 94 LEU LEU A . n A 1 115 ILE 115 95 95 ILE ILE A . n A 1 116 ASN 116 96 96 ASN ASN A . n A 1 117 LEU 117 97 97 LEU LEU A . n A 1 118 ASP 118 98 98 ASP ASP A . n A 1 119 PRO 119 99 99 PRO PRO A . n A 1 120 ALA 120 100 100 ALA ALA A . n A 1 121 ALA 121 101 101 ALA ALA A . n A 1 122 PRO 122 102 102 PRO PRO A . n A 1 123 ILE 123 103 103 ILE ILE A . n A 1 124 VAL 124 104 104 VAL VAL A . n A 1 125 VAL 125 105 105 VAL VAL A . n A 1 126 HIS 126 106 106 HIS HIS A . n A 1 127 ARG 127 107 107 ARG ARG A . n A 1 128 GLY 128 108 108 GLY GLY A . n A 1 129 ASP 129 109 109 ASP ASP A . n A 1 130 ARG 130 110 110 ARG ARG A . n A 1 131 ILE 131 111 111 ILE ILE A . n A 1 132 ALA 132 112 112 ALA ALA A . n A 1 133 GLN 133 113 113 GLN GLN A . n A 1 134 LEU 134 114 114 LEU LEU A . n A 1 135 LEU 135 115 115 LEU LEU A . n A 1 136 VAL 136 116 116 VAL VAL A . n A 1 137 GLN 137 117 117 GLN GLN A . n A 1 138 ARG 138 118 118 ARG ARG A . n A 1 139 VAL 139 119 119 VAL VAL A . n A 1 140 GLU 140 120 120 GLU GLU A . n A 1 141 LEU 141 121 121 LEU LEU A . n A 1 142 VAL 142 122 122 VAL VAL A . n A 1 143 GLU 143 123 123 GLU GLU A . n A 1 144 LEU 144 124 124 LEU LEU A . n A 1 145 VAL 145 125 125 VAL VAL A . n A 1 146 GLU 146 126 126 GLU GLU A . n A 1 147 VAL 147 127 127 VAL VAL A . n A 1 148 SER 148 128 128 SER SER A . n A 1 149 SER 149 129 129 SER SER A . n A 1 150 PHE 150 130 130 PHE PHE A . n A 1 151 ASP 151 131 131 ASP ASP A . n A 1 152 GLU 152 132 132 GLU GLU A . n A 1 153 ALA 153 133 133 ALA ALA A . n A 1 154 GLY 154 134 ? ? ? A . n A 1 155 LEU 155 135 ? ? ? A . n A 1 156 ALA 156 136 ? ? ? A . n A 1 157 SER 157 137 ? ? ? A . n A 1 158 THR 158 138 138 THR THR A . n A 1 159 SER 159 139 139 SER SER A . n A 1 160 ARG 160 140 140 ARG ARG A . n A 1 161 GLY 161 141 141 GLY GLY A . n A 1 162 ASP 162 142 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 DUP 1 201 777 DUP DUP A . C 3 TRS 1 202 201 TRS TRS A . D 4 MG 1 203 1 MG MG A . E 5 GOL 1 204 202 GOL GOL A . F 6 HOH 1 301 142 HOH HOH A . F 6 HOH 2 302 47 HOH HOH A . F 6 HOH 3 303 129 HOH HOH A . F 6 HOH 4 304 77 HOH HOH A . F 6 HOH 5 305 16 HOH HOH A . F 6 HOH 6 306 113 HOH HOH A . F 6 HOH 7 307 115 HOH HOH A . F 6 HOH 8 308 5 HOH HOH A . F 6 HOH 9 309 70 HOH HOH A . F 6 HOH 10 310 135 HOH HOH A . F 6 HOH 11 311 103 HOH HOH A . F 6 HOH 12 312 29 HOH HOH A . F 6 HOH 13 313 73 HOH HOH A . F 6 HOH 14 314 78 HOH HOH A . F 6 HOH 15 315 106 HOH HOH A . F 6 HOH 16 316 110 HOH HOH A . F 6 HOH 17 317 159 HOH HOH A . F 6 HOH 18 318 38 HOH HOH A . F 6 HOH 19 319 25 HOH HOH A . F 6 HOH 20 320 102 HOH HOH A . F 6 HOH 21 321 83 HOH HOH A . F 6 HOH 22 322 105 HOH HOH A . F 6 HOH 23 323 76 HOH HOH A . F 6 HOH 24 324 48 HOH HOH A . F 6 HOH 25 325 100 HOH HOH A . F 6 HOH 26 326 15 HOH HOH A . F 6 HOH 27 327 155 HOH HOH A . F 6 HOH 28 328 35 HOH HOH A . F 6 HOH 29 329 36 HOH HOH A . F 6 HOH 30 330 166 HOH HOH A . F 6 HOH 31 331 1 HOH HOH A . F 6 HOH 32 332 98 HOH HOH A . F 6 HOH 33 333 92 HOH HOH A . F 6 HOH 34 334 11 HOH HOH A . F 6 HOH 35 335 34 HOH HOH A . F 6 HOH 36 336 116 HOH HOH A . F 6 HOH 37 337 18 HOH HOH A . F 6 HOH 38 338 23 HOH HOH A . F 6 HOH 39 339 128 HOH HOH A . F 6 HOH 40 340 31 HOH HOH A . F 6 HOH 41 341 39 HOH HOH A . F 6 HOH 42 342 19 HOH HOH A . F 6 HOH 43 343 95 HOH HOH A . F 6 HOH 44 344 107 HOH HOH A . F 6 HOH 45 345 13 HOH HOH A . F 6 HOH 46 346 12 HOH HOH A . F 6 HOH 47 347 46 HOH HOH A . F 6 HOH 48 348 17 HOH HOH A . F 6 HOH 49 349 72 HOH HOH A . F 6 HOH 50 350 26 HOH HOH A . F 6 HOH 51 351 117 HOH HOH A . F 6 HOH 52 352 108 HOH HOH A . F 6 HOH 53 353 109 HOH HOH A . F 6 HOH 54 354 141 HOH HOH A . F 6 HOH 55 355 30 HOH HOH A . F 6 HOH 56 356 27 HOH HOH A . F 6 HOH 57 357 144 HOH HOH A . F 6 HOH 58 358 71 HOH HOH A . F 6 HOH 59 359 94 HOH HOH A . F 6 HOH 60 360 130 HOH HOH A . F 6 HOH 61 361 133 HOH HOH A . F 6 HOH 62 362 32 HOH HOH A . F 6 HOH 63 363 160 HOH HOH A . F 6 HOH 64 364 14 HOH HOH A . F 6 HOH 65 365 122 HOH HOH A . F 6 HOH 66 366 3 HOH HOH A . F 6 HOH 67 367 28 HOH HOH A . F 6 HOH 68 368 134 HOH HOH A . F 6 HOH 69 369 131 HOH HOH A . F 6 HOH 70 370 81 HOH HOH A . F 6 HOH 71 371 33 HOH HOH A . F 6 HOH 72 372 10 HOH HOH A . F 6 HOH 73 373 85 HOH HOH A . F 6 HOH 74 374 74 HOH HOH A . F 6 HOH 75 375 97 HOH HOH A . F 6 HOH 76 376 154 HOH HOH A . F 6 HOH 77 377 164 HOH HOH A . F 6 HOH 78 378 9 HOH HOH A . F 6 HOH 79 379 88 HOH HOH A . F 6 HOH 80 380 43 HOH HOH A . F 6 HOH 81 381 138 HOH HOH A . F 6 HOH 82 382 101 HOH HOH A . F 6 HOH 83 383 89 HOH HOH A . F 6 HOH 84 384 163 HOH HOH A . F 6 HOH 85 385 50 HOH HOH A . F 6 HOH 86 386 149 HOH HOH A . F 6 HOH 87 387 96 HOH HOH A . F 6 HOH 88 388 6 HOH HOH A . F 6 HOH 89 389 104 HOH HOH A . F 6 HOH 90 390 170 HOH HOH A . F 6 HOH 91 391 143 HOH HOH A . F 6 HOH 92 392 145 HOH HOH A . F 6 HOH 93 393 79 HOH HOH A . F 6 HOH 94 394 22 HOH HOH A . F 6 HOH 95 395 24 HOH HOH A . F 6 HOH 96 396 91 HOH HOH A . F 6 HOH 97 397 151 HOH HOH A . F 6 HOH 98 398 161 HOH HOH A . F 6 HOH 99 399 139 HOH HOH A . F 6 HOH 100 400 21 HOH HOH A . F 6 HOH 101 401 137 HOH HOH A . F 6 HOH 102 402 82 HOH HOH A . F 6 HOH 103 403 4 HOH HOH A . F 6 HOH 104 404 132 HOH HOH A . F 6 HOH 105 405 87 HOH HOH A . F 6 HOH 106 406 150 HOH HOH A . F 6 HOH 107 407 42 HOH HOH A . F 6 HOH 108 408 157 HOH HOH A . F 6 HOH 109 409 93 HOH HOH A . F 6 HOH 110 410 20 HOH HOH A . F 6 HOH 111 411 146 HOH HOH A . F 6 HOH 112 412 99 HOH HOH A . F 6 HOH 113 413 80 HOH HOH A . F 6 HOH 114 414 118 HOH HOH A . F 6 HOH 115 415 156 HOH HOH A . F 6 HOH 116 416 136 HOH HOH A . F 6 HOH 117 417 114 HOH HOH A . F 6 HOH 118 418 165 HOH HOH A . F 6 HOH 119 419 169 HOH HOH A . F 6 HOH 120 420 75 HOH HOH A . F 6 HOH 121 421 152 HOH HOH A . F 6 HOH 122 422 168 HOH HOH A . F 6 HOH 123 423 167 HOH HOH A . F 6 HOH 124 424 158 HOH HOH A . F 6 HOH 125 425 84 HOH HOH A . F 6 HOH 126 426 153 HOH HOH A . F 6 HOH 127 427 119 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A SER -8 ? OG ? A SER 12 OG 2 1 Y 1 A ARG -3 ? CB ? A ARG 17 CB 3 1 Y 1 A ARG -3 ? CG ? A ARG 17 CG 4 1 Y 1 A ARG -3 ? CD ? A ARG 17 CD 5 1 Y 1 A ARG -3 ? NE ? A ARG 17 NE 6 1 Y 1 A ARG -3 ? CZ ? A ARG 17 CZ 7 1 Y 1 A ARG -3 ? NH1 ? A ARG 17 NH1 8 1 Y 1 A ARG -3 ? NH2 ? A ARG 17 NH2 9 1 Y 1 A SER -1 ? OG ? A SER 19 OG 10 1 Y 1 A MET 1 ? CG ? A MET 21 CG 11 1 Y 1 A MET 1 ? SD ? A MET 21 SD 12 1 Y 1 A MET 1 ? CE ? A MET 21 CE 13 1 Y 1 A ARG 46 ? CZ ? A ARG 66 CZ 14 1 Y 1 A ARG 46 ? NH1 ? A ARG 66 NH1 15 1 Y 1 A ARG 46 ? NH2 ? A ARG 66 NH2 16 1 Y 1 A ASP 131 ? CG ? A ASP 151 CG 17 1 Y 1 A ASP 131 ? OD1 ? A ASP 151 OD1 18 1 Y 1 A ASP 131 ? OD2 ? A ASP 151 OD2 19 1 Y 1 A GLU 132 ? CG ? A GLU 152 CG 20 1 Y 1 A GLU 132 ? CD ? A GLU 152 CD 21 1 Y 1 A GLU 132 ? OE1 ? A GLU 152 OE1 22 1 Y 1 A GLU 132 ? OE2 ? A GLU 152 OE2 23 1 N 1 A TRS 202 ? C2 ? C TRS 1 C2 24 1 N 1 A TRS 202 ? C3 ? C TRS 1 C3 25 1 N 1 A TRS 202 ? O2 ? C TRS 1 O2 26 1 N 1 A TRS 202 ? O3 ? C TRS 1 O3 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0049 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 5 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5ECT _cell.details ? _cell.formula_units_Z ? _cell.length_a 54.780 _cell.length_a_esd ? _cell.length_b 54.780 _cell.length_b_esd ? _cell.length_c 84.079 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5ECT _symmetry.cell_setting ? _symmetry.Int_Tables_number 173 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 63' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5ECT _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.15 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 42.75 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1.5 M ammonium sulfate, 0.1M Tris/HCl, 12% glycerol' _exptl_crystal_grow.pdbx_pH_range 7.5-8.5 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 225 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-02-06 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.8729 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID23-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.8729 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID23-2 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5ECT _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.3 _reflns.d_resolution_low 26.05 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 34842 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.10 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.3 _reflns.pdbx_Rmerge_I_obs 0.028 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 21.23 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.3 _reflns_shell.d_res_low 1.344 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.95 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 99.27 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 3.3 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -0.00 _refine.aniso_B[1][2] -0.00 _refine.aniso_B[1][3] -0.00 _refine.aniso_B[2][2] -0.00 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] 0.01 _refine.B_iso_max ? _refine.B_iso_mean 21.974 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.986 _refine.correlation_coeff_Fo_to_Fc_free 0.978 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5ECT _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.30 _refine.ls_d_res_low 26.04 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 33008 _refine.ls_number_reflns_R_free 1813 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.10 _refine.ls_percent_reflns_R_free 5.2 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.12441 _refine.ls_R_factor_R_free 0.15679 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.12267 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'FOURIER SYNTHESIS' _refine.pdbx_starting_model 3HZA _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.039 _refine.pdbx_overall_ESU_R_Free 0.040 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 2.007 _refine.overall_SU_ML 0.035 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 1050 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 39 _refine_hist.number_atoms_solvent 127 _refine_hist.number_atoms_total 1216 _refine_hist.d_res_high 1.30 _refine_hist.d_res_low 26.04 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.019 0.019 1126 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 1115 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.899 2.026 1541 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.249 3.000 2548 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.720 5.000 150 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 32.469 21.282 39 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 10.289 15.000 167 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 18.487 15.000 13 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.120 0.200 187 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.009 0.021 1250 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.005 0.020 235 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 5.658 2.132 589 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 5.712 2.133 587 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 7.339 3.180 733 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 7.404 3.189 734 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 4.511 2.200 535 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 4.495 2.200 535 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 5.170 3.228 804 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 7.140 17.251 1174 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 7.146 17.281 1175 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? 5.038 3.000 2236 ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? 27.470 5.000 52 ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? 16.086 5.000 2296 ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.300 _refine_ls_shell.d_res_low 1.334 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 112 _refine_ls_shell.number_reflns_R_work 2459 _refine_ls_shell.percent_reflns_obs 99.27 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.281 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.269 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5ECT _struct.title 'Mycobacterium tuberculosis dUTPase G143STOP mutant' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5ECT _struct_keywords.text 'HYDROLASE, JELLY-ROLL, TRIMER' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 6 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DUT_MYCTU _struct_ref.pdbx_db_accession P9WNS5 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSTTLAIVRLDPGLPLPSRAHDGDAGVDLYSAEDVELAPGRRALVRTGVAVAVPFGMVGLVHPRSGLATRVGLSIVNSPG TIDAGYRGEIKVALINLDPAAPIVVHRGDRIAQLLVQRVELVELVEVSSFDEAGLASTSRGD ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5ECT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 21 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 162 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P9WNS5 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 142 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 142 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5ECT MET A 1 ? UNP P9WNS5 ? ? 'initiating methionine' -19 1 1 5ECT GLY A 2 ? UNP P9WNS5 ? ? 'expression tag' -18 2 1 5ECT SER A 3 ? UNP P9WNS5 ? ? 'expression tag' -17 3 1 5ECT SER A 4 ? UNP P9WNS5 ? ? 'expression tag' -16 4 1 5ECT HIS A 5 ? UNP P9WNS5 ? ? 'expression tag' -15 5 1 5ECT HIS A 6 ? UNP P9WNS5 ? ? 'expression tag' -14 6 1 5ECT HIS A 7 ? UNP P9WNS5 ? ? 'expression tag' -13 7 1 5ECT HIS A 8 ? UNP P9WNS5 ? ? 'expression tag' -12 8 1 5ECT HIS A 9 ? UNP P9WNS5 ? ? 'expression tag' -11 9 1 5ECT HIS A 10 ? UNP P9WNS5 ? ? 'expression tag' -10 10 1 5ECT SER A 11 ? UNP P9WNS5 ? ? 'expression tag' -9 11 1 5ECT SER A 12 ? UNP P9WNS5 ? ? 'expression tag' -8 12 1 5ECT GLY A 13 ? UNP P9WNS5 ? ? 'expression tag' -7 13 1 5ECT LEU A 14 ? UNP P9WNS5 ? ? 'expression tag' -6 14 1 5ECT VAL A 15 ? UNP P9WNS5 ? ? 'expression tag' -5 15 1 5ECT PRO A 16 ? UNP P9WNS5 ? ? 'expression tag' -4 16 1 5ECT ARG A 17 ? UNP P9WNS5 ? ? 'expression tag' -3 17 1 5ECT GLY A 18 ? UNP P9WNS5 ? ? 'expression tag' -2 18 1 5ECT SER A 19 ? UNP P9WNS5 ? ? 'expression tag' -1 19 1 5ECT HIS A 20 ? UNP P9WNS5 ? ? 'expression tag' 0 20 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 14700 ? 1 MORE -81 ? 1 'SSA (A^2)' 17290 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_565 -y,x-y+1,z -0.5000000000 -0.8660254038 0.0000000000 -27.3900000000 0.8660254038 -0.5000000000 0.0000000000 47.4408716193 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_455 -x+y-1,-x,z -0.5000000000 0.8660254038 0.0000000000 -54.7800000000 -0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 16 ? HIS A 20 ? PRO A -4 HIS A 0 5 ? 5 HELX_P HELX_P2 AA2 ARG A 84 ? GLY A 92 ? ARG A 64 GLY A 72 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? B DUP . O2A ? ? ? 1_555 D MG . MG ? ? A DUP 201 A MG 203 1_555 ? ? ? ? ? ? ? 2.056 ? ? metalc2 metalc ? ? B DUP . O2B ? ? ? 1_555 D MG . MG ? ? A DUP 201 A MG 203 1_555 ? ? ? ? ? ? ? 2.099 ? ? metalc3 metalc ? ? B DUP . O1G ? ? ? 1_555 D MG . MG ? ? A DUP 201 A MG 203 1_555 ? ? ? ? ? ? ? 2.030 ? ? metalc4 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 203 A HOH 305 3_455 ? ? ? ? ? ? ? 2.063 ? ? metalc5 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 203 A HOH 372 1_555 ? ? ? ? ? ? ? 2.087 ? ? metalc6 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 203 A HOH 378 1_555 ? ? ? ? ? ? ? 2.149 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O2A ? B DUP . ? A DUP 201 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O2B ? B DUP . ? A DUP 201 ? 1_555 87.4 ? 2 O2A ? B DUP . ? A DUP 201 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O1G ? B DUP . ? A DUP 201 ? 1_555 94.6 ? 3 O2B ? B DUP . ? A DUP 201 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O1G ? B DUP . ? A DUP 201 ? 1_555 87.7 ? 4 O2A ? B DUP . ? A DUP 201 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? F HOH . ? A HOH 305 ? 3_455 172.9 ? 5 O2B ? B DUP . ? A DUP 201 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? F HOH . ? A HOH 305 ? 3_455 89.2 ? 6 O1G ? B DUP . ? A DUP 201 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? F HOH . ? A HOH 305 ? 3_455 91.5 ? 7 O2A ? B DUP . ? A DUP 201 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? F HOH . ? A HOH 372 ? 1_555 89.3 ? 8 O2B ? B DUP . ? A DUP 201 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? F HOH . ? A HOH 372 ? 1_555 93.4 ? 9 O1G ? B DUP . ? A DUP 201 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? F HOH . ? A HOH 372 ? 1_555 176.0 ? 10 O ? F HOH . ? A HOH 305 ? 3_455 MG ? D MG . ? A MG 203 ? 1_555 O ? F HOH . ? A HOH 372 ? 1_555 84.7 ? 11 O2A ? B DUP . ? A DUP 201 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? F HOH . ? A HOH 378 ? 1_555 88.5 ? 12 O2B ? B DUP . ? A DUP 201 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? F HOH . ? A HOH 378 ? 1_555 175.9 ? 13 O1G ? B DUP . ? A DUP 201 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? F HOH . ? A HOH 378 ? 1_555 93.3 ? 14 O ? F HOH . ? A HOH 305 ? 3_455 MG ? D MG . ? A MG 203 ? 1_555 O ? F HOH . ? A HOH 378 ? 1_555 94.8 ? 15 O ? F HOH . ? A HOH 372 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? F HOH . ? A HOH 378 ? 1_555 85.9 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id SER _struct_mon_prot_cis.label_seq_id 98 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id SER _struct_mon_prot_cis.auth_seq_id 78 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 99 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 79 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -7.23 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 4 ? AA3 ? 2 ? AA4 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ALA A 26 ? ARG A 29 ? ALA A 6 ARG A 9 AA1 2 VAL A 69 ? ALA A 72 ? VAL A 49 ALA A 52 AA2 1 VAL A 47 ? TYR A 50 ? VAL A 27 TYR A 30 AA2 2 ARG A 130 ? ARG A 138 ? ARG A 110 ARG A 118 AA2 3 MET A 77 ? HIS A 82 ? MET A 57 HIS A 62 AA2 4 GLY A 100 ? ILE A 102 ? GLY A 80 ILE A 82 AA3 1 VAL A 55 ? LEU A 57 ? VAL A 35 LEU A 37 AA3 2 ILE A 123 ? VAL A 125 ? ILE A 103 VAL A 105 AA4 1 ARG A 62 ? ARG A 66 ? ARG A 42 ARG A 46 AA4 2 LYS A 111 ? ASN A 116 ? LYS A 91 ASN A 96 AA4 3 LEU A 93 ? ILE A 95 ? LEU A 73 ILE A 75 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 28 ? N VAL A 8 O ALA A 70 ? O ALA A 50 AA2 1 2 N VAL A 47 ? N VAL A 27 O LEU A 134 ? O LEU A 114 AA2 2 3 O GLN A 133 ? O GLN A 113 N HIS A 82 ? N HIS A 62 AA2 3 4 N GLY A 79 ? N GLY A 59 O ILE A 102 ? O ILE A 82 AA3 1 2 N VAL A 55 ? N VAL A 35 O VAL A 125 ? O VAL A 105 AA4 1 2 N VAL A 65 ? N VAL A 45 O VAL A 112 ? O VAL A 92 AA4 2 3 O ILE A 115 ? O ILE A 95 N SER A 94 ? N SER A 74 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A DUP 201 ? 26 'binding site for residue DUP A 201' AC2 Software A TRS 202 ? 7 'binding site for residue TRS A 202' AC3 Software A MG 203 ? 4 'binding site for residue MG A 203' AC4 Software A GOL 204 ? 5 'binding site for residue GOL A 204' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 26 ARG A 84 ? ARG A 64 . ? 3_455 ? 2 AC1 26 SER A 85 ? SER A 65 . ? 3_455 ? 3 AC1 26 GLY A 86 ? GLY A 66 . ? 3_455 ? 4 AC1 26 ASN A 97 ? ASN A 77 . ? 1_555 ? 5 AC1 26 GLY A 100 ? GLY A 80 . ? 1_555 ? 6 AC1 26 THR A 101 ? THR A 81 . ? 1_555 ? 7 AC1 26 ILE A 102 ? ILE A 82 . ? 1_555 ? 8 AC1 26 ASP A 103 ? ASP A 83 . ? 1_555 ? 9 AC1 26 TYR A 106 ? TYR A 86 . ? 1_555 ? 10 AC1 26 ILE A 110 ? ILE A 90 . ? 1_555 ? 11 AC1 26 LYS A 111 ? LYS A 91 . ? 1_555 ? 12 AC1 26 GLN A 133 ? GLN A 113 . ? 3_455 ? 13 AC1 26 ARG A 160 ? ARG A 140 . ? 2_565 ? 14 AC1 26 MG D . ? MG A 203 . ? 1_555 ? 15 AC1 26 HOH F . ? HOH A 304 . ? 1_555 ? 16 AC1 26 HOH F . ? HOH A 305 . ? 3_455 ? 17 AC1 26 HOH F . ? HOH A 322 . ? 1_555 ? 18 AC1 26 HOH F . ? HOH A 324 . ? 1_555 ? 19 AC1 26 HOH F . ? HOH A 329 . ? 1_555 ? 20 AC1 26 HOH F . ? HOH A 334 . ? 1_555 ? 21 AC1 26 HOH F . ? HOH A 362 . ? 3_455 ? 22 AC1 26 HOH F . ? HOH A 364 . ? 3_455 ? 23 AC1 26 HOH F . ? HOH A 372 . ? 1_555 ? 24 AC1 26 HOH F . ? HOH A 378 . ? 1_555 ? 25 AC1 26 HOH F . ? HOH A 381 . ? 1_555 ? 26 AC1 26 HOH F . ? HOH A 414 . ? 2_565 ? 27 AC2 7 SER A 94 ? SER A 74 . ? 3_455 ? 28 AC2 7 SER A 94 ? SER A 74 . ? 2_565 ? 29 AC2 7 ILE A 95 ? ILE A 75 . ? 3_455 ? 30 AC2 7 VAL A 96 ? VAL A 76 . ? 3_455 ? 31 AC2 7 HOH F . ? HOH A 344 . ? 2_565 ? 32 AC2 7 HOH F . ? HOH A 344 . ? 1_555 ? 33 AC2 7 HOH F . ? HOH A 344 . ? 3_455 ? 34 AC3 4 DUP B . ? DUP A 201 . ? 1_555 ? 35 AC3 4 HOH F . ? HOH A 305 . ? 3_455 ? 36 AC3 4 HOH F . ? HOH A 372 . ? 1_555 ? 37 AC3 4 HOH F . ? HOH A 378 . ? 1_555 ? 38 AC4 5 ARG A 84 ? ARG A 64 . ? 2_565 ? 39 AC4 5 ASP A 129 ? ASP A 109 . ? 2_565 ? 40 AC4 5 ARG A 130 ? ARG A 110 . ? 2_565 ? 41 AC4 5 HOH F . ? HOH A 302 . ? 2_565 ? 42 AC4 5 HOH F . ? HOH A 380 . ? 2_565 ? # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 C _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 TRS _pdbx_validate_symm_contact.auth_seq_id_1 202 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 C1 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 TRS _pdbx_validate_symm_contact.auth_seq_id_2 202 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 2_565 _pdbx_validate_symm_contact.dist 1.62 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ALA _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 100 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -141.37 _pdbx_validate_torsion.psi -25.86 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A TRS 202 ? C TRS . 2 1 A TRS 202 ? C TRS . 3 1 A HOH 311 ? F HOH . 4 1 A HOH 349 ? F HOH . 5 1 A HOH 402 ? F HOH . 6 1 A HOH 408 ? F HOH . 7 1 A HOH 415 ? F HOH . 8 1 A HOH 419 ? F HOH . 9 1 A HOH 425 ? F HOH . # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 423 ? 5.92 . 2 1 O ? A HOH 424 ? 6.16 . 3 1 O ? A HOH 425 ? 6.53 . 4 1 O ? A HOH 426 ? . 6.99 5 1 O ? A HOH 427 ? 9.89 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -19 ? A MET 1 2 1 Y 1 A GLY -18 ? A GLY 2 3 1 Y 1 A SER -17 ? A SER 3 4 1 Y 1 A SER -16 ? A SER 4 5 1 Y 1 A HIS -15 ? A HIS 5 6 1 Y 1 A HIS -14 ? A HIS 6 7 1 Y 1 A HIS -13 ? A HIS 7 8 1 Y 1 A HIS -12 ? A HIS 8 9 1 Y 1 A HIS -11 ? A HIS 9 10 1 Y 1 A HIS -10 ? A HIS 10 11 1 Y 1 A SER -9 ? A SER 11 12 1 Y 1 A GLY 134 ? A GLY 154 13 1 Y 1 A LEU 135 ? A LEU 155 14 1 Y 1 A ALA 136 ? A ALA 156 15 1 Y 1 A SER 137 ? A SER 157 16 1 Y 1 A ASP 142 ? A ASP 162 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 DUP O4 O N N 74 DUP C4 C Y N 75 DUP C5 C Y N 76 DUP C6 C Y N 77 DUP N3 N Y N 78 DUP C2 C Y N 79 DUP O2 O N N 80 DUP N1 N Y N 81 DUP "C1'" C N R 82 DUP "C2'" C N N 83 DUP "C3'" C N S 84 DUP "O3'" O N N 85 DUP "O4'" O N N 86 DUP "C4'" C N R 87 DUP "C5'" C N N 88 DUP "O5'" O N N 89 DUP PA P N S 90 DUP O1A O N N 91 DUP O2A O N N 92 DUP N3A N N N 93 DUP PB P N R 94 DUP O1B O N N 95 DUP O2B O N N 96 DUP O3B O N N 97 DUP PG P N N 98 DUP O2G O N N 99 DUP O1G O N N 100 DUP O3G O N N 101 DUP H5 H N N 102 DUP H6 H N N 103 DUP HN3 H N N 104 DUP "H1'" H N N 105 DUP "H2'1" H N N 106 DUP "H2'2" H N N 107 DUP H1 H N N 108 DUP "H3'" H N N 109 DUP "H4'" H N N 110 DUP "H5'1" H N N 111 DUP "H5'2" H N N 112 DUP H2A H N N 113 DUP H3A H N N 114 DUP H2B H N N 115 DUP H1G H N N 116 DUP H3G H N N 117 GLN N N N N 118 GLN CA C N S 119 GLN C C N N 120 GLN O O N N 121 GLN CB C N N 122 GLN CG C N N 123 GLN CD C N N 124 GLN OE1 O N N 125 GLN NE2 N N N 126 GLN OXT O N N 127 GLN H H N N 128 GLN H2 H N N 129 GLN HA H N N 130 GLN HB2 H N N 131 GLN HB3 H N N 132 GLN HG2 H N N 133 GLN HG3 H N N 134 GLN HE21 H N N 135 GLN HE22 H N N 136 GLN HXT H N N 137 GLU N N N N 138 GLU CA C N S 139 GLU C C N N 140 GLU O O N N 141 GLU CB C N N 142 GLU CG C N N 143 GLU CD C N N 144 GLU OE1 O N N 145 GLU OE2 O N N 146 GLU OXT O N N 147 GLU H H N N 148 GLU H2 H N N 149 GLU HA H N N 150 GLU HB2 H N N 151 GLU HB3 H N N 152 GLU HG2 H N N 153 GLU HG3 H N N 154 GLU HE2 H N N 155 GLU HXT H N N 156 GLY N N N N 157 GLY CA C N N 158 GLY C C N N 159 GLY O O N N 160 GLY OXT O N N 161 GLY H H N N 162 GLY H2 H N N 163 GLY HA2 H N N 164 GLY HA3 H N N 165 GLY HXT H N N 166 GOL C1 C N N 167 GOL O1 O N N 168 GOL C2 C N N 169 GOL O2 O N N 170 GOL C3 C N N 171 GOL O3 O N N 172 GOL H11 H N N 173 GOL H12 H N N 174 GOL HO1 H N N 175 GOL H2 H N N 176 GOL HO2 H N N 177 GOL H31 H N N 178 GOL H32 H N N 179 GOL HO3 H N N 180 HIS N N N N 181 HIS CA C N S 182 HIS C C N N 183 HIS O O N N 184 HIS CB C N N 185 HIS CG C Y N 186 HIS ND1 N Y N 187 HIS CD2 C Y N 188 HIS CE1 C Y N 189 HIS NE2 N Y N 190 HIS OXT O N N 191 HIS H H N N 192 HIS H2 H N N 193 HIS HA H N N 194 HIS HB2 H N N 195 HIS HB3 H N N 196 HIS HD1 H N N 197 HIS HD2 H N N 198 HIS HE1 H N N 199 HIS HE2 H N N 200 HIS HXT H N N 201 HOH O O N N 202 HOH H1 H N N 203 HOH H2 H N N 204 ILE N N N N 205 ILE CA C N S 206 ILE C C N N 207 ILE O O N N 208 ILE CB C N S 209 ILE CG1 C N N 210 ILE CG2 C N N 211 ILE CD1 C N N 212 ILE OXT O N N 213 ILE H H N N 214 ILE H2 H N N 215 ILE HA H N N 216 ILE HB H N N 217 ILE HG12 H N N 218 ILE HG13 H N N 219 ILE HG21 H N N 220 ILE HG22 H N N 221 ILE HG23 H N N 222 ILE HD11 H N N 223 ILE HD12 H N N 224 ILE HD13 H N N 225 ILE HXT H N N 226 LEU N N N N 227 LEU CA C N S 228 LEU C C N N 229 LEU O O N N 230 LEU CB C N N 231 LEU CG C N N 232 LEU CD1 C N N 233 LEU CD2 C N N 234 LEU OXT O N N 235 LEU H H N N 236 LEU H2 H N N 237 LEU HA H N N 238 LEU HB2 H N N 239 LEU HB3 H N N 240 LEU HG H N N 241 LEU HD11 H N N 242 LEU HD12 H N N 243 LEU HD13 H N N 244 LEU HD21 H N N 245 LEU HD22 H N N 246 LEU HD23 H N N 247 LEU HXT H N N 248 LYS N N N N 249 LYS CA C N S 250 LYS C C N N 251 LYS O O N N 252 LYS CB C N N 253 LYS CG C N N 254 LYS CD C N N 255 LYS CE C N N 256 LYS NZ N N N 257 LYS OXT O N N 258 LYS H H N N 259 LYS H2 H N N 260 LYS HA H N N 261 LYS HB2 H N N 262 LYS HB3 H N N 263 LYS HG2 H N N 264 LYS HG3 H N N 265 LYS HD2 H N N 266 LYS HD3 H N N 267 LYS HE2 H N N 268 LYS HE3 H N N 269 LYS HZ1 H N N 270 LYS HZ2 H N N 271 LYS HZ3 H N N 272 LYS HXT H N N 273 MET N N N N 274 MET CA C N S 275 MET C C N N 276 MET O O N N 277 MET CB C N N 278 MET CG C N N 279 MET SD S N N 280 MET CE C N N 281 MET OXT O N N 282 MET H H N N 283 MET H2 H N N 284 MET HA H N N 285 MET HB2 H N N 286 MET HB3 H N N 287 MET HG2 H N N 288 MET HG3 H N N 289 MET HE1 H N N 290 MET HE2 H N N 291 MET HE3 H N N 292 MET HXT H N N 293 MG MG MG N N 294 PHE N N N N 295 PHE CA C N S 296 PHE C C N N 297 PHE O O N N 298 PHE CB C N N 299 PHE CG C Y N 300 PHE CD1 C Y N 301 PHE CD2 C Y N 302 PHE CE1 C Y N 303 PHE CE2 C Y N 304 PHE CZ C Y N 305 PHE OXT O N N 306 PHE H H N N 307 PHE H2 H N N 308 PHE HA H N N 309 PHE HB2 H N N 310 PHE HB3 H N N 311 PHE HD1 H N N 312 PHE HD2 H N N 313 PHE HE1 H N N 314 PHE HE2 H N N 315 PHE HZ H N N 316 PHE HXT H N N 317 PRO N N N N 318 PRO CA C N S 319 PRO C C N N 320 PRO O O N N 321 PRO CB C N N 322 PRO CG C N N 323 PRO CD C N N 324 PRO OXT O N N 325 PRO H H N N 326 PRO HA H N N 327 PRO HB2 H N N 328 PRO HB3 H N N 329 PRO HG2 H N N 330 PRO HG3 H N N 331 PRO HD2 H N N 332 PRO HD3 H N N 333 PRO HXT H N N 334 SER N N N N 335 SER CA C N S 336 SER C C N N 337 SER O O N N 338 SER CB C N N 339 SER OG O N N 340 SER OXT O N N 341 SER H H N N 342 SER H2 H N N 343 SER HA H N N 344 SER HB2 H N N 345 SER HB3 H N N 346 SER HG H N N 347 SER HXT H N N 348 THR N N N N 349 THR CA C N S 350 THR C C N N 351 THR O O N N 352 THR CB C N R 353 THR OG1 O N N 354 THR CG2 C N N 355 THR OXT O N N 356 THR H H N N 357 THR H2 H N N 358 THR HA H N N 359 THR HB H N N 360 THR HG1 H N N 361 THR HG21 H N N 362 THR HG22 H N N 363 THR HG23 H N N 364 THR HXT H N N 365 TRS C C N N 366 TRS C1 C N N 367 TRS C2 C N N 368 TRS C3 C N N 369 TRS N N N N 370 TRS O1 O N N 371 TRS O2 O N N 372 TRS O3 O N N 373 TRS H11 H N N 374 TRS H12 H N N 375 TRS H21 H N N 376 TRS H22 H N N 377 TRS H31 H N N 378 TRS H32 H N N 379 TRS HN1 H N N 380 TRS HN2 H N N 381 TRS HN3 H N N 382 TRS HO1 H N N 383 TRS HO2 H N N 384 TRS HO3 H N N 385 TYR N N N N 386 TYR CA C N S 387 TYR C C N N 388 TYR O O N N 389 TYR CB C N N 390 TYR CG C Y N 391 TYR CD1 C Y N 392 TYR CD2 C Y N 393 TYR CE1 C Y N 394 TYR CE2 C Y N 395 TYR CZ C Y N 396 TYR OH O N N 397 TYR OXT O N N 398 TYR H H N N 399 TYR H2 H N N 400 TYR HA H N N 401 TYR HB2 H N N 402 TYR HB3 H N N 403 TYR HD1 H N N 404 TYR HD2 H N N 405 TYR HE1 H N N 406 TYR HE2 H N N 407 TYR HH H N N 408 TYR HXT H N N 409 VAL N N N N 410 VAL CA C N S 411 VAL C C N N 412 VAL O O N N 413 VAL CB C N N 414 VAL CG1 C N N 415 VAL CG2 C N N 416 VAL OXT O N N 417 VAL H H N N 418 VAL H2 H N N 419 VAL HA H N N 420 VAL HB H N N 421 VAL HG11 H N N 422 VAL HG12 H N N 423 VAL HG13 H N N 424 VAL HG21 H N N 425 VAL HG22 H N N 426 VAL HG23 H N N 427 VAL HXT H N N 428 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 DUP O4 C4 doub N N 70 DUP C4 C5 sing Y N 71 DUP C4 N3 sing Y N 72 DUP C5 C6 doub Y N 73 DUP C5 H5 sing N N 74 DUP C6 N1 sing Y N 75 DUP C6 H6 sing N N 76 DUP N3 C2 sing Y N 77 DUP N3 HN3 sing N N 78 DUP C2 O2 doub N N 79 DUP C2 N1 sing Y N 80 DUP N1 "C1'" sing N N 81 DUP "C1'" "C2'" sing N N 82 DUP "C1'" "O4'" sing N N 83 DUP "C1'" "H1'" sing N N 84 DUP "C2'" "C3'" sing N N 85 DUP "C2'" "H2'1" sing N N 86 DUP "C2'" "H2'2" sing N N 87 DUP "C3'" "O3'" sing N N 88 DUP "C3'" "C4'" sing N N 89 DUP "C3'" H1 sing N N 90 DUP "O3'" "H3'" sing N N 91 DUP "O4'" "C4'" sing N N 92 DUP "C4'" "C5'" sing N N 93 DUP "C4'" "H4'" sing N N 94 DUP "C5'" "O5'" sing N N 95 DUP "C5'" "H5'1" sing N N 96 DUP "C5'" "H5'2" sing N N 97 DUP "O5'" PA sing N N 98 DUP PA O1A doub N N 99 DUP PA O2A sing N N 100 DUP PA N3A sing N N 101 DUP O2A H2A sing N N 102 DUP N3A PB sing N N 103 DUP N3A H3A sing N N 104 DUP PB O1B doub N N 105 DUP PB O2B sing N N 106 DUP PB O3B sing N N 107 DUP O2B H2B sing N N 108 DUP O3B PG sing N N 109 DUP PG O2G doub N N 110 DUP PG O1G sing N N 111 DUP PG O3G sing N N 112 DUP O1G H1G sing N N 113 DUP O3G H3G sing N N 114 GLN N CA sing N N 115 GLN N H sing N N 116 GLN N H2 sing N N 117 GLN CA C sing N N 118 GLN CA CB sing N N 119 GLN CA HA sing N N 120 GLN C O doub N N 121 GLN C OXT sing N N 122 GLN CB CG sing N N 123 GLN CB HB2 sing N N 124 GLN CB HB3 sing N N 125 GLN CG CD sing N N 126 GLN CG HG2 sing N N 127 GLN CG HG3 sing N N 128 GLN CD OE1 doub N N 129 GLN CD NE2 sing N N 130 GLN NE2 HE21 sing N N 131 GLN NE2 HE22 sing N N 132 GLN OXT HXT sing N N 133 GLU N CA sing N N 134 GLU N H sing N N 135 GLU N H2 sing N N 136 GLU CA C sing N N 137 GLU CA CB sing N N 138 GLU CA HA sing N N 139 GLU C O doub N N 140 GLU C OXT sing N N 141 GLU CB CG sing N N 142 GLU CB HB2 sing N N 143 GLU CB HB3 sing N N 144 GLU CG CD sing N N 145 GLU CG HG2 sing N N 146 GLU CG HG3 sing N N 147 GLU CD OE1 doub N N 148 GLU CD OE2 sing N N 149 GLU OE2 HE2 sing N N 150 GLU OXT HXT sing N N 151 GLY N CA sing N N 152 GLY N H sing N N 153 GLY N H2 sing N N 154 GLY CA C sing N N 155 GLY CA HA2 sing N N 156 GLY CA HA3 sing N N 157 GLY C O doub N N 158 GLY C OXT sing N N 159 GLY OXT HXT sing N N 160 GOL C1 O1 sing N N 161 GOL C1 C2 sing N N 162 GOL C1 H11 sing N N 163 GOL C1 H12 sing N N 164 GOL O1 HO1 sing N N 165 GOL C2 O2 sing N N 166 GOL C2 C3 sing N N 167 GOL C2 H2 sing N N 168 GOL O2 HO2 sing N N 169 GOL C3 O3 sing N N 170 GOL C3 H31 sing N N 171 GOL C3 H32 sing N N 172 GOL O3 HO3 sing N N 173 HIS N CA sing N N 174 HIS N H sing N N 175 HIS N H2 sing N N 176 HIS CA C sing N N 177 HIS CA CB sing N N 178 HIS CA HA sing N N 179 HIS C O doub N N 180 HIS C OXT sing N N 181 HIS CB CG sing N N 182 HIS CB HB2 sing N N 183 HIS CB HB3 sing N N 184 HIS CG ND1 sing Y N 185 HIS CG CD2 doub Y N 186 HIS ND1 CE1 doub Y N 187 HIS ND1 HD1 sing N N 188 HIS CD2 NE2 sing Y N 189 HIS CD2 HD2 sing N N 190 HIS CE1 NE2 sing Y N 191 HIS CE1 HE1 sing N N 192 HIS NE2 HE2 sing N N 193 HIS OXT HXT sing N N 194 HOH O H1 sing N N 195 HOH O H2 sing N N 196 ILE N CA sing N N 197 ILE N H sing N N 198 ILE N H2 sing N N 199 ILE CA C sing N N 200 ILE CA CB sing N N 201 ILE CA HA sing N N 202 ILE C O doub N N 203 ILE C OXT sing N N 204 ILE CB CG1 sing N N 205 ILE CB CG2 sing N N 206 ILE CB HB sing N N 207 ILE CG1 CD1 sing N N 208 ILE CG1 HG12 sing N N 209 ILE CG1 HG13 sing N N 210 ILE CG2 HG21 sing N N 211 ILE CG2 HG22 sing N N 212 ILE CG2 HG23 sing N N 213 ILE CD1 HD11 sing N N 214 ILE CD1 HD12 sing N N 215 ILE CD1 HD13 sing N N 216 ILE OXT HXT sing N N 217 LEU N CA sing N N 218 LEU N H sing N N 219 LEU N H2 sing N N 220 LEU CA C sing N N 221 LEU CA CB sing N N 222 LEU CA HA sing N N 223 LEU C O doub N N 224 LEU C OXT sing N N 225 LEU CB CG sing N N 226 LEU CB HB2 sing N N 227 LEU CB HB3 sing N N 228 LEU CG CD1 sing N N 229 LEU CG CD2 sing N N 230 LEU CG HG sing N N 231 LEU CD1 HD11 sing N N 232 LEU CD1 HD12 sing N N 233 LEU CD1 HD13 sing N N 234 LEU CD2 HD21 sing N N 235 LEU CD2 HD22 sing N N 236 LEU CD2 HD23 sing N N 237 LEU OXT HXT sing N N 238 LYS N CA sing N N 239 LYS N H sing N N 240 LYS N H2 sing N N 241 LYS CA C sing N N 242 LYS CA CB sing N N 243 LYS CA HA sing N N 244 LYS C O doub N N 245 LYS C OXT sing N N 246 LYS CB CG sing N N 247 LYS CB HB2 sing N N 248 LYS CB HB3 sing N N 249 LYS CG CD sing N N 250 LYS CG HG2 sing N N 251 LYS CG HG3 sing N N 252 LYS CD CE sing N N 253 LYS CD HD2 sing N N 254 LYS CD HD3 sing N N 255 LYS CE NZ sing N N 256 LYS CE HE2 sing N N 257 LYS CE HE3 sing N N 258 LYS NZ HZ1 sing N N 259 LYS NZ HZ2 sing N N 260 LYS NZ HZ3 sing N N 261 LYS OXT HXT sing N N 262 MET N CA sing N N 263 MET N H sing N N 264 MET N H2 sing N N 265 MET CA C sing N N 266 MET CA CB sing N N 267 MET CA HA sing N N 268 MET C O doub N N 269 MET C OXT sing N N 270 MET CB CG sing N N 271 MET CB HB2 sing N N 272 MET CB HB3 sing N N 273 MET CG SD sing N N 274 MET CG HG2 sing N N 275 MET CG HG3 sing N N 276 MET SD CE sing N N 277 MET CE HE1 sing N N 278 MET CE HE2 sing N N 279 MET CE HE3 sing N N 280 MET OXT HXT sing N N 281 PHE N CA sing N N 282 PHE N H sing N N 283 PHE N H2 sing N N 284 PHE CA C sing N N 285 PHE CA CB sing N N 286 PHE CA HA sing N N 287 PHE C O doub N N 288 PHE C OXT sing N N 289 PHE CB CG sing N N 290 PHE CB HB2 sing N N 291 PHE CB HB3 sing N N 292 PHE CG CD1 doub Y N 293 PHE CG CD2 sing Y N 294 PHE CD1 CE1 sing Y N 295 PHE CD1 HD1 sing N N 296 PHE CD2 CE2 doub Y N 297 PHE CD2 HD2 sing N N 298 PHE CE1 CZ doub Y N 299 PHE CE1 HE1 sing N N 300 PHE CE2 CZ sing Y N 301 PHE CE2 HE2 sing N N 302 PHE CZ HZ sing N N 303 PHE OXT HXT sing N N 304 PRO N CA sing N N 305 PRO N CD sing N N 306 PRO N H sing N N 307 PRO CA C sing N N 308 PRO CA CB sing N N 309 PRO CA HA sing N N 310 PRO C O doub N N 311 PRO C OXT sing N N 312 PRO CB CG sing N N 313 PRO CB HB2 sing N N 314 PRO CB HB3 sing N N 315 PRO CG CD sing N N 316 PRO CG HG2 sing N N 317 PRO CG HG3 sing N N 318 PRO CD HD2 sing N N 319 PRO CD HD3 sing N N 320 PRO OXT HXT sing N N 321 SER N CA sing N N 322 SER N H sing N N 323 SER N H2 sing N N 324 SER CA C sing N N 325 SER CA CB sing N N 326 SER CA HA sing N N 327 SER C O doub N N 328 SER C OXT sing N N 329 SER CB OG sing N N 330 SER CB HB2 sing N N 331 SER CB HB3 sing N N 332 SER OG HG sing N N 333 SER OXT HXT sing N N 334 THR N CA sing N N 335 THR N H sing N N 336 THR N H2 sing N N 337 THR CA C sing N N 338 THR CA CB sing N N 339 THR CA HA sing N N 340 THR C O doub N N 341 THR C OXT sing N N 342 THR CB OG1 sing N N 343 THR CB CG2 sing N N 344 THR CB HB sing N N 345 THR OG1 HG1 sing N N 346 THR CG2 HG21 sing N N 347 THR CG2 HG22 sing N N 348 THR CG2 HG23 sing N N 349 THR OXT HXT sing N N 350 TRS C C1 sing N N 351 TRS C C2 sing N N 352 TRS C C3 sing N N 353 TRS C N sing N N 354 TRS C1 O1 sing N N 355 TRS C1 H11 sing N N 356 TRS C1 H12 sing N N 357 TRS C2 O2 sing N N 358 TRS C2 H21 sing N N 359 TRS C2 H22 sing N N 360 TRS C3 O3 sing N N 361 TRS C3 H31 sing N N 362 TRS C3 H32 sing N N 363 TRS N HN1 sing N N 364 TRS N HN2 sing N N 365 TRS N HN3 sing N N 366 TRS O1 HO1 sing N N 367 TRS O2 HO2 sing N N 368 TRS O3 HO3 sing N N 369 TYR N CA sing N N 370 TYR N H sing N N 371 TYR N H2 sing N N 372 TYR CA C sing N N 373 TYR CA CB sing N N 374 TYR CA HA sing N N 375 TYR C O doub N N 376 TYR C OXT sing N N 377 TYR CB CG sing N N 378 TYR CB HB2 sing N N 379 TYR CB HB3 sing N N 380 TYR CG CD1 doub Y N 381 TYR CG CD2 sing Y N 382 TYR CD1 CE1 sing Y N 383 TYR CD1 HD1 sing N N 384 TYR CD2 CE2 doub Y N 385 TYR CD2 HD2 sing N N 386 TYR CE1 CZ doub Y N 387 TYR CE1 HE1 sing N N 388 TYR CE2 CZ sing Y N 389 TYR CE2 HE2 sing N N 390 TYR CZ OH sing N N 391 TYR OH HH sing N N 392 TYR OXT HXT sing N N 393 VAL N CA sing N N 394 VAL N H sing N N 395 VAL N H2 sing N N 396 VAL CA C sing N N 397 VAL CA CB sing N N 398 VAL CA HA sing N N 399 VAL C O doub N N 400 VAL C OXT sing N N 401 VAL CB CG1 sing N N 402 VAL CB CG2 sing N N 403 VAL CB HB sing N N 404 VAL CG1 HG11 sing N N 405 VAL CG1 HG12 sing N N 406 VAL CG1 HG13 sing N N 407 VAL CG2 HG21 sing N N 408 VAL CG2 HG22 sing N N 409 VAL CG2 HG23 sing N N 410 VAL OXT HXT sing N N 411 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Hungarian Scientific Research Fund' Hungary 'NK 84008' 1 'Hungarian Scientific Research Fund' Hungary K109486 2 Biostruct-X Hungary 283570 3 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3HZA _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 5ECT _atom_sites.fract_transf_matrix[1][1] 0.018255 _atom_sites.fract_transf_matrix[1][2] 0.010539 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021079 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011894 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C MG N O P S # loop_