data_5F51 # _entry.id 5F51 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5F51 pdb_00005f51 10.2210/pdb5f51/pdb WWPDB D_1000215902 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.details 'same WrpA protein but bound to FMN' _pdbx_database_related.db_id 5F4B _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5F51 _pdbx_database_status.recvd_initial_deposition_date 2015-12-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Herrou, J.' 1 'Czyz, D.' 2 'Willett, J.W.' 3 'Kim, H.S.' 4 'Kim, Y.' 5 'Crosson, S.' 6 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Bacteriol. _citation.journal_id_ASTM JOBAAY _citation.journal_id_CSD 0767 _citation.journal_id_ISSN 1098-5530 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 198 _citation.language ? _citation.page_first 1281 _citation.page_last 1293 _citation.title 'WrpA Is an Atypical Flavodoxin Family Protein under Regulatory Control of the Brucella abortus General Stress Response System.' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1128/JB.00982-15 _citation.pdbx_database_id_PubMed 26858101 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Herrou, J.' 1 ? primary 'Czyz, D.M.' 2 ? primary 'Willett, J.W.' 3 ? primary 'Kim, H.S.' 4 ? primary 'Chhor, G.' 5 ? primary 'Babnigg, G.' 6 ? primary 'Kim, Y.' 7 ? primary 'Crosson, S.' 8 ? # _cell.entry_id 5F51 _cell.length_a 61.280 _cell.length_b 61.280 _cell.length_c 128.340 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5F51 _symmetry.space_group_name_H-M 'P 42 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 93 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'NAD(P)H dehydrogenase (quinone)' 23636.812 1 1.6.5.2 ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 3 water nat water 18.015 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Flavoprotein WrbA,NAD(P)H:quinone oxidoreductase,NQO' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMVKMLVLYYSAYGYMEQMAKAAAEGAREGGAEVTLKRVPELVPEEVAKASHYKIDQEVPI ATPGELADYDAIIIGTATRYGMMASQMKNFLDQTGGLWAKGALINKVGSVMVSTATQHGGAELALISTQWQMQHHGMIIV PLSYAYREQMGNDVVRGGAPYGMTTTADGDGSRQPSAQELDGARFQGRRVAEITAKLHG ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMVKMLVLYYSAYGYMEQMAKAAAEGAREGGAEVTLKRVPELVPEEVAKASHYKIDQEVPI ATPGELADYDAIIIGTATRYGMMASQMKNFLDQTGGLWAKGALINKVGSVMVSTATQHGGAELALISTQWQMQHHGMIIV PLSYAYREQMGNDVVRGGAPYGMTTTADGDGSRQPSAQELDGARFQGRRVAEITAKLHG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 VAL n 1 23 LYS n 1 24 MET n 1 25 LEU n 1 26 VAL n 1 27 LEU n 1 28 TYR n 1 29 TYR n 1 30 SER n 1 31 ALA n 1 32 TYR n 1 33 GLY n 1 34 TYR n 1 35 MET n 1 36 GLU n 1 37 GLN n 1 38 MET n 1 39 ALA n 1 40 LYS n 1 41 ALA n 1 42 ALA n 1 43 ALA n 1 44 GLU n 1 45 GLY n 1 46 ALA n 1 47 ARG n 1 48 GLU n 1 49 GLY n 1 50 GLY n 1 51 ALA n 1 52 GLU n 1 53 VAL n 1 54 THR n 1 55 LEU n 1 56 LYS n 1 57 ARG n 1 58 VAL n 1 59 PRO n 1 60 GLU n 1 61 LEU n 1 62 VAL n 1 63 PRO n 1 64 GLU n 1 65 GLU n 1 66 VAL n 1 67 ALA n 1 68 LYS n 1 69 ALA n 1 70 SER n 1 71 HIS n 1 72 TYR n 1 73 LYS n 1 74 ILE n 1 75 ASP n 1 76 GLN n 1 77 GLU n 1 78 VAL n 1 79 PRO n 1 80 ILE n 1 81 ALA n 1 82 THR n 1 83 PRO n 1 84 GLY n 1 85 GLU n 1 86 LEU n 1 87 ALA n 1 88 ASP n 1 89 TYR n 1 90 ASP n 1 91 ALA n 1 92 ILE n 1 93 ILE n 1 94 ILE n 1 95 GLY n 1 96 THR n 1 97 ALA n 1 98 THR n 1 99 ARG n 1 100 TYR n 1 101 GLY n 1 102 MET n 1 103 MET n 1 104 ALA n 1 105 SER n 1 106 GLN n 1 107 MET n 1 108 LYS n 1 109 ASN n 1 110 PHE n 1 111 LEU n 1 112 ASP n 1 113 GLN n 1 114 THR n 1 115 GLY n 1 116 GLY n 1 117 LEU n 1 118 TRP n 1 119 ALA n 1 120 LYS n 1 121 GLY n 1 122 ALA n 1 123 LEU n 1 124 ILE n 1 125 ASN n 1 126 LYS n 1 127 VAL n 1 128 GLY n 1 129 SER n 1 130 VAL n 1 131 MET n 1 132 VAL n 1 133 SER n 1 134 THR n 1 135 ALA n 1 136 THR n 1 137 GLN n 1 138 HIS n 1 139 GLY n 1 140 GLY n 1 141 ALA n 1 142 GLU n 1 143 LEU n 1 144 ALA n 1 145 LEU n 1 146 ILE n 1 147 SER n 1 148 THR n 1 149 GLN n 1 150 TRP n 1 151 GLN n 1 152 MET n 1 153 GLN n 1 154 HIS n 1 155 HIS n 1 156 GLY n 1 157 MET n 1 158 ILE n 1 159 ILE n 1 160 VAL n 1 161 PRO n 1 162 LEU n 1 163 SER n 1 164 TYR n 1 165 ALA n 1 166 TYR n 1 167 ARG n 1 168 GLU n 1 169 GLN n 1 170 MET n 1 171 GLY n 1 172 ASN n 1 173 ASP n 1 174 VAL n 1 175 VAL n 1 176 ARG n 1 177 GLY n 1 178 GLY n 1 179 ALA n 1 180 PRO n 1 181 TYR n 1 182 GLY n 1 183 MET n 1 184 THR n 1 185 THR n 1 186 THR n 1 187 ALA n 1 188 ASP n 1 189 GLY n 1 190 ASP n 1 191 GLY n 1 192 SER n 1 193 ARG n 1 194 GLN n 1 195 PRO n 1 196 SER n 1 197 ALA n 1 198 GLN n 1 199 GLU n 1 200 LEU n 1 201 ASP n 1 202 GLY n 1 203 ALA n 1 204 ARG n 1 205 PHE n 1 206 GLN n 1 207 GLY n 1 208 ARG n 1 209 ARG n 1 210 VAL n 1 211 ALA n 1 212 GLU n 1 213 ILE n 1 214 THR n 1 215 ALA n 1 216 LYS n 1 217 LEU n 1 218 HIS n 1 219 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 219 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene BAB1_1070 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 2308 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Brucella abortus (strain 2308)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 359391 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 866768 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details KanR _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28c _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.db_code NQOR_BRUA2 _struct_ref.db_name UNP _struct_ref.details ? _struct_ref.entity_id 1 _struct_ref.id 1 _struct_ref.seq_align ? _struct_ref.seq_dif ? _struct_ref.pdbx_db_accession Q2YQ23 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ;MVKMLVLYYSAYGYMEQMAKAAAEGAREGGAEVTLKRVPELVPEEVAKASHYKIDQEVPIATPGELADYDAIIIGTATRY GMMASQMKNFLDQTGGLWAKGALINKVGSVMVSTATQHGGAELALISTQWQMQHHGMIIVPLSYAYREQMGNDVVRGGAP YGMTTTADGDGSRQPSAQELDGARFQGRRVAEITAKLHG ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_align_end ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5F51 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 21 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 219 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q2YQ23 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 199 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 199 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5F51 MET A 1 ? UNP Q2YQ23 ? ? 'expression tag' -19 1 1 5F51 GLY A 2 ? UNP Q2YQ23 ? ? 'expression tag' -18 2 1 5F51 SER A 3 ? UNP Q2YQ23 ? ? 'expression tag' -17 3 1 5F51 SER A 4 ? UNP Q2YQ23 ? ? 'expression tag' -16 4 1 5F51 HIS A 5 ? UNP Q2YQ23 ? ? 'expression tag' -15 5 1 5F51 HIS A 6 ? UNP Q2YQ23 ? ? 'expression tag' -14 6 1 5F51 HIS A 7 ? UNP Q2YQ23 ? ? 'expression tag' -13 7 1 5F51 HIS A 8 ? UNP Q2YQ23 ? ? 'expression tag' -12 8 1 5F51 HIS A 9 ? UNP Q2YQ23 ? ? 'expression tag' -11 9 1 5F51 HIS A 10 ? UNP Q2YQ23 ? ? 'expression tag' -10 10 1 5F51 SER A 11 ? UNP Q2YQ23 ? ? 'expression tag' -9 11 1 5F51 SER A 12 ? UNP Q2YQ23 ? ? 'expression tag' -8 12 1 5F51 GLY A 13 ? UNP Q2YQ23 ? ? 'expression tag' -7 13 1 5F51 LEU A 14 ? UNP Q2YQ23 ? ? 'expression tag' -6 14 1 5F51 VAL A 15 ? UNP Q2YQ23 ? ? 'expression tag' -5 15 1 5F51 PRO A 16 ? UNP Q2YQ23 ? ? 'expression tag' -4 16 1 5F51 ARG A 17 ? UNP Q2YQ23 ? ? 'expression tag' -3 17 1 5F51 GLY A 18 ? UNP Q2YQ23 ? ? 'expression tag' -2 18 1 5F51 SER A 19 ? UNP Q2YQ23 ? ? 'expression tag' -1 19 1 5F51 HIS A 20 ? UNP Q2YQ23 ? ? 'expression tag' 0 20 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5F51 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.55 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 51.74 _exptl_crystal.description rectangular _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 292 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100 mM Sodium Acetate pH4.6, 300 mM Ammonium Sulfate, 20% PEG 2000 MME' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 300 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-10-07 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 21-ID-D' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.979 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 21-ID-D _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5F51 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.53 _reflns.d_resolution_low 44.32 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all 110348 _reflns.number_obs 8704 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.7 _reflns.pdbx_Rmerge_I_obs 0.063 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 23.54 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.53 _reflns_shell.d_res_low 2.62 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 4.1 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 99.6 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.698 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 13.2 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 5F51 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 8687 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 44.318 _refine.ls_d_res_high 2.530 _refine.ls_percent_reflns_obs 99.51 _refine.ls_R_factor_obs 0.2405 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2390 _refine.ls_R_factor_R_free 0.2680 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.74 _refine.ls_number_reflns_R_free 412 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.details ? _refine.pdbx_starting_model 3B6I _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details 'Random selection' _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.34 _refine.pdbx_overall_phase_error 33.66 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1229 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.number_atoms_solvent 2 _refine_hist.number_atoms_total 1236 _refine_hist.d_res_high 2.530 _refine_hist.d_res_low 44.318 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.003 ? ? 1251 'X-RAY DIFFRACTION' ? f_angle_d 0.715 ? ? 1690 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 12.975 ? ? 454 'X-RAY DIFFRACTION' ? f_chiral_restr 0.027 ? ? 191 'X-RAY DIFFRACTION' ? f_plane_restr 0.002 ? ? 217 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.number_reflns_obs 'X-RAY DIFFRACTION' . 2.5303 2.8964 2683 0.2958 100.00 0.3529 . . 135 . . . . 'X-RAY DIFFRACTION' . 2.8964 3.6489 2732 0.2875 100.00 0.3431 . . 123 . . . . 'X-RAY DIFFRACTION' . 3.6489 44.3248 2860 0.2126 99.00 0.2333 . . 154 . . . . # _struct.entry_id 5F51 _struct.title 'Structure of B. abortus WrbA-related protein A (apo)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5F51 _struct_keywords.text 'Brucella abortus, WrbA, NADH:quinone, WrpA, OXIDOREDUCTASE' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 33 ? GLY A 49 ? GLY A 13 GLY A 29 1 ? 17 HELX_P HELX_P2 AA2 GLY A 84 ? ASP A 88 ? GLY A 64 ASP A 68 5 ? 5 HELX_P HELX_P3 AA3 ALA A 104 ? ASP A 112 ? ALA A 84 ASP A 92 1 ? 9 HELX_P HELX_P4 AA4 THR A 114 ? LYS A 120 ? THR A 94 LYS A 100 1 ? 7 HELX_P HELX_P5 AA5 ALA A 141 ? HIS A 155 ? ALA A 121 HIS A 135 1 ? 15 HELX_P HELX_P6 AA6 SER A 196 ? LEU A 217 ? SER A 176 LEU A 197 1 ? 22 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? parallel AA2 3 4 ? parallel AA2 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 52 ? ARG A 57 ? GLU A 32 ARG A 37 AA1 2 LYS A 23 ? TYR A 29 ? LYS A 3 TYR A 9 AA1 3 ALA A 91 ? ARG A 99 ? ALA A 71 ARG A 79 AA1 4 MET A 102 ? MET A 103 ? MET A 82 MET A 83 AA2 1 GLU A 52 ? ARG A 57 ? GLU A 32 ARG A 37 AA2 2 LYS A 23 ? TYR A 29 ? LYS A 3 TYR A 9 AA2 3 ALA A 91 ? ARG A 99 ? ALA A 71 ARG A 79 AA2 4 VAL A 127 ? SER A 133 ? VAL A 107 SER A 113 AA2 5 ILE A 158 ? ILE A 159 ? ILE A 138 ILE A 139 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O THR A 54 ? O THR A 34 N VAL A 26 ? N VAL A 6 AA1 2 3 N LEU A 25 ? N LEU A 5 O ILE A 93 ? O ILE A 73 AA1 3 4 N ARG A 99 ? N ARG A 79 O MET A 102 ? O MET A 82 AA2 1 2 O THR A 54 ? O THR A 34 N VAL A 26 ? N VAL A 6 AA2 2 3 N LEU A 25 ? N LEU A 5 O ILE A 93 ? O ILE A 73 AA2 3 4 N ILE A 94 ? N ILE A 74 O MET A 131 ? O MET A 111 AA2 4 5 N GLY A 128 ? N GLY A 108 O ILE A 158 ? O ILE A 138 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id SO4 _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 7 _struct_site.details 'binding site for residue SO4 A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 SER A 30 ? SER A 10 . ? 1_555 ? 2 AC1 7 ALA A 31 ? ALA A 11 . ? 1_555 ? 3 AC1 7 TYR A 32 ? TYR A 12 . ? 1_555 ? 4 AC1 7 TYR A 34 ? TYR A 14 . ? 1_555 ? 5 AC1 7 MET A 35 ? MET A 15 . ? 1_555 ? 6 AC1 7 ALA A 97 ? ALA A 77 . ? 1_555 ? 7 AC1 7 SER A 133 ? SER A 113 . ? 1_555 ? # _atom_sites.entry_id 5F51 _atom_sites.fract_transf_matrix[1][1] 0.016319 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016319 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007792 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -19 ? ? ? A . n A 1 2 GLY 2 -18 ? ? ? A . n A 1 3 SER 3 -17 ? ? ? A . n A 1 4 SER 4 -16 ? ? ? A . n A 1 5 HIS 5 -15 ? ? ? A . n A 1 6 HIS 6 -14 ? ? ? A . n A 1 7 HIS 7 -13 ? ? ? A . n A 1 8 HIS 8 -12 ? ? ? A . n A 1 9 HIS 9 -11 ? ? ? A . n A 1 10 HIS 10 -10 ? ? ? A . n A 1 11 SER 11 -9 ? ? ? A . n A 1 12 SER 12 -8 ? ? ? A . n A 1 13 GLY 13 -7 ? ? ? A . n A 1 14 LEU 14 -6 ? ? ? A . n A 1 15 VAL 15 -5 ? ? ? A . n A 1 16 PRO 16 -4 ? ? ? A . n A 1 17 ARG 17 -3 ? ? ? A . n A 1 18 GLY 18 -2 ? ? ? A . n A 1 19 SER 19 -1 ? ? ? A . n A 1 20 HIS 20 0 ? ? ? A . n A 1 21 MET 21 1 1 MET MET A . n A 1 22 VAL 22 2 2 VAL VAL A . n A 1 23 LYS 23 3 3 LYS LYS A . n A 1 24 MET 24 4 4 MET MET A . n A 1 25 LEU 25 5 5 LEU LEU A . n A 1 26 VAL 26 6 6 VAL VAL A . n A 1 27 LEU 27 7 7 LEU LEU A . n A 1 28 TYR 28 8 8 TYR TYR A . n A 1 29 TYR 29 9 9 TYR TYR A . n A 1 30 SER 30 10 10 SER SER A . n A 1 31 ALA 31 11 11 ALA ALA A . n A 1 32 TYR 32 12 12 TYR TYR A . n A 1 33 GLY 33 13 13 GLY GLY A . n A 1 34 TYR 34 14 14 TYR TYR A . n A 1 35 MET 35 15 15 MET MET A . n A 1 36 GLU 36 16 16 GLU GLU A . n A 1 37 GLN 37 17 17 GLN GLN A . n A 1 38 MET 38 18 18 MET MET A . n A 1 39 ALA 39 19 19 ALA ALA A . n A 1 40 LYS 40 20 20 LYS LYS A . n A 1 41 ALA 41 21 21 ALA ALA A . n A 1 42 ALA 42 22 22 ALA ALA A . n A 1 43 ALA 43 23 23 ALA ALA A . n A 1 44 GLU 44 24 24 GLU GLU A . n A 1 45 GLY 45 25 25 GLY GLY A . n A 1 46 ALA 46 26 26 ALA ALA A . n A 1 47 ARG 47 27 27 ARG ARG A . n A 1 48 GLU 48 28 28 GLU GLU A . n A 1 49 GLY 49 29 29 GLY GLY A . n A 1 50 GLY 50 30 30 GLY GLY A . n A 1 51 ALA 51 31 31 ALA ALA A . n A 1 52 GLU 52 32 32 GLU GLU A . n A 1 53 VAL 53 33 33 VAL VAL A . n A 1 54 THR 54 34 34 THR THR A . n A 1 55 LEU 55 35 35 LEU LEU A . n A 1 56 LYS 56 36 36 LYS LYS A . n A 1 57 ARG 57 37 37 ARG ARG A . n A 1 58 VAL 58 38 38 VAL VAL A . n A 1 59 PRO 59 39 39 PRO PRO A . n A 1 60 GLU 60 40 40 GLU GLU A . n A 1 61 LEU 61 41 41 LEU LEU A . n A 1 62 VAL 62 42 42 VAL VAL A . n A 1 63 PRO 63 43 43 PRO PRO A . n A 1 64 GLU 64 44 44 GLU GLU A . n A 1 65 GLU 65 45 45 GLU GLU A . n A 1 66 VAL 66 46 46 VAL VAL A . n A 1 67 ALA 67 47 47 ALA ALA A . n A 1 68 LYS 68 48 48 LYS LYS A . n A 1 69 ALA 69 49 49 ALA ALA A . n A 1 70 SER 70 50 50 SER SER A . n A 1 71 HIS 71 51 51 HIS HIS A . n A 1 72 TYR 72 52 52 TYR TYR A . n A 1 73 LYS 73 53 53 LYS LYS A . n A 1 74 ILE 74 54 54 ILE ILE A . n A 1 75 ASP 75 55 55 ASP ASP A . n A 1 76 GLN 76 56 56 GLN GLN A . n A 1 77 GLU 77 57 57 GLU GLU A . n A 1 78 VAL 78 58 58 VAL VAL A . n A 1 79 PRO 79 59 59 PRO PRO A . n A 1 80 ILE 80 60 60 ILE ILE A . n A 1 81 ALA 81 61 61 ALA ALA A . n A 1 82 THR 82 62 62 THR THR A . n A 1 83 PRO 83 63 63 PRO PRO A . n A 1 84 GLY 84 64 64 GLY GLY A . n A 1 85 GLU 85 65 65 GLU GLU A . n A 1 86 LEU 86 66 66 LEU LEU A . n A 1 87 ALA 87 67 67 ALA ALA A . n A 1 88 ASP 88 68 68 ASP ASP A . n A 1 89 TYR 89 69 69 TYR TYR A . n A 1 90 ASP 90 70 70 ASP ASP A . n A 1 91 ALA 91 71 71 ALA ALA A . n A 1 92 ILE 92 72 72 ILE ILE A . n A 1 93 ILE 93 73 73 ILE ILE A . n A 1 94 ILE 94 74 74 ILE ILE A . n A 1 95 GLY 95 75 75 GLY GLY A . n A 1 96 THR 96 76 76 THR THR A . n A 1 97 ALA 97 77 77 ALA ALA A . n A 1 98 THR 98 78 78 THR THR A . n A 1 99 ARG 99 79 79 ARG ARG A . n A 1 100 TYR 100 80 80 TYR TYR A . n A 1 101 GLY 101 81 81 GLY GLY A . n A 1 102 MET 102 82 82 MET MET A . n A 1 103 MET 103 83 83 MET MET A . n A 1 104 ALA 104 84 84 ALA ALA A . n A 1 105 SER 105 85 85 SER SER A . n A 1 106 GLN 106 86 86 GLN GLN A . n A 1 107 MET 107 87 87 MET MET A . n A 1 108 LYS 108 88 88 LYS LYS A . n A 1 109 ASN 109 89 89 ASN ASN A . n A 1 110 PHE 110 90 90 PHE PHE A . n A 1 111 LEU 111 91 91 LEU LEU A . n A 1 112 ASP 112 92 92 ASP ASP A . n A 1 113 GLN 113 93 93 GLN GLN A . n A 1 114 THR 114 94 94 THR THR A . n A 1 115 GLY 115 95 95 GLY GLY A . n A 1 116 GLY 116 96 96 GLY GLY A . n A 1 117 LEU 117 97 97 LEU LEU A . n A 1 118 TRP 118 98 98 TRP TRP A . n A 1 119 ALA 119 99 99 ALA ALA A . n A 1 120 LYS 120 100 100 LYS LYS A . n A 1 121 GLY 121 101 101 GLY GLY A . n A 1 122 ALA 122 102 102 ALA ALA A . n A 1 123 LEU 123 103 103 LEU LEU A . n A 1 124 ILE 124 104 104 ILE ILE A . n A 1 125 ASN 125 105 105 ASN ASN A . n A 1 126 LYS 126 106 106 LYS LYS A . n A 1 127 VAL 127 107 107 VAL VAL A . n A 1 128 GLY 128 108 108 GLY GLY A . n A 1 129 SER 129 109 109 SER SER A . n A 1 130 VAL 130 110 110 VAL VAL A . n A 1 131 MET 131 111 111 MET MET A . n A 1 132 VAL 132 112 112 VAL VAL A . n A 1 133 SER 133 113 113 SER SER A . n A 1 134 THR 134 114 114 THR THR A . n A 1 135 ALA 135 115 ? ? ? A . n A 1 136 THR 136 116 ? ? ? A . n A 1 137 GLN 137 117 ? ? ? A . n A 1 138 HIS 138 118 ? ? ? A . n A 1 139 GLY 139 119 ? ? ? A . n A 1 140 GLY 140 120 120 GLY GLY A . n A 1 141 ALA 141 121 121 ALA ALA A . n A 1 142 GLU 142 122 122 GLU GLU A . n A 1 143 LEU 143 123 123 LEU LEU A . n A 1 144 ALA 144 124 124 ALA ALA A . n A 1 145 LEU 145 125 125 LEU LEU A . n A 1 146 ILE 146 126 126 ILE ILE A . n A 1 147 SER 147 127 127 SER SER A . n A 1 148 THR 148 128 128 THR THR A . n A 1 149 GLN 149 129 129 GLN GLN A . n A 1 150 TRP 150 130 130 TRP TRP A . n A 1 151 GLN 151 131 131 GLN GLN A . n A 1 152 MET 152 132 132 MET MET A . n A 1 153 GLN 153 133 133 GLN GLN A . n A 1 154 HIS 154 134 134 HIS HIS A . n A 1 155 HIS 155 135 135 HIS HIS A . n A 1 156 GLY 156 136 136 GLY GLY A . n A 1 157 MET 157 137 137 MET MET A . n A 1 158 ILE 158 138 138 ILE ILE A . n A 1 159 ILE 159 139 139 ILE ILE A . n A 1 160 VAL 160 140 140 VAL VAL A . n A 1 161 PRO 161 141 141 PRO PRO A . n A 1 162 LEU 162 142 142 LEU LEU A . n A 1 163 SER 163 143 143 SER SER A . n A 1 164 TYR 164 144 144 TYR TYR A . n A 1 165 ALA 165 145 ? ? ? A . n A 1 166 TYR 166 146 ? ? ? A . n A 1 167 ARG 167 147 ? ? ? A . n A 1 168 GLU 168 148 ? ? ? A . n A 1 169 GLN 169 149 ? ? ? A . n A 1 170 MET 170 150 ? ? ? A . n A 1 171 GLY 171 151 ? ? ? A . n A 1 172 ASN 172 152 ? ? ? A . n A 1 173 ASP 173 153 ? ? ? A . n A 1 174 VAL 174 154 ? ? ? A . n A 1 175 VAL 175 155 ? ? ? A . n A 1 176 ARG 176 156 ? ? ? A . n A 1 177 GLY 177 157 ? ? ? A . n A 1 178 GLY 178 158 ? ? ? A . n A 1 179 ALA 179 159 ? ? ? A . n A 1 180 PRO 180 160 ? ? ? A . n A 1 181 TYR 181 161 ? ? ? A . n A 1 182 GLY 182 162 ? ? ? A . n A 1 183 MET 183 163 ? ? ? A . n A 1 184 THR 184 164 ? ? ? A . n A 1 185 THR 185 165 ? ? ? A . n A 1 186 THR 186 166 ? ? ? A . n A 1 187 ALA 187 167 ? ? ? A . n A 1 188 ASP 188 168 ? ? ? A . n A 1 189 GLY 189 169 ? ? ? A . n A 1 190 ASP 190 170 ? ? ? A . n A 1 191 GLY 191 171 ? ? ? A . n A 1 192 SER 192 172 ? ? ? A . n A 1 193 ARG 193 173 173 ARG ARG A . n A 1 194 GLN 194 174 174 GLN GLN A . n A 1 195 PRO 195 175 175 PRO PRO A . n A 1 196 SER 196 176 176 SER SER A . n A 1 197 ALA 197 177 177 ALA ALA A . n A 1 198 GLN 198 178 178 GLN GLN A . n A 1 199 GLU 199 179 179 GLU GLU A . n A 1 200 LEU 200 180 180 LEU LEU A . n A 1 201 ASP 201 181 181 ASP ASP A . n A 1 202 GLY 202 182 182 GLY GLY A . n A 1 203 ALA 203 183 183 ALA ALA A . n A 1 204 ARG 204 184 184 ARG ARG A . n A 1 205 PHE 205 185 185 PHE PHE A . n A 1 206 GLN 206 186 186 GLN GLN A . n A 1 207 GLY 207 187 187 GLY GLY A . n A 1 208 ARG 208 188 188 ARG ARG A . n A 1 209 ARG 209 189 189 ARG ARG A . n A 1 210 VAL 210 190 190 VAL VAL A . n A 1 211 ALA 211 191 191 ALA ALA A . n A 1 212 GLU 212 192 192 GLU GLU A . n A 1 213 ILE 213 193 193 ILE ILE A . n A 1 214 THR 214 194 194 THR THR A . n A 1 215 ALA 215 195 195 ALA ALA A . n A 1 216 LYS 216 196 196 LYS LYS A . n A 1 217 LEU 217 197 197 LEU LEU A . n A 1 218 HIS 218 198 198 HIS HIS A . n A 1 219 GLY 219 199 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 201 1 SO4 SO4 A . C 3 HOH 1 301 1 HOH HOH A . C 3 HOH 2 302 2 HOH HOH A . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA tetrameric 4 2 software_defined_assembly PISA tetrameric 4 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1,2,5,6 A,B,C 2 1,2,3,4 A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 9020 ? 1 MORE -124 ? 1 'SSA (A^2)' 26630 ? 2 'ABSA (A^2)' 6780 ? 2 MORE -113 ? 2 'SSA (A^2)' 28870 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_665 -x+1,-y+1,z -1.0000000000 0.0000000000 0.0000000000 61.2800000000 0.0000000000 -1.0000000000 0.0000000000 61.2800000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 5_655 -x+1,y,-z -1.0000000000 0.0000000000 0.0000000000 61.2800000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 4 'crystal symmetry operation' 6_565 x,-y+1,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 61.2800000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 5 'crystal symmetry operation' 7_554 y,x,-z-1/2 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -64.1700000000 6 'crystal symmetry operation' 8_664 -y+1,-x+1,-z-1/2 0.0000000000 -1.0000000000 0.0000000000 61.2800000000 -1.0000000000 0.0000000000 0.0000000000 61.2800000000 0.0000000000 0.0000000000 -1.0000000000 -64.1700000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-03-09 2 'Structure model' 1 1 2016-04-20 3 'Structure model' 1 2 2017-09-27 4 'Structure model' 1 3 2019-12-11 5 'Structure model' 1 4 2023-09-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Author supporting evidence' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Author supporting evidence' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Database references' 8 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' citation 2 3 'Structure model' pdbx_audit_support 3 3 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' pdbx_audit_support 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond 7 5 'Structure model' database_2 8 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_citation.journal_id_CSD' 2 3 'Structure model' '_pdbx_audit_support.funding_organization' 3 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 4 4 'Structure model' '_pdbx_audit_support.funding_organization' 5 5 'Structure model' '_database_2.pdbx_DOI' 6 5 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 3 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 5 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 NH1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ARG _pdbx_validate_close_contact.auth_seq_id_1 37 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 ASP _pdbx_validate_close_contact.auth_seq_id_2 55 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.13 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 42 ? ? 66.93 138.14 2 1 VAL A 46 ? ? 56.49 11.76 3 1 ALA A 49 ? ? -64.02 -91.04 4 1 SER A 50 ? ? -66.95 -87.83 5 1 TYR A 52 ? ? -172.55 149.31 6 1 LYS A 53 ? ? -177.46 45.56 7 1 PRO A 141 ? ? -68.61 -179.58 8 1 SER A 143 ? ? -20.71 -95.69 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A VAL 42 ? CG1 ? A VAL 62 CG1 2 1 Y 1 A VAL 42 ? CG2 ? A VAL 62 CG2 3 1 Y 1 A VAL 46 ? CG1 ? A VAL 66 CG1 4 1 Y 1 A VAL 46 ? CG2 ? A VAL 66 CG2 5 1 Y 1 A LYS 48 ? CG ? A LYS 68 CG 6 1 Y 1 A LYS 48 ? CD ? A LYS 68 CD 7 1 Y 1 A LYS 48 ? CE ? A LYS 68 CE 8 1 Y 1 A LYS 48 ? NZ ? A LYS 68 NZ 9 1 Y 1 A SER 50 ? OG ? A SER 70 OG 10 1 Y 1 A HIS 51 ? CG ? A HIS 71 CG 11 1 Y 1 A HIS 51 ? ND1 ? A HIS 71 ND1 12 1 Y 1 A HIS 51 ? CD2 ? A HIS 71 CD2 13 1 Y 1 A HIS 51 ? CE1 ? A HIS 71 CE1 14 1 Y 1 A HIS 51 ? NE2 ? A HIS 71 NE2 15 1 Y 1 A TYR 52 ? CG ? A TYR 72 CG 16 1 Y 1 A TYR 52 ? CD1 ? A TYR 72 CD1 17 1 Y 1 A TYR 52 ? CD2 ? A TYR 72 CD2 18 1 Y 1 A TYR 52 ? CE1 ? A TYR 72 CE1 19 1 Y 1 A TYR 52 ? CE2 ? A TYR 72 CE2 20 1 Y 1 A TYR 52 ? CZ ? A TYR 72 CZ 21 1 Y 1 A TYR 52 ? OH ? A TYR 72 OH 22 1 Y 1 A LYS 53 ? CG ? A LYS 73 CG 23 1 Y 1 A LYS 53 ? CD ? A LYS 73 CD 24 1 Y 1 A LYS 53 ? CE ? A LYS 73 CE 25 1 Y 1 A LYS 53 ? NZ ? A LYS 73 NZ 26 1 Y 1 A MET 82 ? CG ? A MET 102 CG 27 1 Y 1 A MET 82 ? SD ? A MET 102 SD 28 1 Y 1 A MET 82 ? CE ? A MET 102 CE 29 1 Y 1 A HIS 134 ? CG ? A HIS 154 CG 30 1 Y 1 A HIS 134 ? ND1 ? A HIS 154 ND1 31 1 Y 1 A HIS 134 ? CD2 ? A HIS 154 CD2 32 1 Y 1 A HIS 134 ? CE1 ? A HIS 154 CE1 33 1 Y 1 A HIS 134 ? NE2 ? A HIS 154 NE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -19 ? A MET 1 2 1 Y 1 A GLY -18 ? A GLY 2 3 1 Y 1 A SER -17 ? A SER 3 4 1 Y 1 A SER -16 ? A SER 4 5 1 Y 1 A HIS -15 ? A HIS 5 6 1 Y 1 A HIS -14 ? A HIS 6 7 1 Y 1 A HIS -13 ? A HIS 7 8 1 Y 1 A HIS -12 ? A HIS 8 9 1 Y 1 A HIS -11 ? A HIS 9 10 1 Y 1 A HIS -10 ? A HIS 10 11 1 Y 1 A SER -9 ? A SER 11 12 1 Y 1 A SER -8 ? A SER 12 13 1 Y 1 A GLY -7 ? A GLY 13 14 1 Y 1 A LEU -6 ? A LEU 14 15 1 Y 1 A VAL -5 ? A VAL 15 16 1 Y 1 A PRO -4 ? A PRO 16 17 1 Y 1 A ARG -3 ? A ARG 17 18 1 Y 1 A GLY -2 ? A GLY 18 19 1 Y 1 A SER -1 ? A SER 19 20 1 Y 1 A HIS 0 ? A HIS 20 21 1 Y 1 A ALA 115 ? A ALA 135 22 1 Y 1 A THR 116 ? A THR 136 23 1 Y 1 A GLN 117 ? A GLN 137 24 1 Y 1 A HIS 118 ? A HIS 138 25 1 Y 1 A GLY 119 ? A GLY 139 26 1 Y 1 A ALA 145 ? A ALA 165 27 1 Y 1 A TYR 146 ? A TYR 166 28 1 Y 1 A ARG 147 ? A ARG 167 29 1 Y 1 A GLU 148 ? A GLU 168 30 1 Y 1 A GLN 149 ? A GLN 169 31 1 Y 1 A MET 150 ? A MET 170 32 1 Y 1 A GLY 151 ? A GLY 171 33 1 Y 1 A ASN 152 ? A ASN 172 34 1 Y 1 A ASP 153 ? A ASP 173 35 1 Y 1 A VAL 154 ? A VAL 174 36 1 Y 1 A VAL 155 ? A VAL 175 37 1 Y 1 A ARG 156 ? A ARG 176 38 1 Y 1 A GLY 157 ? A GLY 177 39 1 Y 1 A GLY 158 ? A GLY 178 40 1 Y 1 A ALA 159 ? A ALA 179 41 1 Y 1 A PRO 160 ? A PRO 180 42 1 Y 1 A TYR 161 ? A TYR 181 43 1 Y 1 A GLY 162 ? A GLY 182 44 1 Y 1 A MET 163 ? A MET 183 45 1 Y 1 A THR 164 ? A THR 184 46 1 Y 1 A THR 165 ? A THR 185 47 1 Y 1 A THR 166 ? A THR 186 48 1 Y 1 A ALA 167 ? A ALA 187 49 1 Y 1 A ASP 168 ? A ASP 188 50 1 Y 1 A GLY 169 ? A GLY 189 51 1 Y 1 A ASP 170 ? A ASP 190 52 1 Y 1 A GLY 171 ? A GLY 191 53 1 Y 1 A SER 172 ? A SER 192 54 1 Y 1 A GLY 199 ? A GLY 219 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 PHE N N N N 236 PHE CA C N S 237 PHE C C N N 238 PHE O O N N 239 PHE CB C N N 240 PHE CG C Y N 241 PHE CD1 C Y N 242 PHE CD2 C Y N 243 PHE CE1 C Y N 244 PHE CE2 C Y N 245 PHE CZ C Y N 246 PHE OXT O N N 247 PHE H H N N 248 PHE H2 H N N 249 PHE HA H N N 250 PHE HB2 H N N 251 PHE HB3 H N N 252 PHE HD1 H N N 253 PHE HD2 H N N 254 PHE HE1 H N N 255 PHE HE2 H N N 256 PHE HZ H N N 257 PHE HXT H N N 258 PRO N N N N 259 PRO CA C N S 260 PRO C C N N 261 PRO O O N N 262 PRO CB C N N 263 PRO CG C N N 264 PRO CD C N N 265 PRO OXT O N N 266 PRO H H N N 267 PRO HA H N N 268 PRO HB2 H N N 269 PRO HB3 H N N 270 PRO HG2 H N N 271 PRO HG3 H N N 272 PRO HD2 H N N 273 PRO HD3 H N N 274 PRO HXT H N N 275 SER N N N N 276 SER CA C N S 277 SER C C N N 278 SER O O N N 279 SER CB C N N 280 SER OG O N N 281 SER OXT O N N 282 SER H H N N 283 SER H2 H N N 284 SER HA H N N 285 SER HB2 H N N 286 SER HB3 H N N 287 SER HG H N N 288 SER HXT H N N 289 SO4 S S N N 290 SO4 O1 O N N 291 SO4 O2 O N N 292 SO4 O3 O N N 293 SO4 O4 O N N 294 THR N N N N 295 THR CA C N S 296 THR C C N N 297 THR O O N N 298 THR CB C N R 299 THR OG1 O N N 300 THR CG2 C N N 301 THR OXT O N N 302 THR H H N N 303 THR H2 H N N 304 THR HA H N N 305 THR HB H N N 306 THR HG1 H N N 307 THR HG21 H N N 308 THR HG22 H N N 309 THR HG23 H N N 310 THR HXT H N N 311 TRP N N N N 312 TRP CA C N S 313 TRP C C N N 314 TRP O O N N 315 TRP CB C N N 316 TRP CG C Y N 317 TRP CD1 C Y N 318 TRP CD2 C Y N 319 TRP NE1 N Y N 320 TRP CE2 C Y N 321 TRP CE3 C Y N 322 TRP CZ2 C Y N 323 TRP CZ3 C Y N 324 TRP CH2 C Y N 325 TRP OXT O N N 326 TRP H H N N 327 TRP H2 H N N 328 TRP HA H N N 329 TRP HB2 H N N 330 TRP HB3 H N N 331 TRP HD1 H N N 332 TRP HE1 H N N 333 TRP HE3 H N N 334 TRP HZ2 H N N 335 TRP HZ3 H N N 336 TRP HH2 H N N 337 TRP HXT H N N 338 TYR N N N N 339 TYR CA C N S 340 TYR C C N N 341 TYR O O N N 342 TYR CB C N N 343 TYR CG C Y N 344 TYR CD1 C Y N 345 TYR CD2 C Y N 346 TYR CE1 C Y N 347 TYR CE2 C Y N 348 TYR CZ C Y N 349 TYR OH O N N 350 TYR OXT O N N 351 TYR H H N N 352 TYR H2 H N N 353 TYR HA H N N 354 TYR HB2 H N N 355 TYR HB3 H N N 356 TYR HD1 H N N 357 TYR HD2 H N N 358 TYR HE1 H N N 359 TYR HE2 H N N 360 TYR HH H N N 361 TYR HXT H N N 362 VAL N N N N 363 VAL CA C N S 364 VAL C C N N 365 VAL O O N N 366 VAL CB C N N 367 VAL CG1 C N N 368 VAL CG2 C N N 369 VAL OXT O N N 370 VAL H H N N 371 VAL H2 H N N 372 VAL HA H N N 373 VAL HB H N N 374 VAL HG11 H N N 375 VAL HG12 H N N 376 VAL HG13 H N N 377 VAL HG21 H N N 378 VAL HG22 H N N 379 VAL HG23 H N N 380 VAL HXT H N N 381 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 SO4 S O1 doub N N 277 SO4 S O2 doub N N 278 SO4 S O3 sing N N 279 SO4 S O4 sing N N 280 THR N CA sing N N 281 THR N H sing N N 282 THR N H2 sing N N 283 THR CA C sing N N 284 THR CA CB sing N N 285 THR CA HA sing N N 286 THR C O doub N N 287 THR C OXT sing N N 288 THR CB OG1 sing N N 289 THR CB CG2 sing N N 290 THR CB HB sing N N 291 THR OG1 HG1 sing N N 292 THR CG2 HG21 sing N N 293 THR CG2 HG22 sing N N 294 THR CG2 HG23 sing N N 295 THR OXT HXT sing N N 296 TRP N CA sing N N 297 TRP N H sing N N 298 TRP N H2 sing N N 299 TRP CA C sing N N 300 TRP CA CB sing N N 301 TRP CA HA sing N N 302 TRP C O doub N N 303 TRP C OXT sing N N 304 TRP CB CG sing N N 305 TRP CB HB2 sing N N 306 TRP CB HB3 sing N N 307 TRP CG CD1 doub Y N 308 TRP CG CD2 sing Y N 309 TRP CD1 NE1 sing Y N 310 TRP CD1 HD1 sing N N 311 TRP CD2 CE2 doub Y N 312 TRP CD2 CE3 sing Y N 313 TRP NE1 CE2 sing Y N 314 TRP NE1 HE1 sing N N 315 TRP CE2 CZ2 sing Y N 316 TRP CE3 CZ3 doub Y N 317 TRP CE3 HE3 sing N N 318 TRP CZ2 CH2 doub Y N 319 TRP CZ2 HZ2 sing N N 320 TRP CZ3 CH2 sing Y N 321 TRP CZ3 HZ3 sing N N 322 TRP CH2 HH2 sing N N 323 TRP OXT HXT sing N N 324 TYR N CA sing N N 325 TYR N H sing N N 326 TYR N H2 sing N N 327 TYR CA C sing N N 328 TYR CA CB sing N N 329 TYR CA HA sing N N 330 TYR C O doub N N 331 TYR C OXT sing N N 332 TYR CB CG sing N N 333 TYR CB HB2 sing N N 334 TYR CB HB3 sing N N 335 TYR CG CD1 doub Y N 336 TYR CG CD2 sing Y N 337 TYR CD1 CE1 sing Y N 338 TYR CD1 HD1 sing N N 339 TYR CD2 CE2 doub Y N 340 TYR CD2 HD2 sing N N 341 TYR CE1 CZ doub Y N 342 TYR CE1 HE1 sing N N 343 TYR CE2 CZ sing Y N 344 TYR CE2 HE2 sing N N 345 TYR CZ OH sing N N 346 TYR OH HH sing N N 347 TYR OXT HXT sing N N 348 VAL N CA sing N N 349 VAL N H sing N N 350 VAL N H2 sing N N 351 VAL CA C sing N N 352 VAL CA CB sing N N 353 VAL CA HA sing N N 354 VAL C O doub N N 355 VAL C OXT sing N N 356 VAL CB CG1 sing N N 357 VAL CB CG2 sing N N 358 VAL CB HB sing N N 359 VAL CG1 HG11 sing N N 360 VAL CG1 HG12 sing N N 361 VAL CG1 HG13 sing N N 362 VAL CG2 HG21 sing N N 363 VAL CG2 HG22 sing N N 364 VAL CG2 HG23 sing N N 365 VAL OXT HXT sing N N 366 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' U19AI107792 1 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' R01AI107159 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3B6I _pdbx_initial_refinement_model.details ? #