data_5FDD # _entry.id 5FDD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5FDD pdb_00005fdd 10.2210/pdb5fdd/pdb WWPDB D_1000216404 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB ;4ZHZ contains the same protein and ligand. The difference is the pH under which crystals were soaked with the ligand solution. 4ZHZ was pH 5.8 while this entry was pH 7.0. ; 4ZHZ unspecified PDB . 5FDE unspecified PDB . 5FDG unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5FDD _pdbx_database_status.recvd_initial_deposition_date 2015-12-16 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Fudo, S.' 1 'Yamamoto, N.' 2 'Nukaga, M.' 3 'Odagiri, T.' 4 'Tashiro, M.' 5 'Hoshino, T.' 6 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochemistry _citation.journal_id_ASTM BICHAW _citation.journal_id_CSD 0033 _citation.journal_id_ISSN 0006-2960 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 55 _citation.language ? _citation.page_first 2646 _citation.page_last 2660 _citation.title 'Two Distinctive Binding Modes of Endonuclease Inhibitors to the N-Terminal Region of Influenza Virus Polymerase Acidic Subunit' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.biochem.5b01087 _citation.pdbx_database_id_PubMed 27088785 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Fudo, S.' 1 ? primary 'Yamamoto, N.' 2 ? primary 'Nukaga, M.' 3 ? primary 'Odagiri, T.' 4 ? primary 'Tashiro, M.' 5 ? primary 'Hoshino, T.' 6 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5FDD _cell.details ? _cell.formula_units_Z ? _cell.length_a 66.397 _cell.length_a_esd ? _cell.length_b 66.397 _cell.length_b_esd ? _cell.length_c 127.392 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5FDD _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Polymerase acidic protein,Polymerase acidic protein' 22300.494 1 ? ? 'endonuclease, residues 1-50, 73-196' ? 2 non-polymer syn '5-(2-chlorobenzyl)-2-hydroxy-3-nitrobenzaldehyde' 291.687 1 ? ? ? ? 3 non-polymer syn 'MANGANESE (II) ION' 54.938 1 ? ? ? ? 4 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 5 water nat water 18.015 23 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'RNA-directed RNA polymerase subunit P2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPLGSMEDFVRQCFNPMIVELAEKTMKEYGEDLKIETNKFAAICTHLEVCFMYSDASKHRFEIIEGRDRTMAWTVVNSIC NTTGAEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRL FTIRQEMASRGLWDSFRQSERGAAELALVPR ; _entity_poly.pdbx_seq_one_letter_code_can ;GPLGSMEDFVRQCFNPMIVELAEKTMKEYGEDLKIETNKFAAICTHLEVCFMYSDASKHRFEIIEGRDRTMAWTVVNSIC NTTGAEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRL FTIRQEMASRGLWDSFRQSERGAAELALVPR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 LEU n 1 4 GLY n 1 5 SER n 1 6 MET n 1 7 GLU n 1 8 ASP n 1 9 PHE n 1 10 VAL n 1 11 ARG n 1 12 GLN n 1 13 CYS n 1 14 PHE n 1 15 ASN n 1 16 PRO n 1 17 MET n 1 18 ILE n 1 19 VAL n 1 20 GLU n 1 21 LEU n 1 22 ALA n 1 23 GLU n 1 24 LYS n 1 25 THR n 1 26 MET n 1 27 LYS n 1 28 GLU n 1 29 TYR n 1 30 GLY n 1 31 GLU n 1 32 ASP n 1 33 LEU n 1 34 LYS n 1 35 ILE n 1 36 GLU n 1 37 THR n 1 38 ASN n 1 39 LYS n 1 40 PHE n 1 41 ALA n 1 42 ALA n 1 43 ILE n 1 44 CYS n 1 45 THR n 1 46 HIS n 1 47 LEU n 1 48 GLU n 1 49 VAL n 1 50 CYS n 1 51 PHE n 1 52 MET n 1 53 TYR n 1 54 SER n 1 55 ASP n 1 56 ALA n 1 57 SER n 1 58 LYS n 1 59 HIS n 1 60 ARG n 1 61 PHE n 1 62 GLU n 1 63 ILE n 1 64 ILE n 1 65 GLU n 1 66 GLY n 1 67 ARG n 1 68 ASP n 1 69 ARG n 1 70 THR n 1 71 MET n 1 72 ALA n 1 73 TRP n 1 74 THR n 1 75 VAL n 1 76 VAL n 1 77 ASN n 1 78 SER n 1 79 ILE n 1 80 CYS n 1 81 ASN n 1 82 THR n 1 83 THR n 1 84 GLY n 1 85 ALA n 1 86 GLU n 1 87 LYS n 1 88 PRO n 1 89 LYS n 1 90 PHE n 1 91 LEU n 1 92 PRO n 1 93 ASP n 1 94 LEU n 1 95 TYR n 1 96 ASP n 1 97 TYR n 1 98 LYS n 1 99 GLU n 1 100 ASN n 1 101 ARG n 1 102 PHE n 1 103 ILE n 1 104 GLU n 1 105 ILE n 1 106 GLY n 1 107 VAL n 1 108 THR n 1 109 ARG n 1 110 ARG n 1 111 GLU n 1 112 VAL n 1 113 HIS n 1 114 ILE n 1 115 TYR n 1 116 TYR n 1 117 LEU n 1 118 GLU n 1 119 LYS n 1 120 ALA n 1 121 ASN n 1 122 LYS n 1 123 ILE n 1 124 LYS n 1 125 SER n 1 126 GLU n 1 127 LYS n 1 128 THR n 1 129 HIS n 1 130 ILE n 1 131 HIS n 1 132 ILE n 1 133 PHE n 1 134 SER n 1 135 PHE n 1 136 THR n 1 137 GLY n 1 138 GLU n 1 139 GLU n 1 140 MET n 1 141 ALA n 1 142 THR n 1 143 LYS n 1 144 ALA n 1 145 ASP n 1 146 TYR n 1 147 THR n 1 148 LEU n 1 149 ASP n 1 150 GLU n 1 151 GLU n 1 152 SER n 1 153 ARG n 1 154 ALA n 1 155 ARG n 1 156 ILE n 1 157 LYS n 1 158 THR n 1 159 ARG n 1 160 LEU n 1 161 PHE n 1 162 THR n 1 163 ILE n 1 164 ARG n 1 165 GLN n 1 166 GLU n 1 167 MET n 1 168 ALA n 1 169 SER n 1 170 ARG n 1 171 GLY n 1 172 LEU n 1 173 TRP n 1 174 ASP n 1 175 SER n 1 176 PHE n 1 177 ARG n 1 178 GLN n 1 179 SER n 1 180 GLU n 1 181 ARG n 1 182 GLY n 1 183 ALA n 1 184 ALA n 1 185 GLU n 1 186 LEU n 1 187 ALA n 1 188 LEU n 1 189 VAL n 1 190 PRO n 1 191 ARG n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 57 ? ? PA ? 'A/Puerto Rico/8/1934 H1N1' ? ? ? ? 'Influenza A virus' 211044 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 'Rosetta (DE3) pLysS' ? ? ? ? ? ? ? plasmid ? ? ? 'pET50b(+)' ? ? 1 2 sample 'Biological sequence' 58 191 ? ? PA ? 'A/Puerto Rico/8/1934 H1N1' ? ? ? ? 'Influenza A virus' 211044 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 'Rosetta (DE3) pLysS' ? ? ? ? ? ? ? plasmid ? ? ? 'pET50b(+)' ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP PA_I34A1 P03433 ? 1 MEDFVRQCFNPMIVELAEKTMKEYGEDLKIETNKFAAICTHLEVCFMYSD 1 2 UNP PA_I34A1 P03433 ? 1 ;KHRFEIIEGRDRTMAWTVVNSICNTTGAEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTG EEMATKADYTLDEESRARIKTRLFTIRQEMASRGLWDSFRQSERG ; 73 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5FDD A 6 ? 55 ? P03433 1 ? 50 ? 6 55 2 2 5FDD A 58 ? 182 ? P03433 73 ? 197 ? 58 182 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5FDD GLY A 1 ? UNP P03433 ? ? 'expression tag' 1 1 1 5FDD PRO A 2 ? UNP P03433 ? ? 'expression tag' 2 2 1 5FDD LEU A 3 ? UNP P03433 ? ? 'expression tag' 3 3 1 5FDD GLY A 4 ? UNP P03433 ? ? 'expression tag' 4 4 1 5FDD SER A 5 ? UNP P03433 ? ? 'expression tag' 5 5 1 5FDD ALA A 56 ? UNP P03433 ? ? linker 56 6 1 5FDD SER A 57 ? UNP P03433 ? ? linker 57 7 2 5FDD ALA A 183 ? UNP P03433 ? ? 'expression tag' 183 8 2 5FDD ALA A 184 ? UNP P03433 ? ? 'expression tag' 184 9 2 5FDD GLU A 185 ? UNP P03433 ? ? 'expression tag' 185 10 2 5FDD LEU A 186 ? UNP P03433 ? ? 'expression tag' 186 11 2 5FDD ALA A 187 ? UNP P03433 ? ? 'expression tag' 187 12 2 5FDD LEU A 188 ? UNP P03433 ? ? 'expression tag' 188 13 2 5FDD VAL A 189 ? UNP P03433 ? ? 'expression tag' 189 14 2 5FDD PRO A 190 ? UNP P03433 ? ? 'expression tag' 190 15 2 5FDD ARG A 191 ? UNP P03433 ? ? 'expression tag' 191 16 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 4P8 non-polymer . '5-(2-chlorobenzyl)-2-hydroxy-3-nitrobenzaldehyde' ? 'C14 H10 Cl N O4' 291.687 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MN non-polymer . 'MANGANESE (II) ION' ? 'Mn 2' 54.938 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5FDD _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.15 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 60.93 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;Crystals were grown with the reservoir containing 100 mM MES, 1.1 M ammonium sulfate, 0.1 M potassium chloride and 9 % trehalose at pH 5.8. Crystal was then soaked with the ligand solution at pH 7.0. ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 270' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-12-05 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Numerical link type Si(111) double crystal monochromator, liquid nitrogen cooled' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.98 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PHOTON FACTORY BEAMLINE BL-17A' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.98 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL-17A _diffrn_source.pdbx_synchrotron_site 'Photon Factory' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5FDD _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.500 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10401 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 11.300 _reflns.pdbx_Rmerge_I_obs 0.152 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI 18.628 _reflns.pdbx_netI_over_sigmaI 9.100 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.020 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.160 _reflns.pdbx_Rpim_I_all 0.047 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 117975 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.500 2.540 ? ? ? ? ? 504 ? 100.000 ? ? ? ? 1.195 ? ? ? ? ? ? ? ? 8.800 ? 0.996 ? ? 1.270 0.422 0 1 1 0.807 ? 2.540 2.590 ? ? ? ? ? 495 ? 99.800 ? ? ? ? 1.055 ? ? ? ? ? ? ? ? 9.800 ? 1.010 ? ? 1.113 0.350 0 2 1 0.896 ? 2.590 2.640 ? ? ? ? ? 514 ? 100.000 ? ? ? ? 1.051 ? ? ? ? ? ? ? ? 10.400 ? 0.981 ? ? 1.105 0.337 0 3 1 0.895 ? 2.640 2.690 ? ? ? ? ? 495 ? 100.000 ? ? ? ? 1.008 ? ? ? ? ? ? ? ? 10.900 ? 1.024 ? ? 1.058 0.316 0 4 1 0.880 ? 2.690 2.750 ? ? ? ? ? 518 ? 100.000 ? ? ? ? 0.858 ? ? ? ? ? ? ? ? 12.200 ? 1.032 ? ? 0.895 0.252 0 5 1 0.937 ? 2.750 2.820 ? ? ? ? ? 497 ? 100.000 ? ? ? ? 0.769 ? ? ? ? ? ? ? ? 12.000 ? 1.042 ? ? 0.803 0.229 0 6 1 0.931 ? 2.820 2.890 ? ? ? ? ? 515 ? 100.000 ? ? ? ? 0.655 ? ? ? ? ? ? ? ? 12.600 ? 1.044 ? ? 0.683 0.189 0 7 1 0.967 ? 2.890 2.960 ? ? ? ? ? 501 ? 100.000 ? ? ? ? 0.485 ? ? ? ? ? ? ? ? 12.900 ? 1.032 ? ? 0.505 0.138 0 8 1 0.978 ? 2.960 3.050 ? ? ? ? ? 506 ? 100.000 ? ? ? ? 0.388 ? ? ? ? ? ? ? ? 12.800 ? 1.031 ? ? 0.404 0.111 0 9 1 0.977 ? 3.050 3.150 ? ? ? ? ? 522 ? 100.000 ? ? ? ? 0.350 ? ? ? ? ? ? ? ? 12.400 ? 1.043 ? ? 0.365 0.102 0 10 1 0.979 ? 3.150 3.260 ? ? ? ? ? 509 ? 100.000 ? ? ? ? 0.278 ? ? ? ? ? ? ? ? 11.800 ? 1.014 ? ? 0.291 0.084 0 11 1 0.981 ? 3.260 3.390 ? ? ? ? ? 509 ? 100.000 ? ? ? ? 0.209 ? ? ? ? ? ? ? ? 12.100 ? 1.035 ? ? 0.218 0.062 0 12 1 0.989 ? 3.390 3.550 ? ? ? ? ? 521 ? 100.000 ? ? ? ? 0.171 ? ? ? ? ? ? ? ? 11.600 ? 1.044 ? ? 0.179 0.053 0 13 1 0.990 ? 3.550 3.730 ? ? ? ? ? 512 ? 99.800 ? ? ? ? 0.140 ? ? ? ? ? ? ? ? 12.200 ? 1.028 ? ? 0.147 0.042 0 14 1 0.995 ? 3.730 3.970 ? ? ? ? ? 521 ? 100.000 ? ? ? ? 0.112 ? ? ? ? ? ? ? ? 11.700 ? 1.045 ? ? 0.117 0.035 0 15 1 0.994 ? 3.970 4.270 ? ? ? ? ? 529 ? 99.800 ? ? ? ? 0.089 ? ? ? ? ? ? ? ? 10.800 ? 0.975 ? ? 0.094 0.029 0 16 1 0.997 ? 4.270 4.700 ? ? ? ? ? 533 ? 100.000 ? ? ? ? 0.082 ? ? ? ? ? ? ? ? 10.800 ? 0.997 ? ? 0.087 0.027 0 17 1 0.995 ? 4.700 5.380 ? ? ? ? ? 536 ? 100.000 ? ? ? ? 0.079 ? ? ? ? ? ? ? ? 11.300 ? 0.995 ? ? 0.083 0.024 0 18 1 0.997 ? 5.380 6.780 ? ? ? ? ? 555 ? 99.800 ? ? ? ? 0.086 ? ? ? ? ? ? ? ? 10.700 ? 0.992 ? ? 0.091 0.028 0 19 1 0.995 ? 6.780 50.000 ? ? ? ? ? 609 ? 99.200 ? ? ? ? 0.089 ? ? ? ? ? ? ? ? 9.300 ? 1.022 ? ? 0.094 0.030 0 20 1 0.995 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 132.140 _refine.B_iso_mean 59.3400 _refine.B_iso_min 26.350 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5FDD _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.5060 _refine.ls_d_res_low 37.7930 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10350 _refine.ls_number_reflns_R_free 550 _refine.ls_number_reflns_R_work 9800 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.8900 _refine.ls_percent_reflns_R_free 5.3100 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2024 _refine.ls_R_factor_R_free 0.2318 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2007 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4ZQQ _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 24.7500 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2200 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set 0.8073 _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.5060 _refine_hist.d_res_low 37.7930 _refine_hist.pdbx_number_atoms_ligand 26 _refine_hist.number_atoms_solvent 23 _refine_hist.number_atoms_total 1542 _refine_hist.pdbx_number_residues_total 181 _refine_hist.pdbx_B_iso_mean_ligand 96.54 _refine_hist.pdbx_B_iso_mean_solvent 54.75 _refine_hist.pdbx_number_atoms_protein 1493 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 ? 1548 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.794 ? 2079 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.059 ? 218 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 265 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 13.054 ? 585 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.5058 2.7579 2522 . 140 2382 100.0000 . . . 0.3190 . 0.2459 . . . . . . 4 . . . 'X-RAY DIFFRACTION' 2.7579 3.1569 2533 . 129 2404 100.0000 . . . 0.3217 . 0.2361 . . . . . . 4 . . . 'X-RAY DIFFRACTION' 3.1569 3.9766 2564 . 129 2435 100.0000 . . . 0.2332 . 0.1939 . . . . . . 4 . . . 'X-RAY DIFFRACTION' 3.9766 37.7970 2731 . 152 2579 100.0000 . . . 0.1933 . 0.1858 . . . . . . 4 . . . # _struct.entry_id 5FDD _struct.title 'Endonuclease inhibitor 1 bound to influenza strain H1N1 polymerase acidic subunit N-terminal region at pH 7.0' _struct.pdbx_model_details 'RNA binding protein' _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5FDD _struct_keywords.text 'Hydrolase/Inhibitor, HYDROLASE-HYDROLASE INHIBITOR complex' _struct_keywords.pdbx_keywords 'HYDROLASE/HYDROLASE INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 5 ? PHE A 14 ? SER A 5 PHE A 14 1 ? 10 HELX_P HELX_P2 AA2 ASN A 15 ? TYR A 29 ? ASN A 15 TYR A 29 1 ? 15 HELX_P HELX_P3 AA3 GLU A 36 ? ALA A 56 ? GLU A 36 ALA A 56 1 ? 21 HELX_P HELX_P4 AA4 ASP A 68 ? GLY A 84 ? ASP A 68 GLY A 84 1 ? 17 HELX_P HELX_P5 AA5 GLU A 111 ? LYS A 124 ? GLU A 111 LYS A 124 1 ? 14 HELX_P HELX_P6 AA6 LYS A 143 ? ASP A 145 ? LYS A 143 ASP A 145 5 ? 3 HELX_P HELX_P7 AA7 ASP A 149 ? ARG A 170 ? ASP A 149 ARG A 170 1 ? 22 HELX_P HELX_P8 AA8 LEU A 172 ? SER A 179 ? LEU A 172 SER A 179 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id metalc1 _struct_conn.conn_type_id metalc _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id ASP _struct_conn.ptnr1_label_seq_id 93 _struct_conn.ptnr1_label_atom_id OD1 _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id C _struct_conn.ptnr2_label_comp_id MN _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id MN _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id ASP _struct_conn.ptnr1_auth_seq_id 93 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id MN _struct_conn.ptnr2_auth_seq_id 202 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.487 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 61 ? ILE A 63 ? PHE A 61 ILE A 63 AA1 2 LEU A 94 ? ASP A 96 ? LEU A 94 ASP A 96 AA1 3 ARG A 101 ? THR A 108 ? ARG A 101 THR A 108 AA1 4 HIS A 129 ? SER A 134 ? HIS A 129 SER A 134 AA1 5 GLU A 139 ? ALA A 141 ? GLU A 139 ALA A 141 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 62 ? N GLU A 62 O TYR A 95 ? O TYR A 95 AA1 2 3 N LEU A 94 ? N LEU A 94 O ILE A 103 ? O ILE A 103 AA1 3 4 N PHE A 102 ? N PHE A 102 O HIS A 129 ? O HIS A 129 AA1 4 5 N ILE A 132 ? N ILE A 132 O MET A 140 ? O MET A 140 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A 4P8 201 ? 8 'binding site for residue 4P8 A 201' AC2 Software A MN 202 ? 4 'binding site for residue MN A 202' AC3 Software A SO4 203 ? 3 'binding site for residue SO4 A 203' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 8 TYR A 29 ? TYR A 29 . ? 1_555 ? 2 AC1 8 HIS A 46 ? HIS A 46 . ? 1_555 ? 3 AC1 8 GLU A 65 ? GLU A 65 . ? 1_555 ? 4 AC1 8 GLU A 104 ? GLU A 104 . ? 1_555 ? 5 AC1 8 TYR A 115 ? TYR A 115 . ? 1_555 ? 6 AC1 8 LYS A 119 ? LYS A 119 . ? 1_555 ? 7 AC1 8 MN C . ? MN A 202 . ? 1_555 ? 8 AC1 8 HOH E . ? HOH A 301 . ? 1_555 ? 9 AC2 4 GLU A 65 ? GLU A 65 . ? 1_555 ? 10 AC2 4 LEU A 91 ? LEU A 91 . ? 1_555 ? 11 AC2 4 ASP A 93 ? ASP A 93 . ? 1_555 ? 12 AC2 4 4P8 B . ? 4P8 A 201 . ? 1_555 ? 13 AC3 3 ARG A 164 ? ARG A 164 . ? 1_555 ? 14 AC3 3 TRP A 173 ? TRP A 173 . ? 1_555 ? 15 AC3 3 ARG A 177 ? ARG A 177 . ? 1_555 ? # _atom_sites.entry_id 5FDD _atom_sites.fract_transf_matrix[1][1] 0.015061 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015061 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007850 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CL MN N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 MET 6 6 6 MET MET A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 CYS 13 13 13 CYS CYS A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 MET 17 17 17 MET MET A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 MET 26 26 26 MET MET A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 CYS 44 44 44 CYS CYS A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 HIS 46 46 46 HIS HIS A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 CYS 50 50 50 CYS CYS A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 MET 52 52 52 MET MET A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 HIS 59 59 59 HIS HIS A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 MET 71 71 71 MET MET A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 TRP 73 73 73 TRP TRP A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 ASN 77 77 77 ASN ASN A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 CYS 80 80 80 CYS CYS A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 PHE 90 90 90 PHE PHE A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 ASP 93 93 93 ASP ASP A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 TYR 95 95 95 TYR TYR A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 TYR 97 97 97 TYR TYR A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 ASN 100 100 100 ASN ASN A . n A 1 101 ARG 101 101 101 ARG ARG A . n A 1 102 PHE 102 102 102 PHE PHE A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 ILE 105 105 105 ILE ILE A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 THR 108 108 108 THR THR A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 ARG 110 110 110 ARG ARG A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 HIS 113 113 113 HIS HIS A . n A 1 114 ILE 114 114 114 ILE ILE A . n A 1 115 TYR 115 115 115 TYR TYR A . n A 1 116 TYR 116 116 116 TYR TYR A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 ASN 121 121 121 ASN ASN A . n A 1 122 LYS 122 122 122 LYS LYS A . n A 1 123 ILE 123 123 123 ILE ILE A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 SER 125 125 125 SER SER A . n A 1 126 GLU 126 126 126 GLU GLU A . n A 1 127 LYS 127 127 127 LYS LYS A . n A 1 128 THR 128 128 128 THR THR A . n A 1 129 HIS 129 129 129 HIS HIS A . n A 1 130 ILE 130 130 130 ILE ILE A . n A 1 131 HIS 131 131 131 HIS HIS A . n A 1 132 ILE 132 132 132 ILE ILE A . n A 1 133 PHE 133 133 133 PHE PHE A . n A 1 134 SER 134 134 134 SER SER A . n A 1 135 PHE 135 135 135 PHE PHE A . n A 1 136 THR 136 136 136 THR THR A . n A 1 137 GLY 137 137 137 GLY GLY A . n A 1 138 GLU 138 138 138 GLU GLU A . n A 1 139 GLU 139 139 139 GLU GLU A . n A 1 140 MET 140 140 140 MET MET A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 THR 142 142 142 THR THR A . n A 1 143 LYS 143 143 143 LYS LYS A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 TYR 146 146 146 TYR TYR A . n A 1 147 THR 147 147 147 THR THR A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 ASP 149 149 149 ASP ASP A . n A 1 150 GLU 150 150 150 GLU GLU A . n A 1 151 GLU 151 151 151 GLU GLU A . n A 1 152 SER 152 152 152 SER SER A . n A 1 153 ARG 153 153 153 ARG ARG A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 ARG 155 155 155 ARG ARG A . n A 1 156 ILE 156 156 156 ILE ILE A . n A 1 157 LYS 157 157 157 LYS LYS A . n A 1 158 THR 158 158 158 THR THR A . n A 1 159 ARG 159 159 159 ARG ARG A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 PHE 161 161 161 PHE PHE A . n A 1 162 THR 162 162 162 THR THR A . n A 1 163 ILE 163 163 163 ILE ILE A . n A 1 164 ARG 164 164 164 ARG ARG A . n A 1 165 GLN 165 165 165 GLN GLN A . n A 1 166 GLU 166 166 166 GLU GLU A . n A 1 167 MET 167 167 167 MET MET A . n A 1 168 ALA 168 168 168 ALA ALA A . n A 1 169 SER 169 169 169 SER SER A . n A 1 170 ARG 170 170 170 ARG ARG A . n A 1 171 GLY 171 171 171 GLY GLY A . n A 1 172 LEU 172 172 172 LEU LEU A . n A 1 173 TRP 173 173 173 TRP TRP A . n A 1 174 ASP 174 174 174 ASP ASP A . n A 1 175 SER 175 175 175 SER SER A . n A 1 176 PHE 176 176 176 PHE PHE A . n A 1 177 ARG 177 177 177 ARG ARG A . n A 1 178 GLN 178 178 178 GLN GLN A . n A 1 179 SER 179 179 179 SER SER A . n A 1 180 GLU 180 180 180 GLU GLU A . n A 1 181 ARG 181 181 181 ARG ARG A . n A 1 182 GLY 182 182 ? ? ? A . n A 1 183 ALA 183 183 ? ? ? A . n A 1 184 ALA 184 184 ? ? ? A . n A 1 185 GLU 185 185 ? ? ? A . n A 1 186 LEU 186 186 ? ? ? A . n A 1 187 ALA 187 187 ? ? ? A . n A 1 188 LEU 188 188 ? ? ? A . n A 1 189 VAL 189 189 ? ? ? A . n A 1 190 PRO 190 190 ? ? ? A . n A 1 191 ARG 191 191 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 4P8 1 201 1 4P8 DRG A . C 3 MN 1 202 1 MN MN A . D 4 SO4 1 203 1 SO4 SO4 A . E 5 HOH 1 301 17 HOH HOH A . E 5 HOH 2 302 22 HOH HOH A . E 5 HOH 3 303 11 HOH HOH A . E 5 HOH 4 304 3 HOH HOH A . E 5 HOH 5 305 2 HOH HOH A . E 5 HOH 6 306 12 HOH HOH A . E 5 HOH 7 307 15 HOH HOH A . E 5 HOH 8 308 20 HOH HOH A . E 5 HOH 9 309 5 HOH HOH A . E 5 HOH 10 310 16 HOH HOH A . E 5 HOH 11 311 10 HOH HOH A . E 5 HOH 12 312 4 HOH HOH A . E 5 HOH 13 313 6 HOH HOH A . E 5 HOH 14 314 1 HOH HOH A . E 5 HOH 15 315 23 HOH HOH A . E 5 HOH 16 316 13 HOH HOH A . E 5 HOH 17 317 7 HOH HOH A . E 5 HOH 18 318 18 HOH HOH A . E 5 HOH 19 319 8 HOH HOH A . E 5 HOH 20 320 9 HOH HOH A . E 5 HOH 21 321 14 HOH HOH A . E 5 HOH 22 322 19 HOH HOH A . E 5 HOH 23 323 21 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 180 ? 1 MORE -12 ? 1 'SSA (A^2)' 9750 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-12-30 2 'Structure model' 1 1 2016-05-25 3 'Structure model' 1 2 2020-02-19 4 'Structure model' 1 3 2023-11-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' 7 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' citation 2 3 'Structure model' diffrn_source 3 3 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 7 4 'Structure model' diffrn_radiation_wavelength 8 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_citation.journal_id_CSD' 2 3 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 3 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 4 4 'Structure model' '_database_2.pdbx_DOI' 5 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_phasing_MR.entry_id 5FDD _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details ? _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body 0.438 _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_translation ? _pdbx_phasing_MR.d_res_low_translation ? _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 3 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 'phenix.refine: 1.8.1_1168' 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 5 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 6 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OAS A 4P8 201 ? ? O A HOH 301 ? ? 1.95 2 1 OE2 A GLU 104 ? ? O A HOH 301 ? ? 2.04 3 1 NZ A LYS 122 ? ? O A HOH 302 ? ? 2.19 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 57 ? ? -154.80 82.46 2 1 HIS A 59 ? ? 74.87 -0.35 3 1 LYS A 124 ? ? 57.36 5.01 4 1 THR A 147 ? ? 64.83 -58.44 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 182 ? A GLY 182 2 1 Y 1 A ALA 183 ? A ALA 183 3 1 Y 1 A ALA 184 ? A ALA 184 4 1 Y 1 A GLU 185 ? A GLU 185 5 1 Y 1 A LEU 186 ? A LEU 186 6 1 Y 1 A ALA 187 ? A ALA 187 7 1 Y 1 A LEU 188 ? A LEU 188 8 1 Y 1 A VAL 189 ? A VAL 189 9 1 Y 1 A PRO 190 ? A PRO 190 10 1 Y 1 A ARG 191 ? A ARG 191 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 4P8 OAP O N N 1 4P8 CAO C N N 2 4P8 CAM C Y N 3 4P8 CAK C Y N 4 4P8 CAN C Y N 5 4P8 OAQ O N N 6 4P8 CAL C Y N 7 4P8 NAR N N N 8 4P8 OAT O N N 9 4P8 OAS O N N 10 4P8 CAJ C Y N 11 4P8 CAI C Y N 12 4P8 CAH C N N 13 4P8 CAB C Y N 14 4P8 CAA C Y N 15 4P8 CLG CL N N 16 4P8 CAF C Y N 17 4P8 CAE C Y N 18 4P8 CAD C Y N 19 4P8 CAC C Y N 20 4P8 H1 H N N 21 4P8 H2 H N N 22 4P8 H3 H N N 23 4P8 H4 H N N 24 4P8 H5 H N N 25 4P8 H6 H N N 26 4P8 H7 H N N 27 4P8 H8 H N N 28 4P8 H9 H N N 29 4P8 H10 H N N 30 ALA N N N N 31 ALA CA C N S 32 ALA C C N N 33 ALA O O N N 34 ALA CB C N N 35 ALA OXT O N N 36 ALA H H N N 37 ALA H2 H N N 38 ALA HA H N N 39 ALA HB1 H N N 40 ALA HB2 H N N 41 ALA HB3 H N N 42 ALA HXT H N N 43 ARG N N N N 44 ARG CA C N S 45 ARG C C N N 46 ARG O O N N 47 ARG CB C N N 48 ARG CG C N N 49 ARG CD C N N 50 ARG NE N N N 51 ARG CZ C N N 52 ARG NH1 N N N 53 ARG NH2 N N N 54 ARG OXT O N N 55 ARG H H N N 56 ARG H2 H N N 57 ARG HA H N N 58 ARG HB2 H N N 59 ARG HB3 H N N 60 ARG HG2 H N N 61 ARG HG3 H N N 62 ARG HD2 H N N 63 ARG HD3 H N N 64 ARG HE H N N 65 ARG HH11 H N N 66 ARG HH12 H N N 67 ARG HH21 H N N 68 ARG HH22 H N N 69 ARG HXT H N N 70 ASN N N N N 71 ASN CA C N S 72 ASN C C N N 73 ASN O O N N 74 ASN CB C N N 75 ASN CG C N N 76 ASN OD1 O N N 77 ASN ND2 N N N 78 ASN OXT O N N 79 ASN H H N N 80 ASN H2 H N N 81 ASN HA H N N 82 ASN HB2 H N N 83 ASN HB3 H N N 84 ASN HD21 H N N 85 ASN HD22 H N N 86 ASN HXT H N N 87 ASP N N N N 88 ASP CA C N S 89 ASP C C N N 90 ASP O O N N 91 ASP CB C N N 92 ASP CG C N N 93 ASP OD1 O N N 94 ASP OD2 O N N 95 ASP OXT O N N 96 ASP H H N N 97 ASP H2 H N N 98 ASP HA H N N 99 ASP HB2 H N N 100 ASP HB3 H N N 101 ASP HD2 H N N 102 ASP HXT H N N 103 CYS N N N N 104 CYS CA C N R 105 CYS C C N N 106 CYS O O N N 107 CYS CB C N N 108 CYS SG S N N 109 CYS OXT O N N 110 CYS H H N N 111 CYS H2 H N N 112 CYS HA H N N 113 CYS HB2 H N N 114 CYS HB3 H N N 115 CYS HG H N N 116 CYS HXT H N N 117 GLN N N N N 118 GLN CA C N S 119 GLN C C N N 120 GLN O O N N 121 GLN CB C N N 122 GLN CG C N N 123 GLN CD C N N 124 GLN OE1 O N N 125 GLN NE2 N N N 126 GLN OXT O N N 127 GLN H H N N 128 GLN H2 H N N 129 GLN HA H N N 130 GLN HB2 H N N 131 GLN HB3 H N N 132 GLN HG2 H N N 133 GLN HG3 H N N 134 GLN HE21 H N N 135 GLN HE22 H N N 136 GLN HXT H N N 137 GLU N N N N 138 GLU CA C N S 139 GLU C C N N 140 GLU O O N N 141 GLU CB C N N 142 GLU CG C N N 143 GLU CD C N N 144 GLU OE1 O N N 145 GLU OE2 O N N 146 GLU OXT O N N 147 GLU H H N N 148 GLU H2 H N N 149 GLU HA H N N 150 GLU HB2 H N N 151 GLU HB3 H N N 152 GLU HG2 H N N 153 GLU HG3 H N N 154 GLU HE2 H N N 155 GLU HXT H N N 156 GLY N N N N 157 GLY CA C N N 158 GLY C C N N 159 GLY O O N N 160 GLY OXT O N N 161 GLY H H N N 162 GLY H2 H N N 163 GLY HA2 H N N 164 GLY HA3 H N N 165 GLY HXT H N N 166 HIS N N N N 167 HIS CA C N S 168 HIS C C N N 169 HIS O O N N 170 HIS CB C N N 171 HIS CG C Y N 172 HIS ND1 N Y N 173 HIS CD2 C Y N 174 HIS CE1 C Y N 175 HIS NE2 N Y N 176 HIS OXT O N N 177 HIS H H N N 178 HIS H2 H N N 179 HIS HA H N N 180 HIS HB2 H N N 181 HIS HB3 H N N 182 HIS HD1 H N N 183 HIS HD2 H N N 184 HIS HE1 H N N 185 HIS HE2 H N N 186 HIS HXT H N N 187 HOH O O N N 188 HOH H1 H N N 189 HOH H2 H N N 190 ILE N N N N 191 ILE CA C N S 192 ILE C C N N 193 ILE O O N N 194 ILE CB C N S 195 ILE CG1 C N N 196 ILE CG2 C N N 197 ILE CD1 C N N 198 ILE OXT O N N 199 ILE H H N N 200 ILE H2 H N N 201 ILE HA H N N 202 ILE HB H N N 203 ILE HG12 H N N 204 ILE HG13 H N N 205 ILE HG21 H N N 206 ILE HG22 H N N 207 ILE HG23 H N N 208 ILE HD11 H N N 209 ILE HD12 H N N 210 ILE HD13 H N N 211 ILE HXT H N N 212 LEU N N N N 213 LEU CA C N S 214 LEU C C N N 215 LEU O O N N 216 LEU CB C N N 217 LEU CG C N N 218 LEU CD1 C N N 219 LEU CD2 C N N 220 LEU OXT O N N 221 LEU H H N N 222 LEU H2 H N N 223 LEU HA H N N 224 LEU HB2 H N N 225 LEU HB3 H N N 226 LEU HG H N N 227 LEU HD11 H N N 228 LEU HD12 H N N 229 LEU HD13 H N N 230 LEU HD21 H N N 231 LEU HD22 H N N 232 LEU HD23 H N N 233 LEU HXT H N N 234 LYS N N N N 235 LYS CA C N S 236 LYS C C N N 237 LYS O O N N 238 LYS CB C N N 239 LYS CG C N N 240 LYS CD C N N 241 LYS CE C N N 242 LYS NZ N N N 243 LYS OXT O N N 244 LYS H H N N 245 LYS H2 H N N 246 LYS HA H N N 247 LYS HB2 H N N 248 LYS HB3 H N N 249 LYS HG2 H N N 250 LYS HG3 H N N 251 LYS HD2 H N N 252 LYS HD3 H N N 253 LYS HE2 H N N 254 LYS HE3 H N N 255 LYS HZ1 H N N 256 LYS HZ2 H N N 257 LYS HZ3 H N N 258 LYS HXT H N N 259 MET N N N N 260 MET CA C N S 261 MET C C N N 262 MET O O N N 263 MET CB C N N 264 MET CG C N N 265 MET SD S N N 266 MET CE C N N 267 MET OXT O N N 268 MET H H N N 269 MET H2 H N N 270 MET HA H N N 271 MET HB2 H N N 272 MET HB3 H N N 273 MET HG2 H N N 274 MET HG3 H N N 275 MET HE1 H N N 276 MET HE2 H N N 277 MET HE3 H N N 278 MET HXT H N N 279 MN MN MN N N 280 PHE N N N N 281 PHE CA C N S 282 PHE C C N N 283 PHE O O N N 284 PHE CB C N N 285 PHE CG C Y N 286 PHE CD1 C Y N 287 PHE CD2 C Y N 288 PHE CE1 C Y N 289 PHE CE2 C Y N 290 PHE CZ C Y N 291 PHE OXT O N N 292 PHE H H N N 293 PHE H2 H N N 294 PHE HA H N N 295 PHE HB2 H N N 296 PHE HB3 H N N 297 PHE HD1 H N N 298 PHE HD2 H N N 299 PHE HE1 H N N 300 PHE HE2 H N N 301 PHE HZ H N N 302 PHE HXT H N N 303 PRO N N N N 304 PRO CA C N S 305 PRO C C N N 306 PRO O O N N 307 PRO CB C N N 308 PRO CG C N N 309 PRO CD C N N 310 PRO OXT O N N 311 PRO H H N N 312 PRO HA H N N 313 PRO HB2 H N N 314 PRO HB3 H N N 315 PRO HG2 H N N 316 PRO HG3 H N N 317 PRO HD2 H N N 318 PRO HD3 H N N 319 PRO HXT H N N 320 SER N N N N 321 SER CA C N S 322 SER C C N N 323 SER O O N N 324 SER CB C N N 325 SER OG O N N 326 SER OXT O N N 327 SER H H N N 328 SER H2 H N N 329 SER HA H N N 330 SER HB2 H N N 331 SER HB3 H N N 332 SER HG H N N 333 SER HXT H N N 334 SO4 S S N N 335 SO4 O1 O N N 336 SO4 O2 O N N 337 SO4 O3 O N N 338 SO4 O4 O N N 339 THR N N N N 340 THR CA C N S 341 THR C C N N 342 THR O O N N 343 THR CB C N R 344 THR OG1 O N N 345 THR CG2 C N N 346 THR OXT O N N 347 THR H H N N 348 THR H2 H N N 349 THR HA H N N 350 THR HB H N N 351 THR HG1 H N N 352 THR HG21 H N N 353 THR HG22 H N N 354 THR HG23 H N N 355 THR HXT H N N 356 TRP N N N N 357 TRP CA C N S 358 TRP C C N N 359 TRP O O N N 360 TRP CB C N N 361 TRP CG C Y N 362 TRP CD1 C Y N 363 TRP CD2 C Y N 364 TRP NE1 N Y N 365 TRP CE2 C Y N 366 TRP CE3 C Y N 367 TRP CZ2 C Y N 368 TRP CZ3 C Y N 369 TRP CH2 C Y N 370 TRP OXT O N N 371 TRP H H N N 372 TRP H2 H N N 373 TRP HA H N N 374 TRP HB2 H N N 375 TRP HB3 H N N 376 TRP HD1 H N N 377 TRP HE1 H N N 378 TRP HE3 H N N 379 TRP HZ2 H N N 380 TRP HZ3 H N N 381 TRP HH2 H N N 382 TRP HXT H N N 383 TYR N N N N 384 TYR CA C N S 385 TYR C C N N 386 TYR O O N N 387 TYR CB C N N 388 TYR CG C Y N 389 TYR CD1 C Y N 390 TYR CD2 C Y N 391 TYR CE1 C Y N 392 TYR CE2 C Y N 393 TYR CZ C Y N 394 TYR OH O N N 395 TYR OXT O N N 396 TYR H H N N 397 TYR H2 H N N 398 TYR HA H N N 399 TYR HB2 H N N 400 TYR HB3 H N N 401 TYR HD1 H N N 402 TYR HD2 H N N 403 TYR HE1 H N N 404 TYR HE2 H N N 405 TYR HH H N N 406 TYR HXT H N N 407 VAL N N N N 408 VAL CA C N S 409 VAL C C N N 410 VAL O O N N 411 VAL CB C N N 412 VAL CG1 C N N 413 VAL CG2 C N N 414 VAL OXT O N N 415 VAL H H N N 416 VAL H2 H N N 417 VAL HA H N N 418 VAL HB H N N 419 VAL HG11 H N N 420 VAL HG12 H N N 421 VAL HG13 H N N 422 VAL HG21 H N N 423 VAL HG22 H N N 424 VAL HG23 H N N 425 VAL HXT H N N 426 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 4P8 CAH CAB sing N N 1 4P8 CAH CAI sing N N 2 4P8 CAC CAB doub Y N 3 4P8 CAC CAD sing Y N 4 4P8 CAB CAA sing Y N 5 4P8 CAD CAE doub Y N 6 4P8 CAA CLG sing N N 7 4P8 CAA CAF doub Y N 8 4P8 CAE CAF sing Y N 9 4P8 CAI CAK doub Y N 10 4P8 CAI CAJ sing Y N 11 4P8 CAK CAM sing Y N 12 4P8 CAJ CAL doub Y N 13 4P8 CAM CAO sing N N 14 4P8 CAM CAN doub Y N 15 4P8 CAL CAN sing Y N 16 4P8 CAL NAR sing N N 17 4P8 CAO OAP doub N N 18 4P8 OAT NAR sing N N 19 4P8 CAN OAQ sing N N 20 4P8 NAR OAS doub N N 21 4P8 CAO H1 sing N N 22 4P8 CAK H2 sing N N 23 4P8 OAQ H3 sing N N 24 4P8 CAJ H4 sing N N 25 4P8 CAH H5 sing N N 26 4P8 CAH H6 sing N N 27 4P8 CAF H7 sing N N 28 4P8 CAE H8 sing N N 29 4P8 CAD H9 sing N N 30 4P8 CAC H10 sing N N 31 ALA N CA sing N N 32 ALA N H sing N N 33 ALA N H2 sing N N 34 ALA CA C sing N N 35 ALA CA CB sing N N 36 ALA CA HA sing N N 37 ALA C O doub N N 38 ALA C OXT sing N N 39 ALA CB HB1 sing N N 40 ALA CB HB2 sing N N 41 ALA CB HB3 sing N N 42 ALA OXT HXT sing N N 43 ARG N CA sing N N 44 ARG N H sing N N 45 ARG N H2 sing N N 46 ARG CA C sing N N 47 ARG CA CB sing N N 48 ARG CA HA sing N N 49 ARG C O doub N N 50 ARG C OXT sing N N 51 ARG CB CG sing N N 52 ARG CB HB2 sing N N 53 ARG CB HB3 sing N N 54 ARG CG CD sing N N 55 ARG CG HG2 sing N N 56 ARG CG HG3 sing N N 57 ARG CD NE sing N N 58 ARG CD HD2 sing N N 59 ARG CD HD3 sing N N 60 ARG NE CZ sing N N 61 ARG NE HE sing N N 62 ARG CZ NH1 sing N N 63 ARG CZ NH2 doub N N 64 ARG NH1 HH11 sing N N 65 ARG NH1 HH12 sing N N 66 ARG NH2 HH21 sing N N 67 ARG NH2 HH22 sing N N 68 ARG OXT HXT sing N N 69 ASN N CA sing N N 70 ASN N H sing N N 71 ASN N H2 sing N N 72 ASN CA C sing N N 73 ASN CA CB sing N N 74 ASN CA HA sing N N 75 ASN C O doub N N 76 ASN C OXT sing N N 77 ASN CB CG sing N N 78 ASN CB HB2 sing N N 79 ASN CB HB3 sing N N 80 ASN CG OD1 doub N N 81 ASN CG ND2 sing N N 82 ASN ND2 HD21 sing N N 83 ASN ND2 HD22 sing N N 84 ASN OXT HXT sing N N 85 ASP N CA sing N N 86 ASP N H sing N N 87 ASP N H2 sing N N 88 ASP CA C sing N N 89 ASP CA CB sing N N 90 ASP CA HA sing N N 91 ASP C O doub N N 92 ASP C OXT sing N N 93 ASP CB CG sing N N 94 ASP CB HB2 sing N N 95 ASP CB HB3 sing N N 96 ASP CG OD1 doub N N 97 ASP CG OD2 sing N N 98 ASP OD2 HD2 sing N N 99 ASP OXT HXT sing N N 100 CYS N CA sing N N 101 CYS N H sing N N 102 CYS N H2 sing N N 103 CYS CA C sing N N 104 CYS CA CB sing N N 105 CYS CA HA sing N N 106 CYS C O doub N N 107 CYS C OXT sing N N 108 CYS CB SG sing N N 109 CYS CB HB2 sing N N 110 CYS CB HB3 sing N N 111 CYS SG HG sing N N 112 CYS OXT HXT sing N N 113 GLN N CA sing N N 114 GLN N H sing N N 115 GLN N H2 sing N N 116 GLN CA C sing N N 117 GLN CA CB sing N N 118 GLN CA HA sing N N 119 GLN C O doub N N 120 GLN C OXT sing N N 121 GLN CB CG sing N N 122 GLN CB HB2 sing N N 123 GLN CB HB3 sing N N 124 GLN CG CD sing N N 125 GLN CG HG2 sing N N 126 GLN CG HG3 sing N N 127 GLN CD OE1 doub N N 128 GLN CD NE2 sing N N 129 GLN NE2 HE21 sing N N 130 GLN NE2 HE22 sing N N 131 GLN OXT HXT sing N N 132 GLU N CA sing N N 133 GLU N H sing N N 134 GLU N H2 sing N N 135 GLU CA C sing N N 136 GLU CA CB sing N N 137 GLU CA HA sing N N 138 GLU C O doub N N 139 GLU C OXT sing N N 140 GLU CB CG sing N N 141 GLU CB HB2 sing N N 142 GLU CB HB3 sing N N 143 GLU CG CD sing N N 144 GLU CG HG2 sing N N 145 GLU CG HG3 sing N N 146 GLU CD OE1 doub N N 147 GLU CD OE2 sing N N 148 GLU OE2 HE2 sing N N 149 GLU OXT HXT sing N N 150 GLY N CA sing N N 151 GLY N H sing N N 152 GLY N H2 sing N N 153 GLY CA C sing N N 154 GLY CA HA2 sing N N 155 GLY CA HA3 sing N N 156 GLY C O doub N N 157 GLY C OXT sing N N 158 GLY OXT HXT sing N N 159 HIS N CA sing N N 160 HIS N H sing N N 161 HIS N H2 sing N N 162 HIS CA C sing N N 163 HIS CA CB sing N N 164 HIS CA HA sing N N 165 HIS C O doub N N 166 HIS C OXT sing N N 167 HIS CB CG sing N N 168 HIS CB HB2 sing N N 169 HIS CB HB3 sing N N 170 HIS CG ND1 sing Y N 171 HIS CG CD2 doub Y N 172 HIS ND1 CE1 doub Y N 173 HIS ND1 HD1 sing N N 174 HIS CD2 NE2 sing Y N 175 HIS CD2 HD2 sing N N 176 HIS CE1 NE2 sing Y N 177 HIS CE1 HE1 sing N N 178 HIS NE2 HE2 sing N N 179 HIS OXT HXT sing N N 180 HOH O H1 sing N N 181 HOH O H2 sing N N 182 ILE N CA sing N N 183 ILE N H sing N N 184 ILE N H2 sing N N 185 ILE CA C sing N N 186 ILE CA CB sing N N 187 ILE CA HA sing N N 188 ILE C O doub N N 189 ILE C OXT sing N N 190 ILE CB CG1 sing N N 191 ILE CB CG2 sing N N 192 ILE CB HB sing N N 193 ILE CG1 CD1 sing N N 194 ILE CG1 HG12 sing N N 195 ILE CG1 HG13 sing N N 196 ILE CG2 HG21 sing N N 197 ILE CG2 HG22 sing N N 198 ILE CG2 HG23 sing N N 199 ILE CD1 HD11 sing N N 200 ILE CD1 HD12 sing N N 201 ILE CD1 HD13 sing N N 202 ILE OXT HXT sing N N 203 LEU N CA sing N N 204 LEU N H sing N N 205 LEU N H2 sing N N 206 LEU CA C sing N N 207 LEU CA CB sing N N 208 LEU CA HA sing N N 209 LEU C O doub N N 210 LEU C OXT sing N N 211 LEU CB CG sing N N 212 LEU CB HB2 sing N N 213 LEU CB HB3 sing N N 214 LEU CG CD1 sing N N 215 LEU CG CD2 sing N N 216 LEU CG HG sing N N 217 LEU CD1 HD11 sing N N 218 LEU CD1 HD12 sing N N 219 LEU CD1 HD13 sing N N 220 LEU CD2 HD21 sing N N 221 LEU CD2 HD22 sing N N 222 LEU CD2 HD23 sing N N 223 LEU OXT HXT sing N N 224 LYS N CA sing N N 225 LYS N H sing N N 226 LYS N H2 sing N N 227 LYS CA C sing N N 228 LYS CA CB sing N N 229 LYS CA HA sing N N 230 LYS C O doub N N 231 LYS C OXT sing N N 232 LYS CB CG sing N N 233 LYS CB HB2 sing N N 234 LYS CB HB3 sing N N 235 LYS CG CD sing N N 236 LYS CG HG2 sing N N 237 LYS CG HG3 sing N N 238 LYS CD CE sing N N 239 LYS CD HD2 sing N N 240 LYS CD HD3 sing N N 241 LYS CE NZ sing N N 242 LYS CE HE2 sing N N 243 LYS CE HE3 sing N N 244 LYS NZ HZ1 sing N N 245 LYS NZ HZ2 sing N N 246 LYS NZ HZ3 sing N N 247 LYS OXT HXT sing N N 248 MET N CA sing N N 249 MET N H sing N N 250 MET N H2 sing N N 251 MET CA C sing N N 252 MET CA CB sing N N 253 MET CA HA sing N N 254 MET C O doub N N 255 MET C OXT sing N N 256 MET CB CG sing N N 257 MET CB HB2 sing N N 258 MET CB HB3 sing N N 259 MET CG SD sing N N 260 MET CG HG2 sing N N 261 MET CG HG3 sing N N 262 MET SD CE sing N N 263 MET CE HE1 sing N N 264 MET CE HE2 sing N N 265 MET CE HE3 sing N N 266 MET OXT HXT sing N N 267 PHE N CA sing N N 268 PHE N H sing N N 269 PHE N H2 sing N N 270 PHE CA C sing N N 271 PHE CA CB sing N N 272 PHE CA HA sing N N 273 PHE C O doub N N 274 PHE C OXT sing N N 275 PHE CB CG sing N N 276 PHE CB HB2 sing N N 277 PHE CB HB3 sing N N 278 PHE CG CD1 doub Y N 279 PHE CG CD2 sing Y N 280 PHE CD1 CE1 sing Y N 281 PHE CD1 HD1 sing N N 282 PHE CD2 CE2 doub Y N 283 PHE CD2 HD2 sing N N 284 PHE CE1 CZ doub Y N 285 PHE CE1 HE1 sing N N 286 PHE CE2 CZ sing Y N 287 PHE CE2 HE2 sing N N 288 PHE CZ HZ sing N N 289 PHE OXT HXT sing N N 290 PRO N CA sing N N 291 PRO N CD sing N N 292 PRO N H sing N N 293 PRO CA C sing N N 294 PRO CA CB sing N N 295 PRO CA HA sing N N 296 PRO C O doub N N 297 PRO C OXT sing N N 298 PRO CB CG sing N N 299 PRO CB HB2 sing N N 300 PRO CB HB3 sing N N 301 PRO CG CD sing N N 302 PRO CG HG2 sing N N 303 PRO CG HG3 sing N N 304 PRO CD HD2 sing N N 305 PRO CD HD3 sing N N 306 PRO OXT HXT sing N N 307 SER N CA sing N N 308 SER N H sing N N 309 SER N H2 sing N N 310 SER CA C sing N N 311 SER CA CB sing N N 312 SER CA HA sing N N 313 SER C O doub N N 314 SER C OXT sing N N 315 SER CB OG sing N N 316 SER CB HB2 sing N N 317 SER CB HB3 sing N N 318 SER OG HG sing N N 319 SER OXT HXT sing N N 320 SO4 S O1 doub N N 321 SO4 S O2 doub N N 322 SO4 S O3 sing N N 323 SO4 S O4 sing N N 324 THR N CA sing N N 325 THR N H sing N N 326 THR N H2 sing N N 327 THR CA C sing N N 328 THR CA CB sing N N 329 THR CA HA sing N N 330 THR C O doub N N 331 THR C OXT sing N N 332 THR CB OG1 sing N N 333 THR CB CG2 sing N N 334 THR CB HB sing N N 335 THR OG1 HG1 sing N N 336 THR CG2 HG21 sing N N 337 THR CG2 HG22 sing N N 338 THR CG2 HG23 sing N N 339 THR OXT HXT sing N N 340 TRP N CA sing N N 341 TRP N H sing N N 342 TRP N H2 sing N N 343 TRP CA C sing N N 344 TRP CA CB sing N N 345 TRP CA HA sing N N 346 TRP C O doub N N 347 TRP C OXT sing N N 348 TRP CB CG sing N N 349 TRP CB HB2 sing N N 350 TRP CB HB3 sing N N 351 TRP CG CD1 doub Y N 352 TRP CG CD2 sing Y N 353 TRP CD1 NE1 sing Y N 354 TRP CD1 HD1 sing N N 355 TRP CD2 CE2 doub Y N 356 TRP CD2 CE3 sing Y N 357 TRP NE1 CE2 sing Y N 358 TRP NE1 HE1 sing N N 359 TRP CE2 CZ2 sing Y N 360 TRP CE3 CZ3 doub Y N 361 TRP CE3 HE3 sing N N 362 TRP CZ2 CH2 doub Y N 363 TRP CZ2 HZ2 sing N N 364 TRP CZ3 CH2 sing Y N 365 TRP CZ3 HZ3 sing N N 366 TRP CH2 HH2 sing N N 367 TRP OXT HXT sing N N 368 TYR N CA sing N N 369 TYR N H sing N N 370 TYR N H2 sing N N 371 TYR CA C sing N N 372 TYR CA CB sing N N 373 TYR CA HA sing N N 374 TYR C O doub N N 375 TYR C OXT sing N N 376 TYR CB CG sing N N 377 TYR CB HB2 sing N N 378 TYR CB HB3 sing N N 379 TYR CG CD1 doub Y N 380 TYR CG CD2 sing Y N 381 TYR CD1 CE1 sing Y N 382 TYR CD1 HD1 sing N N 383 TYR CD2 CE2 doub Y N 384 TYR CD2 HD2 sing N N 385 TYR CE1 CZ doub Y N 386 TYR CE1 HE1 sing N N 387 TYR CE2 CZ sing Y N 388 TYR CE2 HE2 sing N N 389 TYR CZ OH sing N N 390 TYR OH HH sing N N 391 TYR OXT HXT sing N N 392 VAL N CA sing N N 393 VAL N H sing N N 394 VAL N H2 sing N N 395 VAL CA C sing N N 396 VAL CA CB sing N N 397 VAL CA HA sing N N 398 VAL C O doub N N 399 VAL C OXT sing N N 400 VAL CB CG1 sing N N 401 VAL CB CG2 sing N N 402 VAL CB HB sing N N 403 VAL CG1 HG11 sing N N 404 VAL CG1 HG12 sing N N 405 VAL CG1 HG13 sing N N 406 VAL CG2 HG21 sing N N 407 VAL CG2 HG22 sing N N 408 VAL CG2 HG23 sing N N 409 VAL OXT HXT sing N N 410 # _pdbx_audit_support.funding_organization 'Japan Society for the Promotion of Science' _pdbx_audit_support.country Japan _pdbx_audit_support.grant_number 24590548 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '5-(2-chlorobenzyl)-2-hydroxy-3-nitrobenzaldehyde' 4P8 3 'MANGANESE (II) ION' MN 4 'SULFATE ION' SO4 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4ZQQ _pdbx_initial_refinement_model.details ? #