data_5FRF # _entry.id 5FRF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5FRF pdb_00005frf 10.2210/pdb5frf/pdb PDBE EBI-65753 ? ? WWPDB D_1290065753 ? ? BMRB 25955 ? 10.13018/BMR25955 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-08-03 2 'Structure model' 2 0 2019-10-23 3 'Structure model' 2 1 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Atomic model' 2 2 'Structure model' 'Data collection' 3 2 'Structure model' Other 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Database references' 6 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' atom_site 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' chem_comp_atom 5 3 'Structure model' chem_comp_bond 6 3 'Structure model' database_2 7 3 'Structure model' pdbx_struct_conn_angle 8 3 'Structure model' struct_conn 9 3 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_atom_site.Cartn_x' 2 2 'Structure model' '_atom_site.Cartn_y' 3 2 'Structure model' '_atom_site.Cartn_z' 4 2 'Structure model' '_pdbx_database_status.status_code_cs' 5 2 'Structure model' '_pdbx_database_status.status_code_mr' 6 2 'Structure model' '_pdbx_nmr_spectrometer.model' 7 3 'Structure model' '_database_2.pdbx_DOI' 8 3 'Structure model' '_database_2.pdbx_database_accession' 9 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 10 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 12 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 13 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 14 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 15 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 16 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 17 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 18 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 19 3 'Structure model' '_pdbx_struct_conn_angle.value' 20 3 'Structure model' '_struct_conn.pdbx_dist_value' 21 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 22 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 23 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 24 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 25 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 26 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 27 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 28 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 29 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 30 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 31 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 32 3 'Structure model' '_struct_conn.ptnr2_label_seq_id' 33 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 34 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 35 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 5FRF _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2015-12-17 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_id 25955 _pdbx_database_related.details . _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zdanowski, K.' 1 'Pecqueur, L.' 2 'Werner, J.' 3 'Potts, J.R.' 4 'Kleanthous, C.' 5 # _citation.id primary _citation.title 'The Anti-Sigma Factor Rsra Responds to Oxidative Stress by Reburying its Hydrophobic Core.' _citation.journal_abbrev Nat.Commun. _citation.journal_volume 7 _citation.page_first 12194 _citation.page_last ? _citation.year 2016 _citation.journal_id_ASTM ? _citation.country UK _citation.journal_id_ISSN 2041-1723 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 27432510 _citation.pdbx_database_id_DOI 10.1038/NCOMMS12194 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Rajasekar, K.V.' 1 ? primary 'Zdanowski, K.' 2 ? primary 'Yan, J.' 3 ? primary 'Hopper, J.T.' 4 ? primary 'Francis, M.L.' 5 ? primary 'Seepersad, C.' 6 ? primary 'Sharp, C.' 7 ? primary 'Pecqueur, L.' 8 ? primary 'Werner, J.M.' 9 ? primary 'Robinson, C.V.' 10 ? primary 'Mohammed, S.' 11 ? primary 'Potts, J.R.' 12 ? primary 'Kleanthous, C.' 13 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'ANTI-SIGMA FACTOR RSRA' 11835.058 1 ? YES ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'REGULATOR OF SIGR, SIGMA-R ANTI-SIGMA FACTOR RSRA' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMSAGEPHETDCSEILDHLYEFLDKEMPDSDAVKFEHHFEESSPCLEKYGLEQAVKKLVKRAAGQDDVPGDLRAKVMG RLDLIRSGQSVPEHDVAAAPSSSAPQES ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMSAGEPHETDCSEILDHLYEFLDKEMPDSDAVKFEHHFEESSPCLEKYGLEQAVKKLVKRAAGQDDVPGDLRAKVMG RLDLIRSGQSVPEHDVAAAPSSSAPQES ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 SER n 1 6 ALA n 1 7 GLY n 1 8 GLU n 1 9 PRO n 1 10 HIS n 1 11 GLU n 1 12 THR n 1 13 ASP n 1 14 CYS n 1 15 SER n 1 16 GLU n 1 17 ILE n 1 18 LEU n 1 19 ASP n 1 20 HIS n 1 21 LEU n 1 22 TYR n 1 23 GLU n 1 24 PHE n 1 25 LEU n 1 26 ASP n 1 27 LYS n 1 28 GLU n 1 29 MET n 1 30 PRO n 1 31 ASP n 1 32 SER n 1 33 ASP n 1 34 ALA n 1 35 VAL n 1 36 LYS n 1 37 PHE n 1 38 GLU n 1 39 HIS n 1 40 HIS n 1 41 PHE n 1 42 GLU n 1 43 GLU n 1 44 SER n 1 45 SER n 1 46 PRO n 1 47 CYS n 1 48 LEU n 1 49 GLU n 1 50 LYS n 1 51 TYR n 1 52 GLY n 1 53 LEU n 1 54 GLU n 1 55 GLN n 1 56 ALA n 1 57 VAL n 1 58 LYS n 1 59 LYS n 1 60 LEU n 1 61 VAL n 1 62 LYS n 1 63 ARG n 1 64 ALA n 1 65 ALA n 1 66 GLY n 1 67 GLN n 1 68 ASP n 1 69 ASP n 1 70 VAL n 1 71 PRO n 1 72 GLY n 1 73 ASP n 1 74 LEU n 1 75 ARG n 1 76 ALA n 1 77 LYS n 1 78 VAL n 1 79 MET n 1 80 GLY n 1 81 ARG n 1 82 LEU n 1 83 ASP n 1 84 LEU n 1 85 ILE n 1 86 ARG n 1 87 SER n 1 88 GLY n 1 89 GLN n 1 90 SER n 1 91 VAL n 1 92 PRO n 1 93 GLU n 1 94 HIS n 1 95 ASP n 1 96 VAL n 1 97 ALA n 1 98 ALA n 1 99 ALA n 1 100 PRO n 1 101 SER n 1 102 SER n 1 103 SER n 1 104 ALA n 1 105 PRO n 1 106 GLN n 1 107 GLU n 1 108 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'STREPTOMYCES COELICOLOR' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1902 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant PLYSS _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 -2 GLY GLY A . n A 1 2 SER 2 -1 -1 SER SER A . n A 1 3 HIS 3 0 0 HIS HIS A . n A 1 4 MET 4 1 1 MET MET A . n A 1 5 SER 5 2 2 SER SER A . n A 1 6 ALA 6 3 3 ALA ALA A . n A 1 7 GLY 7 4 4 GLY GLY A . n A 1 8 GLU 8 5 5 GLU GLU A . n A 1 9 PRO 9 6 6 PRO PRO A . n A 1 10 HIS 10 7 7 HIS HIS A . n A 1 11 GLU 11 8 8 GLU GLU A . n A 1 12 THR 12 9 9 THR THR A . n A 1 13 ASP 13 10 10 ASP ASP A . n A 1 14 CYS 14 11 11 CYS CYS A . n A 1 15 SER 15 12 12 SER SER A . n A 1 16 GLU 16 13 13 GLU GLU A . n A 1 17 ILE 17 14 14 ILE ILE A . n A 1 18 LEU 18 15 15 LEU LEU A . n A 1 19 ASP 19 16 16 ASP ASP A . n A 1 20 HIS 20 17 17 HIS HIS A . n A 1 21 LEU 21 18 18 LEU LEU A . n A 1 22 TYR 22 19 19 TYR TYR A . n A 1 23 GLU 23 20 20 GLU GLU A . n A 1 24 PHE 24 21 21 PHE PHE A . n A 1 25 LEU 25 22 22 LEU LEU A . n A 1 26 ASP 26 23 23 ASP ASP A . n A 1 27 LYS 27 24 24 LYS LYS A . n A 1 28 GLU 28 25 25 GLU GLU A . n A 1 29 MET 29 26 26 MET MET A . n A 1 30 PRO 30 27 27 PRO PRO A . n A 1 31 ASP 31 28 28 ASP ASP A . n A 1 32 SER 32 29 29 SER SER A . n A 1 33 ASP 33 30 30 ASP ASP A . n A 1 34 ALA 34 31 31 ALA ALA A . n A 1 35 VAL 35 32 32 VAL VAL A . n A 1 36 LYS 36 33 33 LYS LYS A . n A 1 37 PHE 37 34 34 PHE PHE A . n A 1 38 GLU 38 35 35 GLU GLU A . n A 1 39 HIS 39 36 36 HIS HIS A . n A 1 40 HIS 40 37 37 HIS HIS A . n A 1 41 PHE 41 38 38 PHE PHE A . n A 1 42 GLU 42 39 39 GLU GLU A . n A 1 43 GLU 43 40 40 GLU GLU A . n A 1 44 SER 44 41 41 SER SER A . n A 1 45 SER 45 42 42 SER SER A . n A 1 46 PRO 46 43 43 PRO PRO A . n A 1 47 CYS 47 44 44 CYS CYS A . n A 1 48 LEU 48 45 45 LEU LEU A . n A 1 49 GLU 49 46 46 GLU GLU A . n A 1 50 LYS 50 47 47 LYS LYS A . n A 1 51 TYR 51 48 48 TYR TYR A . n A 1 52 GLY 52 49 49 GLY GLY A . n A 1 53 LEU 53 50 50 LEU LEU A . n A 1 54 GLU 54 51 51 GLU GLU A . n A 1 55 GLN 55 52 52 GLN GLN A . n A 1 56 ALA 56 53 53 ALA ALA A . n A 1 57 VAL 57 54 54 VAL VAL A . n A 1 58 LYS 58 55 55 LYS LYS A . n A 1 59 LYS 59 56 56 LYS LYS A . n A 1 60 LEU 60 57 57 LEU LEU A . n A 1 61 VAL 61 58 58 VAL VAL A . n A 1 62 LYS 62 59 59 LYS LYS A . n A 1 63 ARG 63 60 60 ARG ARG A . n A 1 64 ALA 64 61 61 ALA ALA A . n A 1 65 ALA 65 62 62 ALA ALA A . n A 1 66 GLY 66 63 63 GLY GLY A . n A 1 67 GLN 67 64 64 GLN GLN A . n A 1 68 ASP 68 65 65 ASP ASP A . n A 1 69 ASP 69 66 66 ASP ASP A . n A 1 70 VAL 70 67 67 VAL VAL A . n A 1 71 PRO 71 68 68 PRO PRO A . n A 1 72 GLY 72 69 69 GLY GLY A . n A 1 73 ASP 73 70 70 ASP ASP A . n A 1 74 LEU 74 71 71 LEU LEU A . n A 1 75 ARG 75 72 72 ARG ARG A . n A 1 76 ALA 76 73 73 ALA ALA A . n A 1 77 LYS 77 74 74 LYS LYS A . n A 1 78 VAL 78 75 75 VAL VAL A . n A 1 79 MET 79 76 76 MET MET A . n A 1 80 GLY 80 77 77 GLY GLY A . n A 1 81 ARG 81 78 78 ARG ARG A . n A 1 82 LEU 82 79 79 LEU LEU A . n A 1 83 ASP 83 80 80 ASP ASP A . n A 1 84 LEU 84 81 81 LEU LEU A . n A 1 85 ILE 85 82 82 ILE ILE A . n A 1 86 ARG 86 83 83 ARG ARG A . n A 1 87 SER 87 84 84 SER SER A . n A 1 88 GLY 88 85 85 GLY GLY A . n A 1 89 GLN 89 86 86 GLN GLN A . n A 1 90 SER 90 87 87 SER SER A . n A 1 91 VAL 91 88 88 VAL VAL A . n A 1 92 PRO 92 89 89 PRO PRO A . n A 1 93 GLU 93 90 90 GLU GLU A . n A 1 94 HIS 94 91 91 HIS HIS A . n A 1 95 ASP 95 92 92 ASP ASP A . n A 1 96 VAL 96 93 93 VAL VAL A . n A 1 97 ALA 97 94 94 ALA ALA A . n A 1 98 ALA 98 95 95 ALA ALA A . n A 1 99 ALA 99 96 96 ALA ALA A . n A 1 100 PRO 100 97 97 PRO PRO A . n A 1 101 SER 101 98 98 SER SER A . n A 1 102 SER 102 99 99 SER SER A . n A 1 103 SER 103 100 100 SER SER A . n A 1 104 ALA 104 101 101 ALA ALA A . n A 1 105 PRO 105 102 102 PRO PRO A . n A 1 106 GLN 106 103 103 GLN GLN A . n A 1 107 GLU 107 104 104 GLU GLU A . n A 1 108 SER 108 105 105 SER SER A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 106 _pdbx_nonpoly_scheme.auth_seq_num 106 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _cell.entry_id 5FRF _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5FRF _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 5FRF _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 5FRF _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 5FRF _struct.title 'Solution structure of reduced and zinc-bound RsrA' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 5FRF _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text 'TRANSCRIPTION, ANTI-SIGMA FACTOR, REDOX SENSING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RSRA_STRCO _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession Q7AKG8 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5FRF _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 108 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q7AKG8 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 105 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 105 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5FRF GLY A 1 ? UNP Q7AKG8 ? ? 'expression tag' -2 1 1 5FRF SER A 2 ? UNP Q7AKG8 ? ? 'expression tag' -1 2 1 5FRF HIS A 3 ? UNP Q7AKG8 ? ? 'expression tag' 0 3 1 5FRF ALA A 6 ? UNP Q7AKG8 CYS 3 'engineered mutation' 3 4 1 5FRF ALA A 34 ? UNP Q7AKG8 CYS 31 'engineered mutation' 31 5 1 5FRF SER A 44 ? UNP Q7AKG8 CYS 41 'engineered mutation' 41 6 1 5FRF ALA A 64 ? UNP Q7AKG8 CYS 61 'engineered mutation' 61 7 1 5FRF ALA A 65 ? UNP Q7AKG8 CYS 62 'engineered mutation' 62 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 13 ? GLU A 28 ? ASP A 10 GLU A 25 1 ? 16 HELX_P HELX_P2 2 PRO A 30 ? VAL A 35 ? PRO A 27 VAL A 32 1 ? 6 HELX_P HELX_P3 3 LYS A 36 ? GLU A 42 ? LYS A 33 GLU A 39 5 ? 7 HELX_P HELX_P4 4 LEU A 53 ? ALA A 64 ? LEU A 50 ALA A 61 1 ? 12 HELX_P HELX_P5 5 ASP A 73 ? MET A 79 ? ASP A 70 MET A 76 1 ? 7 HELX_P HELX_P6 6 MET A 79 ? GLY A 88 ? MET A 76 GLY A 85 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 14 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 11 A ZN 106 1_555 ? ? ? ? ? ? ? 2.298 ? ? metalc2 metalc ? ? A HIS 40 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 37 A ZN 106 1_555 ? ? ? ? ? ? ? 1.998 ? ? metalc3 metalc ? ? A SER 44 OG ? ? ? 1_555 B ZN . ZN ? ? A SER 41 A ZN 106 1_555 ? ? ? ? ? ? ? 2.302 ? ? metalc4 metalc ? ? A CYS 47 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 44 A ZN 106 1_555 ? ? ? ? ? ? ? 2.299 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 14 ? A CYS 11 ? 1_555 ZN ? B ZN . ? A ZN 106 ? 1_555 NE2 ? A HIS 40 ? A HIS 37 ? 1_555 109.5 ? 2 SG ? A CYS 14 ? A CYS 11 ? 1_555 ZN ? B ZN . ? A ZN 106 ? 1_555 OG ? A SER 44 ? A SER 41 ? 1_555 110.7 ? 3 NE2 ? A HIS 40 ? A HIS 37 ? 1_555 ZN ? B ZN . ? A ZN 106 ? 1_555 OG ? A SER 44 ? A SER 41 ? 1_555 106.5 ? 4 SG ? A CYS 14 ? A CYS 11 ? 1_555 ZN ? B ZN . ? A ZN 106 ? 1_555 SG ? A CYS 47 ? A CYS 44 ? 1_555 109.1 ? 5 NE2 ? A HIS 40 ? A HIS 37 ? 1_555 ZN ? B ZN . ? A ZN 106 ? 1_555 SG ? A CYS 47 ? A CYS 44 ? 1_555 111.2 ? 6 OG ? A SER 44 ? A SER 41 ? 1_555 ZN ? B ZN . ? A ZN 106 ? 1_555 SG ? A CYS 47 ? A CYS 44 ? 1_555 109.8 ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 SER 45 A . ? SER 42 A PRO 46 A ? PRO 43 A 1 0.79 2 SER 45 A . ? SER 42 A PRO 46 A ? PRO 43 A 2 0.13 3 SER 45 A . ? SER 42 A PRO 46 A ? PRO 43 A 3 0.38 4 SER 45 A . ? SER 42 A PRO 46 A ? PRO 43 A 4 0.14 5 SER 45 A . ? SER 42 A PRO 46 A ? PRO 43 A 5 0.14 6 SER 45 A . ? SER 42 A PRO 46 A ? PRO 43 A 6 -0.04 7 SER 45 A . ? SER 42 A PRO 46 A ? PRO 43 A 7 0.02 8 SER 45 A . ? SER 42 A PRO 46 A ? PRO 43 A 8 0.34 9 SER 45 A . ? SER 42 A PRO 46 A ? PRO 43 A 9 0.52 10 SER 45 A . ? SER 42 A PRO 46 A ? PRO 43 A 10 0.03 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 106 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 106' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 14 ? CYS A 11 . ? 1_555 ? 2 AC1 4 HIS A 40 ? HIS A 37 . ? 1_555 ? 3 AC1 4 SER A 44 ? SER A 41 . ? 1_555 ? 4 AC1 4 CYS A 47 ? CYS A 44 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A CYS 11 ? ? H A LEU 15 ? ? 1.58 2 1 O A SER 12 ? ? H A ASP 16 ? ? 1.60 3 4 O A GLN 64 ? ? H A ASP 66 ? ? 1.53 4 6 O A GLN 64 ? ? H A ASP 66 ? ? 1.52 5 6 O A SER 12 ? ? H A ASP 16 ? ? 1.56 6 8 O A GLU 51 ? ? H A LYS 55 ? ? 1.57 7 8 O A SER 12 ? ? H A ASP 16 ? ? 1.60 8 9 O A SER 12 ? ? H A ASP 16 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 32 ? ? -47.41 -15.72 2 1 GLU A 39 ? ? -95.62 -73.91 3 1 SER A 41 ? ? -173.14 -32.65 4 1 SER A 42 ? ? -175.02 -51.93 5 1 LYS A 47 ? ? 67.88 66.12 6 1 TYR A 48 ? ? -167.28 -42.28 7 1 ARG A 60 ? ? -70.34 -99.50 8 1 ALA A 62 ? ? 67.89 150.84 9 1 ASP A 66 ? ? -44.39 164.51 10 1 ASP A 70 ? ? -147.74 -48.00 11 1 GLU A 90 ? ? -34.86 102.33 12 1 HIS A 91 ? ? -157.05 -58.14 13 1 ALA A 94 ? ? -143.27 -54.16 14 2 PRO A 27 ? ? -48.39 164.84 15 2 VAL A 32 ? ? -47.68 -15.64 16 2 LEU A 45 ? ? -159.61 -58.08 17 2 ARG A 60 ? ? -71.37 -108.02 18 2 ALA A 62 ? ? 67.67 150.19 19 2 ASP A 66 ? ? -45.69 164.27 20 2 ASP A 70 ? ? -143.67 -50.08 21 2 ASP A 92 ? ? 67.84 157.42 22 2 VAL A 93 ? ? -101.24 64.00 23 2 ALA A 94 ? ? -133.99 -54.92 24 3 HIS A 7 ? ? -126.10 -59.00 25 3 PRO A 27 ? ? -48.59 164.60 26 3 VAL A 32 ? ? -47.92 -15.76 27 3 GLU A 39 ? ? -86.81 -101.56 28 3 SER A 41 ? ? -143.62 -109.66 29 3 TYR A 48 ? ? -168.83 -38.38 30 3 ARG A 60 ? ? -70.23 -110.59 31 3 ALA A 62 ? ? -123.33 -62.97 32 3 ASP A 66 ? ? -33.81 144.76 33 3 HIS A 91 ? ? -113.01 56.68 34 3 ALA A 94 ? ? -140.50 -56.62 35 4 GLU A 8 ? ? -153.40 25.15 36 4 GLU A 25 ? ? 53.04 86.81 37 4 PRO A 27 ? ? -50.44 172.20 38 4 VAL A 32 ? ? -46.41 -17.23 39 4 GLU A 39 ? ? -71.57 -70.52 40 4 SER A 41 ? ? -119.18 -86.93 41 4 LEU A 45 ? ? -152.02 -55.34 42 4 ALA A 62 ? ? 60.22 -179.77 43 4 ASP A 65 ? ? 61.86 -41.78 44 4 HIS A 91 ? ? -154.83 -60.32 45 4 VAL A 93 ? ? 45.75 97.30 46 4 ALA A 94 ? ? 70.41 131.83 47 5 THR A 9 ? ? -54.53 105.49 48 5 ASP A 10 ? ? -24.74 113.90 49 5 GLU A 25 ? ? -53.21 96.56 50 5 VAL A 32 ? ? -47.43 -18.86 51 5 GLU A 39 ? ? -74.69 -76.96 52 5 SER A 41 ? ? -96.45 -64.60 53 5 CYS A 44 ? ? -93.49 -68.50 54 5 LEU A 45 ? ? -168.56 114.14 55 5 GLU A 46 ? ? 62.85 170.75 56 5 ARG A 60 ? ? -76.76 -104.27 57 5 ALA A 61 ? ? 58.87 -86.46 58 5 ASP A 66 ? ? 47.95 176.69 59 5 HIS A 91 ? ? 55.22 93.79 60 5 ASP A 92 ? ? 68.80 171.33 61 5 VAL A 93 ? ? -90.06 59.97 62 5 ALA A 94 ? ? -135.06 -54.15 63 5 SER A 100 ? ? 65.32 126.23 64 5 ALA A 101 ? ? 57.80 74.53 65 6 HIS A 7 ? ? -143.75 -56.25 66 6 PRO A 27 ? ? -47.02 166.57 67 6 VAL A 32 ? ? -46.11 -17.65 68 6 GLU A 39 ? ? -65.53 -94.01 69 6 SER A 41 ? ? -168.08 -52.99 70 6 LEU A 45 ? ? 60.35 79.82 71 6 GLU A 46 ? ? 67.61 158.86 72 6 ARG A 60 ? ? -71.94 -74.98 73 6 ALA A 61 ? ? 58.48 177.34 74 6 ASP A 65 ? ? 61.45 -42.45 75 6 HIS A 91 ? ? 64.90 -73.94 76 6 VAL A 93 ? ? 27.13 75.68 77 6 ALA A 94 ? ? 60.96 88.32 78 6 ALA A 95 ? ? -135.83 -53.18 79 6 GLN A 103 ? ? -130.72 -58.74 80 7 GLU A 25 ? ? 51.16 75.89 81 7 PRO A 27 ? ? -49.39 165.67 82 7 VAL A 32 ? ? -47.05 -16.39 83 7 SER A 41 ? ? -126.27 -68.35 84 7 CYS A 44 ? ? -86.75 -70.09 85 7 LEU A 45 ? ? -168.01 -61.12 86 7 ARG A 60 ? ? -73.36 -100.48 87 7 ALA A 62 ? ? 62.99 159.86 88 7 ASP A 66 ? ? 46.75 179.09 89 7 GLU A 90 ? ? -41.38 101.89 90 7 ASP A 92 ? ? 66.39 130.92 91 7 VAL A 93 ? ? 33.45 69.71 92 7 PRO A 97 ? ? -69.62 98.37 93 7 ALA A 101 ? ? 57.85 75.52 94 7 GLU A 104 ? ? 64.48 102.02 95 8 HIS A 0 ? ? 58.27 89.18 96 8 HIS A 7 ? ? -137.64 -58.33 97 8 GLU A 25 ? ? 51.99 79.30 98 8 PRO A 27 ? ? -51.89 171.79 99 8 VAL A 32 ? ? -44.73 -18.80 100 8 GLU A 39 ? ? -90.00 -72.44 101 8 SER A 41 ? ? -137.94 -63.36 102 8 SER A 42 ? ? -37.86 119.14 103 8 LEU A 45 ? ? 62.10 71.96 104 8 GLU A 46 ? ? 62.05 93.71 105 8 TYR A 48 ? ? -162.10 63.24 106 8 ARG A 60 ? ? -70.63 -109.07 107 8 ALA A 62 ? ? -152.02 -69.90 108 8 ASP A 92 ? ? 55.93 85.67 109 8 VAL A 93 ? ? 33.46 61.20 110 8 ALA A 94 ? ? -150.66 -56.38 111 8 ALA A 96 ? ? 66.33 149.59 112 9 HIS A 7 ? ? -103.45 63.45 113 9 GLU A 25 ? ? 54.32 85.15 114 9 PRO A 27 ? ? -49.59 168.66 115 9 VAL A 32 ? ? -45.69 -17.21 116 9 GLU A 39 ? ? -94.13 -75.11 117 9 SER A 41 ? ? -159.45 -107.04 118 9 LEU A 45 ? ? -142.82 47.64 119 9 LEU A 50 ? ? -140.89 27.22 120 9 ARG A 60 ? ? -72.43 -104.46 121 9 ALA A 62 ? ? -170.16 82.62 122 9 HIS A 91 ? ? 68.57 -74.55 123 9 VAL A 93 ? ? 34.64 51.06 124 9 ALA A 94 ? ? 47.91 70.28 125 9 ALA A 96 ? ? -154.40 80.48 126 10 HIS A 0 ? ? 63.37 101.40 127 10 HIS A 7 ? ? -127.77 -55.67 128 10 PRO A 27 ? ? -48.23 164.64 129 10 VAL A 32 ? ? -47.77 -16.69 130 10 GLU A 39 ? ? -60.03 -94.03 131 10 SER A 41 ? ? -168.22 -53.60 132 10 LEU A 45 ? ? 65.96 166.48 133 10 ARG A 60 ? ? -69.84 -92.87 134 10 ALA A 61 ? ? 55.03 -85.39 135 10 GLU A 90 ? ? -39.08 115.78 136 10 ASP A 92 ? ? -100.26 51.75 137 10 VAL A 93 ? ? -141.53 56.27 # _pdbx_entry_details.entry_id 5FRF _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;COMPARED TO THE SEQUENCE CORRESPONDING TO THIS SEQUENCE ACCESSION NUMBER THERE ARE THREE N-TERMINAL NON-NATIVE RESIDUES AND FIVE MUTATIONS (AS STATED ABOVE) IN THE SUBMITTED PDB FILES. ; _pdbx_entry_details.has_ligand_of_interest ? # _pdbx_nmr_ensemble.entry_id 5FRF _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'LEAST RESTRAINT VIOLATION' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '5% D2O/(5% WATER' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298.0 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 7.1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 NOESY 1 2 1 'TOCSY (2D' 1 3 1 '3D)' 1 4 1 HNCA 1 5 1 CBCANH 1 6 1 'CBCA(CO)NH' 1 7 1 HNCO 1 8 1 'HN(CA)CO' 1 # _pdbx_nmr_details.entry_id 5FRF _pdbx_nmr_details.text NONE # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement CNS ? 'BRUNGER,ADAMS,CLORE,DELANO,GROS,GROSSE-KUNSTLEVE, JIANG,KUSZEWSKI,NILGES,PANNU,READ,RICE,SIMONSON, WARREN' 1 'structure solution' CNS ? ? 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 CYS N N N N 57 CYS CA C N R 58 CYS C C N N 59 CYS O O N N 60 CYS CB C N N 61 CYS SG S N N 62 CYS OXT O N N 63 CYS H H N N 64 CYS H2 H N N 65 CYS HA H N N 66 CYS HB2 H N N 67 CYS HB3 H N N 68 CYS HG H N N 69 CYS HXT H N N 70 GLN N N N N 71 GLN CA C N S 72 GLN C C N N 73 GLN O O N N 74 GLN CB C N N 75 GLN CG C N N 76 GLN CD C N N 77 GLN OE1 O N N 78 GLN NE2 N N N 79 GLN OXT O N N 80 GLN H H N N 81 GLN H2 H N N 82 GLN HA H N N 83 GLN HB2 H N N 84 GLN HB3 H N N 85 GLN HG2 H N N 86 GLN HG3 H N N 87 GLN HE21 H N N 88 GLN HE22 H N N 89 GLN HXT H N N 90 GLU N N N N 91 GLU CA C N S 92 GLU C C N N 93 GLU O O N N 94 GLU CB C N N 95 GLU CG C N N 96 GLU CD C N N 97 GLU OE1 O N N 98 GLU OE2 O N N 99 GLU OXT O N N 100 GLU H H N N 101 GLU H2 H N N 102 GLU HA H N N 103 GLU HB2 H N N 104 GLU HB3 H N N 105 GLU HG2 H N N 106 GLU HG3 H N N 107 GLU HE2 H N N 108 GLU HXT H N N 109 GLY N N N N 110 GLY CA C N N 111 GLY C C N N 112 GLY O O N N 113 GLY OXT O N N 114 GLY H H N N 115 GLY H2 H N N 116 GLY HA2 H N N 117 GLY HA3 H N N 118 GLY HXT H N N 119 HIS N N N N 120 HIS CA C N S 121 HIS C C N N 122 HIS O O N N 123 HIS CB C N N 124 HIS CG C Y N 125 HIS ND1 N Y N 126 HIS CD2 C Y N 127 HIS CE1 C Y N 128 HIS NE2 N Y N 129 HIS OXT O N N 130 HIS H H N N 131 HIS H2 H N N 132 HIS HA H N N 133 HIS HB2 H N N 134 HIS HB3 H N N 135 HIS HD1 H N N 136 HIS HD2 H N N 137 HIS HE1 H N N 138 HIS HE2 H N N 139 HIS HXT H N N 140 ILE N N N N 141 ILE CA C N S 142 ILE C C N N 143 ILE O O N N 144 ILE CB C N S 145 ILE CG1 C N N 146 ILE CG2 C N N 147 ILE CD1 C N N 148 ILE OXT O N N 149 ILE H H N N 150 ILE H2 H N N 151 ILE HA H N N 152 ILE HB H N N 153 ILE HG12 H N N 154 ILE HG13 H N N 155 ILE HG21 H N N 156 ILE HG22 H N N 157 ILE HG23 H N N 158 ILE HD11 H N N 159 ILE HD12 H N N 160 ILE HD13 H N N 161 ILE HXT H N N 162 LEU N N N N 163 LEU CA C N S 164 LEU C C N N 165 LEU O O N N 166 LEU CB C N N 167 LEU CG C N N 168 LEU CD1 C N N 169 LEU CD2 C N N 170 LEU OXT O N N 171 LEU H H N N 172 LEU H2 H N N 173 LEU HA H N N 174 LEU HB2 H N N 175 LEU HB3 H N N 176 LEU HG H N N 177 LEU HD11 H N N 178 LEU HD12 H N N 179 LEU HD13 H N N 180 LEU HD21 H N N 181 LEU HD22 H N N 182 LEU HD23 H N N 183 LEU HXT H N N 184 LYS N N N N 185 LYS CA C N S 186 LYS C C N N 187 LYS O O N N 188 LYS CB C N N 189 LYS CG C N N 190 LYS CD C N N 191 LYS CE C N N 192 LYS NZ N N N 193 LYS OXT O N N 194 LYS H H N N 195 LYS H2 H N N 196 LYS HA H N N 197 LYS HB2 H N N 198 LYS HB3 H N N 199 LYS HG2 H N N 200 LYS HG3 H N N 201 LYS HD2 H N N 202 LYS HD3 H N N 203 LYS HE2 H N N 204 LYS HE3 H N N 205 LYS HZ1 H N N 206 LYS HZ2 H N N 207 LYS HZ3 H N N 208 LYS HXT H N N 209 MET N N N N 210 MET CA C N S 211 MET C C N N 212 MET O O N N 213 MET CB C N N 214 MET CG C N N 215 MET SD S N N 216 MET CE C N N 217 MET OXT O N N 218 MET H H N N 219 MET H2 H N N 220 MET HA H N N 221 MET HB2 H N N 222 MET HB3 H N N 223 MET HG2 H N N 224 MET HG3 H N N 225 MET HE1 H N N 226 MET HE2 H N N 227 MET HE3 H N N 228 MET HXT H N N 229 PHE N N N N 230 PHE CA C N S 231 PHE C C N N 232 PHE O O N N 233 PHE CB C N N 234 PHE CG C Y N 235 PHE CD1 C Y N 236 PHE CD2 C Y N 237 PHE CE1 C Y N 238 PHE CE2 C Y N 239 PHE CZ C Y N 240 PHE OXT O N N 241 PHE H H N N 242 PHE H2 H N N 243 PHE HA H N N 244 PHE HB2 H N N 245 PHE HB3 H N N 246 PHE HD1 H N N 247 PHE HD2 H N N 248 PHE HE1 H N N 249 PHE HE2 H N N 250 PHE HZ H N N 251 PHE HXT H N N 252 PRO N N N N 253 PRO CA C N S 254 PRO C C N N 255 PRO O O N N 256 PRO CB C N N 257 PRO CG C N N 258 PRO CD C N N 259 PRO OXT O N N 260 PRO H H N N 261 PRO HA H N N 262 PRO HB2 H N N 263 PRO HB3 H N N 264 PRO HG2 H N N 265 PRO HG3 H N N 266 PRO HD2 H N N 267 PRO HD3 H N N 268 PRO HXT H N N 269 SER N N N N 270 SER CA C N S 271 SER C C N N 272 SER O O N N 273 SER CB C N N 274 SER OG O N N 275 SER OXT O N N 276 SER H H N N 277 SER H2 H N N 278 SER HA H N N 279 SER HB2 H N N 280 SER HB3 H N N 281 SER HG H N N 282 SER HXT H N N 283 THR N N N N 284 THR CA C N S 285 THR C C N N 286 THR O O N N 287 THR CB C N R 288 THR OG1 O N N 289 THR CG2 C N N 290 THR OXT O N N 291 THR H H N N 292 THR H2 H N N 293 THR HA H N N 294 THR HB H N N 295 THR HG1 H N N 296 THR HG21 H N N 297 THR HG22 H N N 298 THR HG23 H N N 299 THR HXT H N N 300 TYR N N N N 301 TYR CA C N S 302 TYR C C N N 303 TYR O O N N 304 TYR CB C N N 305 TYR CG C Y N 306 TYR CD1 C Y N 307 TYR CD2 C Y N 308 TYR CE1 C Y N 309 TYR CE2 C Y N 310 TYR CZ C Y N 311 TYR OH O N N 312 TYR OXT O N N 313 TYR H H N N 314 TYR H2 H N N 315 TYR HA H N N 316 TYR HB2 H N N 317 TYR HB3 H N N 318 TYR HD1 H N N 319 TYR HD2 H N N 320 TYR HE1 H N N 321 TYR HE2 H N N 322 TYR HH H N N 323 TYR HXT H N N 324 VAL N N N N 325 VAL CA C N S 326 VAL C C N N 327 VAL O O N N 328 VAL CB C N N 329 VAL CG1 C N N 330 VAL CG2 C N N 331 VAL OXT O N N 332 VAL H H N N 333 VAL H2 H N N 334 VAL HA H N N 335 VAL HB H N N 336 VAL HG11 H N N 337 VAL HG12 H N N 338 VAL HG13 H N N 339 VAL HG21 H N N 340 VAL HG22 H N N 341 VAL HG23 H N N 342 VAL HXT H N N 343 ZN ZN ZN N N 344 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 CYS N CA sing N N 54 CYS N H sing N N 55 CYS N H2 sing N N 56 CYS CA C sing N N 57 CYS CA CB sing N N 58 CYS CA HA sing N N 59 CYS C O doub N N 60 CYS C OXT sing N N 61 CYS CB SG sing N N 62 CYS CB HB2 sing N N 63 CYS CB HB3 sing N N 64 CYS SG HG sing N N 65 CYS OXT HXT sing N N 66 GLN N CA sing N N 67 GLN N H sing N N 68 GLN N H2 sing N N 69 GLN CA C sing N N 70 GLN CA CB sing N N 71 GLN CA HA sing N N 72 GLN C O doub N N 73 GLN C OXT sing N N 74 GLN CB CG sing N N 75 GLN CB HB2 sing N N 76 GLN CB HB3 sing N N 77 GLN CG CD sing N N 78 GLN CG HG2 sing N N 79 GLN CG HG3 sing N N 80 GLN CD OE1 doub N N 81 GLN CD NE2 sing N N 82 GLN NE2 HE21 sing N N 83 GLN NE2 HE22 sing N N 84 GLN OXT HXT sing N N 85 GLU N CA sing N N 86 GLU N H sing N N 87 GLU N H2 sing N N 88 GLU CA C sing N N 89 GLU CA CB sing N N 90 GLU CA HA sing N N 91 GLU C O doub N N 92 GLU C OXT sing N N 93 GLU CB CG sing N N 94 GLU CB HB2 sing N N 95 GLU CB HB3 sing N N 96 GLU CG CD sing N N 97 GLU CG HG2 sing N N 98 GLU CG HG3 sing N N 99 GLU CD OE1 doub N N 100 GLU CD OE2 sing N N 101 GLU OE2 HE2 sing N N 102 GLU OXT HXT sing N N 103 GLY N CA sing N N 104 GLY N H sing N N 105 GLY N H2 sing N N 106 GLY CA C sing N N 107 GLY CA HA2 sing N N 108 GLY CA HA3 sing N N 109 GLY C O doub N N 110 GLY C OXT sing N N 111 GLY OXT HXT sing N N 112 HIS N CA sing N N 113 HIS N H sing N N 114 HIS N H2 sing N N 115 HIS CA C sing N N 116 HIS CA CB sing N N 117 HIS CA HA sing N N 118 HIS C O doub N N 119 HIS C OXT sing N N 120 HIS CB CG sing N N 121 HIS CB HB2 sing N N 122 HIS CB HB3 sing N N 123 HIS CG ND1 sing Y N 124 HIS CG CD2 doub Y N 125 HIS ND1 CE1 doub Y N 126 HIS ND1 HD1 sing N N 127 HIS CD2 NE2 sing Y N 128 HIS CD2 HD2 sing N N 129 HIS CE1 NE2 sing Y N 130 HIS CE1 HE1 sing N N 131 HIS NE2 HE2 sing N N 132 HIS OXT HXT sing N N 133 ILE N CA sing N N 134 ILE N H sing N N 135 ILE N H2 sing N N 136 ILE CA C sing N N 137 ILE CA CB sing N N 138 ILE CA HA sing N N 139 ILE C O doub N N 140 ILE C OXT sing N N 141 ILE CB CG1 sing N N 142 ILE CB CG2 sing N N 143 ILE CB HB sing N N 144 ILE CG1 CD1 sing N N 145 ILE CG1 HG12 sing N N 146 ILE CG1 HG13 sing N N 147 ILE CG2 HG21 sing N N 148 ILE CG2 HG22 sing N N 149 ILE CG2 HG23 sing N N 150 ILE CD1 HD11 sing N N 151 ILE CD1 HD12 sing N N 152 ILE CD1 HD13 sing N N 153 ILE OXT HXT sing N N 154 LEU N CA sing N N 155 LEU N H sing N N 156 LEU N H2 sing N N 157 LEU CA C sing N N 158 LEU CA CB sing N N 159 LEU CA HA sing N N 160 LEU C O doub N N 161 LEU C OXT sing N N 162 LEU CB CG sing N N 163 LEU CB HB2 sing N N 164 LEU CB HB3 sing N N 165 LEU CG CD1 sing N N 166 LEU CG CD2 sing N N 167 LEU CG HG sing N N 168 LEU CD1 HD11 sing N N 169 LEU CD1 HD12 sing N N 170 LEU CD1 HD13 sing N N 171 LEU CD2 HD21 sing N N 172 LEU CD2 HD22 sing N N 173 LEU CD2 HD23 sing N N 174 LEU OXT HXT sing N N 175 LYS N CA sing N N 176 LYS N H sing N N 177 LYS N H2 sing N N 178 LYS CA C sing N N 179 LYS CA CB sing N N 180 LYS CA HA sing N N 181 LYS C O doub N N 182 LYS C OXT sing N N 183 LYS CB CG sing N N 184 LYS CB HB2 sing N N 185 LYS CB HB3 sing N N 186 LYS CG CD sing N N 187 LYS CG HG2 sing N N 188 LYS CG HG3 sing N N 189 LYS CD CE sing N N 190 LYS CD HD2 sing N N 191 LYS CD HD3 sing N N 192 LYS CE NZ sing N N 193 LYS CE HE2 sing N N 194 LYS CE HE3 sing N N 195 LYS NZ HZ1 sing N N 196 LYS NZ HZ2 sing N N 197 LYS NZ HZ3 sing N N 198 LYS OXT HXT sing N N 199 MET N CA sing N N 200 MET N H sing N N 201 MET N H2 sing N N 202 MET CA C sing N N 203 MET CA CB sing N N 204 MET CA HA sing N N 205 MET C O doub N N 206 MET C OXT sing N N 207 MET CB CG sing N N 208 MET CB HB2 sing N N 209 MET CB HB3 sing N N 210 MET CG SD sing N N 211 MET CG HG2 sing N N 212 MET CG HG3 sing N N 213 MET SD CE sing N N 214 MET CE HE1 sing N N 215 MET CE HE2 sing N N 216 MET CE HE3 sing N N 217 MET OXT HXT sing N N 218 PHE N CA sing N N 219 PHE N H sing N N 220 PHE N H2 sing N N 221 PHE CA C sing N N 222 PHE CA CB sing N N 223 PHE CA HA sing N N 224 PHE C O doub N N 225 PHE C OXT sing N N 226 PHE CB CG sing N N 227 PHE CB HB2 sing N N 228 PHE CB HB3 sing N N 229 PHE CG CD1 doub Y N 230 PHE CG CD2 sing Y N 231 PHE CD1 CE1 sing Y N 232 PHE CD1 HD1 sing N N 233 PHE CD2 CE2 doub Y N 234 PHE CD2 HD2 sing N N 235 PHE CE1 CZ doub Y N 236 PHE CE1 HE1 sing N N 237 PHE CE2 CZ sing Y N 238 PHE CE2 HE2 sing N N 239 PHE CZ HZ sing N N 240 PHE OXT HXT sing N N 241 PRO N CA sing N N 242 PRO N CD sing N N 243 PRO N H sing N N 244 PRO CA C sing N N 245 PRO CA CB sing N N 246 PRO CA HA sing N N 247 PRO C O doub N N 248 PRO C OXT sing N N 249 PRO CB CG sing N N 250 PRO CB HB2 sing N N 251 PRO CB HB3 sing N N 252 PRO CG CD sing N N 253 PRO CG HG2 sing N N 254 PRO CG HG3 sing N N 255 PRO CD HD2 sing N N 256 PRO CD HD3 sing N N 257 PRO OXT HXT sing N N 258 SER N CA sing N N 259 SER N H sing N N 260 SER N H2 sing N N 261 SER CA C sing N N 262 SER CA CB sing N N 263 SER CA HA sing N N 264 SER C O doub N N 265 SER C OXT sing N N 266 SER CB OG sing N N 267 SER CB HB2 sing N N 268 SER CB HB3 sing N N 269 SER OG HG sing N N 270 SER OXT HXT sing N N 271 THR N CA sing N N 272 THR N H sing N N 273 THR N H2 sing N N 274 THR CA C sing N N 275 THR CA CB sing N N 276 THR CA HA sing N N 277 THR C O doub N N 278 THR C OXT sing N N 279 THR CB OG1 sing N N 280 THR CB CG2 sing N N 281 THR CB HB sing N N 282 THR OG1 HG1 sing N N 283 THR CG2 HG21 sing N N 284 THR CG2 HG22 sing N N 285 THR CG2 HG23 sing N N 286 THR OXT HXT sing N N 287 TYR N CA sing N N 288 TYR N H sing N N 289 TYR N H2 sing N N 290 TYR CA C sing N N 291 TYR CA CB sing N N 292 TYR CA HA sing N N 293 TYR C O doub N N 294 TYR C OXT sing N N 295 TYR CB CG sing N N 296 TYR CB HB2 sing N N 297 TYR CB HB3 sing N N 298 TYR CG CD1 doub Y N 299 TYR CG CD2 sing Y N 300 TYR CD1 CE1 sing Y N 301 TYR CD1 HD1 sing N N 302 TYR CD2 CE2 doub Y N 303 TYR CD2 HD2 sing N N 304 TYR CE1 CZ doub Y N 305 TYR CE1 HE1 sing N N 306 TYR CE2 CZ sing Y N 307 TYR CE2 HE2 sing N N 308 TYR CZ OH sing N N 309 TYR OH HH sing N N 310 TYR OXT HXT sing N N 311 VAL N CA sing N N 312 VAL N H sing N N 313 VAL N H2 sing N N 314 VAL CA C sing N N 315 VAL CA CB sing N N 316 VAL CA HA sing N N 317 VAL C O doub N N 318 VAL C OXT sing N N 319 VAL CB CG1 sing N N 320 VAL CB CG2 sing N N 321 VAL CB HB sing N N 322 VAL CG1 HG11 sing N N 323 VAL CG1 HG12 sing N N 324 VAL CG1 HG13 sing N N 325 VAL CG2 HG21 sing N N 326 VAL CG2 HG22 sing N N 327 VAL CG2 HG23 sing N N 328 VAL OXT HXT sing N N 329 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 # _atom_sites.entry_id 5FRF _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_