data_5H5P # _entry.id 5H5P # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.286 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5H5P WWPDB D_1300002081 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5H5P _pdbx_database_status.recvd_initial_deposition_date 2016-11-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Shi, N.' 1 ? 'Zhen, X.' 2 ? 'Li, B.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Rep' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2045-2322 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 7 _citation.language ? _citation.page_first 3696 _citation.page_last 3696 _citation.title 'Crystal structure of the DNA-binding domain of Myelin-gene Regulatory Factor.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41598-017-03768-9 _citation.pdbx_database_id_PubMed 28623291 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Zhen, X.' 1 primary 'Li, B.' 2 primary 'Hu, F.' 3 primary 'Yan, S.' 4 primary 'Meloni, G.' 5 primary 'Li, H.' 6 primary 'Shi, N.' 7 # _cell.entry_id 5H5P _cell.length_a 103.970 _cell.length_b 103.970 _cell.length_c 46.730 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5H5P _symmetry.space_group_name_H-M 'P 3 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 150 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Myelin regulatory factor' 21495.941 1 ? ? 'UNP residues 351-532' ? 2 water nat water 18.015 21 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Myelin gene regulatory factor' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;GPEIIKWQPHQQNKWATLYDANYKELP(MSE)LTYRVDADKGFNFSVGDDAFVCQKKNHFQVTVYIG(MSE)LGEPKYVK TPEGLKPLDCFYLKLHGVKLEALNQSINIEQSQSDRSKRPFNPVTVNLPPEQVTKVTVGRLHFSETTANN(MSE)RKKGK PNPDQRYF(MSE)LVVALQAHAQNQNYTLAAQISERIIVRAS ; _entity_poly.pdbx_seq_one_letter_code_can ;GPEIIKWQPHQQNKWATLYDANYKELPMLTYRVDADKGFNFSVGDDAFVCQKKNHFQVTVYIGMLGEPKYVKTPEGLKPL DCFYLKLHGVKLEALNQSINIEQSQSDRSKRPFNPVTVNLPPEQVTKVTVGRLHFSETTANNMRKKGKPNPDQRYFMLVV ALQAHAQNQNYTLAAQISERIIVRAS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 GLU n 1 4 ILE n 1 5 ILE n 1 6 LYS n 1 7 TRP n 1 8 GLN n 1 9 PRO n 1 10 HIS n 1 11 GLN n 1 12 GLN n 1 13 ASN n 1 14 LYS n 1 15 TRP n 1 16 ALA n 1 17 THR n 1 18 LEU n 1 19 TYR n 1 20 ASP n 1 21 ALA n 1 22 ASN n 1 23 TYR n 1 24 LYS n 1 25 GLU n 1 26 LEU n 1 27 PRO n 1 28 MSE n 1 29 LEU n 1 30 THR n 1 31 TYR n 1 32 ARG n 1 33 VAL n 1 34 ASP n 1 35 ALA n 1 36 ASP n 1 37 LYS n 1 38 GLY n 1 39 PHE n 1 40 ASN n 1 41 PHE n 1 42 SER n 1 43 VAL n 1 44 GLY n 1 45 ASP n 1 46 ASP n 1 47 ALA n 1 48 PHE n 1 49 VAL n 1 50 CYS n 1 51 GLN n 1 52 LYS n 1 53 LYS n 1 54 ASN n 1 55 HIS n 1 56 PHE n 1 57 GLN n 1 58 VAL n 1 59 THR n 1 60 VAL n 1 61 TYR n 1 62 ILE n 1 63 GLY n 1 64 MSE n 1 65 LEU n 1 66 GLY n 1 67 GLU n 1 68 PRO n 1 69 LYS n 1 70 TYR n 1 71 VAL n 1 72 LYS n 1 73 THR n 1 74 PRO n 1 75 GLU n 1 76 GLY n 1 77 LEU n 1 78 LYS n 1 79 PRO n 1 80 LEU n 1 81 ASP n 1 82 CYS n 1 83 PHE n 1 84 TYR n 1 85 LEU n 1 86 LYS n 1 87 LEU n 1 88 HIS n 1 89 GLY n 1 90 VAL n 1 91 LYS n 1 92 LEU n 1 93 GLU n 1 94 ALA n 1 95 LEU n 1 96 ASN n 1 97 GLN n 1 98 SER n 1 99 ILE n 1 100 ASN n 1 101 ILE n 1 102 GLU n 1 103 GLN n 1 104 SER n 1 105 GLN n 1 106 SER n 1 107 ASP n 1 108 ARG n 1 109 SER n 1 110 LYS n 1 111 ARG n 1 112 PRO n 1 113 PHE n 1 114 ASN n 1 115 PRO n 1 116 VAL n 1 117 THR n 1 118 VAL n 1 119 ASN n 1 120 LEU n 1 121 PRO n 1 122 PRO n 1 123 GLU n 1 124 GLN n 1 125 VAL n 1 126 THR n 1 127 LYS n 1 128 VAL n 1 129 THR n 1 130 VAL n 1 131 GLY n 1 132 ARG n 1 133 LEU n 1 134 HIS n 1 135 PHE n 1 136 SER n 1 137 GLU n 1 138 THR n 1 139 THR n 1 140 ALA n 1 141 ASN n 1 142 ASN n 1 143 MSE n 1 144 ARG n 1 145 LYS n 1 146 LYS n 1 147 GLY n 1 148 LYS n 1 149 PRO n 1 150 ASN n 1 151 PRO n 1 152 ASP n 1 153 GLN n 1 154 ARG n 1 155 TYR n 1 156 PHE n 1 157 MSE n 1 158 LEU n 1 159 VAL n 1 160 VAL n 1 161 ALA n 1 162 LEU n 1 163 GLN n 1 164 ALA n 1 165 HIS n 1 166 ALA n 1 167 GLN n 1 168 ASN n 1 169 GLN n 1 170 ASN n 1 171 TYR n 1 172 THR n 1 173 LEU n 1 174 ALA n 1 175 ALA n 1 176 GLN n 1 177 ILE n 1 178 SER n 1 179 GLU n 1 180 ARG n 1 181 ILE n 1 182 ILE n 1 183 VAL n 1 184 ARG n 1 185 ALA n 1 186 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 186 _entity_src_gen.gene_src_common_name Mouse _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Myrf, Gm1804, Gm98, Mrf' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MRF_MOUSE _struct_ref.pdbx_db_accession Q3UR85 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;IKWQPHQQNKWATLYDANYKELPMLTYRVDADKGFNFSVGDDAFVCQKKNHFQVTVYIGMLGEPKYVKTPEGLKPLDCFY LKLHGVKLEALNQSINIEQSQSDRSKRPFNPVTVNLPPEQVTKVTVGRLHFSETTANNMRKKGKPNPDQRYFMLVVALQA HAQNQNYTLAAQISERIIVRAS ; _struct_ref.pdbx_align_begin 351 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5H5P _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 186 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q3UR85 _struct_ref_seq.db_align_beg 351 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 532 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 351 _struct_ref_seq.pdbx_auth_seq_align_end 532 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5H5P GLY A 1 ? UNP Q3UR85 ? ? 'expression tag' 347 1 1 5H5P PRO A 2 ? UNP Q3UR85 ? ? 'expression tag' 348 2 1 5H5P GLU A 3 ? UNP Q3UR85 ? ? 'expression tag' 349 3 1 5H5P ILE A 4 ? UNP Q3UR85 ? ? 'expression tag' 350 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5H5P _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.41 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 63.89 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'Tris, Magnesium acetate, PEG4000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-12-07 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17U' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.979 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17U _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5H5P _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.366 _reflns.d_resolution_low 44.95 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 24100 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.77 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 8.8 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.52 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high . _reflns_shell.d_res_low ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 5H5P _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 20442 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 34.032 _refine.ls_d_res_high 2.461 _refine.ls_percent_reflns_obs 99.56 _refine.ls_R_factor_obs 0.1796 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1747 _refine.ls_R_factor_R_free 0.2239 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 9.97 _refine.ls_number_reflns_R_free 2038 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.38 _refine.pdbx_overall_phase_error 24.77 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1489 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 21 _refine_hist.number_atoms_total 1510 _refine_hist.d_res_high 2.461 _refine_hist.d_res_low 34.032 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.010 ? ? 1536 'X-RAY DIFFRACTION' ? f_angle_d 1.209 ? ? 2083 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 15.895 ? ? 587 'X-RAY DIFFRACTION' ? f_chiral_restr 0.048 ? ? 226 'X-RAY DIFFRACTION' ? f_plane_restr 0.005 ? ? 272 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.number_reflns_obs 'X-RAY DIFFRACTION' . 2.4606 2.5179 1160 0.3909 95.00 0.4618 . . 123 . . . . 'X-RAY DIFFRACTION' . 2.5179 2.5808 1253 0.2589 100.00 0.3620 . . 132 . . . . 'X-RAY DIFFRACTION' . 2.5808 2.6506 1232 0.2212 100.00 0.2783 . . 130 . . . . 'X-RAY DIFFRACTION' . 2.6506 2.7285 1239 0.2356 100.00 0.3208 . . 132 . . . . 'X-RAY DIFFRACTION' . 2.7285 2.8166 1245 0.2188 100.00 0.2798 . . 135 . . . . 'X-RAY DIFFRACTION' . 2.8166 2.9172 1216 0.2302 100.00 0.2826 . . 136 . . . . 'X-RAY DIFFRACTION' . 2.9172 3.0339 1210 0.2065 100.00 0.2511 . . 138 . . . . 'X-RAY DIFFRACTION' . 3.0339 3.1719 1259 0.1969 100.00 0.2700 . . 147 . . . . 'X-RAY DIFFRACTION' . 3.1719 3.3390 1225 0.1830 100.00 0.2589 . . 136 . . . . 'X-RAY DIFFRACTION' . 3.3390 3.5480 1211 0.1675 100.00 0.2265 . . 148 . . . . 'X-RAY DIFFRACTION' . 3.5480 3.8216 1238 0.1620 100.00 0.2279 . . 128 . . . . 'X-RAY DIFFRACTION' . 3.8216 4.2055 1231 0.1449 100.00 0.1913 . . 138 . . . . 'X-RAY DIFFRACTION' . 4.2055 4.8126 1229 0.1295 100.00 0.1891 . . 132 . . . . 'X-RAY DIFFRACTION' . 4.8126 6.0578 1225 0.1501 100.00 0.1530 . . 143 . . . . 'X-RAY DIFFRACTION' . 6.0578 34.0354 1231 0.1711 100.00 0.2070 . . 140 . . . . # _struct.entry_id 5H5P _struct.title 'Crystal structure of Myelin-gene Regulatory Factor DNA binding domain' _struct.pdbx_descriptor 'Myelin regulatory factor' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5H5P _struct_keywords.text 'Ig fold transcription factor, ER membrane protein, trimeric transcription factor, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id GLN _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 11 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id TRP _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 15 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLN _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 357 _struct_conf.end_auth_comp_id TRP _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 361 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale both ? A PRO 27 C ? ? ? 1_555 A MSE 28 N ? ? A PRO 373 A MSE 374 1_555 ? ? ? ? ? ? ? 1.331 ? covale2 covale both ? A MSE 28 C ? ? ? 1_555 A LEU 29 N ? ? A MSE 374 A LEU 375 1_555 ? ? ? ? ? ? ? 1.316 ? covale3 covale both ? A GLY 63 C ? ? ? 1_555 A MSE 64 N ? ? A GLY 409 A MSE 410 1_555 ? ? ? ? ? ? ? 1.329 ? covale4 covale both ? A MSE 64 C ? ? ? 1_555 A LEU 65 N ? ? A MSE 410 A LEU 411 1_555 ? ? ? ? ? ? ? 1.326 ? covale5 covale both ? A ASN 142 C ? ? ? 1_555 A MSE 143 N ? ? A ASN 488 A MSE 489 1_555 ? ? ? ? ? ? ? 1.331 ? covale6 covale both ? A MSE 143 C ? ? ? 1_555 A ARG 144 N ? ? A MSE 489 A ARG 490 1_555 ? ? ? ? ? ? ? 1.326 ? covale7 covale both ? A PHE 156 C ? ? ? 1_555 A MSE 157 N ? ? A PHE 502 A MSE 503 1_555 ? ? ? ? ? ? ? 1.324 ? covale8 covale both ? A MSE 157 C ? ? ? 1_555 A LEU 158 N ? ? A MSE 503 A LEU 504 1_555 ? ? ? ? ? ? ? 1.326 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 5 ? AA3 ? 3 ? AA4 ? 5 ? AA5 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA4 3 4 ? anti-parallel AA4 4 5 ? anti-parallel AA5 1 2 ? anti-parallel AA5 2 3 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TRP A 7 ? PRO A 9 ? TRP A 353 PRO A 355 AA1 2 GLN A 169 ? SER A 178 ? GLN A 515 SER A 524 AA1 3 PHE A 156 ? ALA A 166 ? PHE A 502 ALA A 512 AA1 4 CYS A 82 ? LYS A 91 ? CYS A 428 LYS A 437 AA1 5 ALA A 94 ? ILE A 99 ? ALA A 440 ILE A 445 AA2 1 TRP A 7 ? PRO A 9 ? TRP A 353 PRO A 355 AA2 2 GLN A 169 ? SER A 178 ? GLN A 515 SER A 524 AA2 3 PHE A 156 ? ALA A 166 ? PHE A 502 ALA A 512 AA2 4 CYS A 82 ? LYS A 91 ? CYS A 428 LYS A 437 AA2 5 VAL A 116 ? VAL A 118 ? VAL A 462 VAL A 464 AA3 1 THR A 17 ? ASP A 20 ? THR A 363 ASP A 366 AA3 2 PRO A 68 ? THR A 73 ? PRO A 414 THR A 419 AA3 3 GLY A 76 ? PRO A 79 ? GLY A 422 PRO A 425 AA4 1 THR A 30 ? ASP A 34 ? THR A 376 ASP A 380 AA4 2 PHE A 56 ? GLY A 63 ? PHE A 402 GLY A 409 AA4 3 VAL A 125 ? PHE A 135 ? VAL A 471 PHE A 481 AA4 4 ILE A 101 ? SER A 104 ? ILE A 447 SER A 450 AA4 5 LYS A 110 ? PRO A 112 ? LYS A 456 PRO A 458 AA5 1 ASN A 40 ? SER A 42 ? ASN A 386 SER A 388 AA5 2 ALA A 47 ? GLN A 51 ? ALA A 393 GLN A 397 AA5 3 ILE A 181 ? ARG A 184 ? ILE A 527 ARG A 530 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLN A 8 ? N GLN A 354 O ILE A 177 ? O ILE A 523 AA1 2 3 O ALA A 174 ? O ALA A 520 N LEU A 162 ? N LEU A 508 AA1 3 4 O GLN A 163 ? O GLN A 509 N TYR A 84 ? N TYR A 430 AA1 4 5 N GLY A 89 ? N GLY A 435 O ILE A 99 ? O ILE A 445 AA2 1 2 N GLN A 8 ? N GLN A 354 O ILE A 177 ? O ILE A 523 AA2 2 3 O ALA A 174 ? O ALA A 520 N LEU A 162 ? N LEU A 508 AA2 3 4 O GLN A 163 ? O GLN A 509 N TYR A 84 ? N TYR A 430 AA2 4 5 N LEU A 85 ? N LEU A 431 O VAL A 116 ? O VAL A 462 AA3 1 2 N TYR A 19 ? N TYR A 365 O TYR A 70 ? O TYR A 416 AA3 2 3 N VAL A 71 ? N VAL A 417 O LYS A 78 ? O LYS A 424 AA4 1 2 N ASP A 34 ? N ASP A 380 O THR A 59 ? O THR A 405 AA4 2 3 N VAL A 58 ? N VAL A 404 O VAL A 130 ? O VAL A 476 AA4 3 4 O HIS A 134 ? O HIS A 480 N GLU A 102 ? N GLU A 448 AA4 4 5 N GLN A 103 ? N GLN A 449 O ARG A 111 ? O ARG A 457 AA5 1 2 N ASN A 40 ? N ASN A 386 O VAL A 49 ? O VAL A 395 AA5 2 3 N PHE A 48 ? N PHE A 394 O ILE A 182 ? O ILE A 528 # _atom_sites.entry_id 5H5P _atom_sites.fract_transf_matrix[1][1] 0.009618 _atom_sites.fract_transf_matrix[1][2] 0.005553 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011106 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.021400 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 347 ? ? ? A . n A 1 2 PRO 2 348 ? ? ? A . n A 1 3 GLU 3 349 349 GLU GLU A . n A 1 4 ILE 4 350 350 ILE ILE A . n A 1 5 ILE 5 351 351 ILE ILE A . n A 1 6 LYS 6 352 352 LYS LYS A . n A 1 7 TRP 7 353 353 TRP TRP A . n A 1 8 GLN 8 354 354 GLN GLN A . n A 1 9 PRO 9 355 355 PRO PRO A . n A 1 10 HIS 10 356 356 HIS HIS A . n A 1 11 GLN 11 357 357 GLN GLN A . n A 1 12 GLN 12 358 358 GLN GLN A . n A 1 13 ASN 13 359 359 ASN ASN A . n A 1 14 LYS 14 360 360 LYS LYS A . n A 1 15 TRP 15 361 361 TRP TRP A . n A 1 16 ALA 16 362 362 ALA ALA A . n A 1 17 THR 17 363 363 THR THR A . n A 1 18 LEU 18 364 364 LEU LEU A . n A 1 19 TYR 19 365 365 TYR TYR A . n A 1 20 ASP 20 366 366 ASP ASP A . n A 1 21 ALA 21 367 367 ALA ALA A . n A 1 22 ASN 22 368 368 ASN ASN A . n A 1 23 TYR 23 369 369 TYR TYR A . n A 1 24 LYS 24 370 370 LYS LYS A . n A 1 25 GLU 25 371 371 GLU GLU A . n A 1 26 LEU 26 372 372 LEU LEU A . n A 1 27 PRO 27 373 373 PRO PRO A . n A 1 28 MSE 28 374 374 MSE MSE A . n A 1 29 LEU 29 375 375 LEU LEU A . n A 1 30 THR 30 376 376 THR THR A . n A 1 31 TYR 31 377 377 TYR TYR A . n A 1 32 ARG 32 378 378 ARG ARG A . n A 1 33 VAL 33 379 379 VAL VAL A . n A 1 34 ASP 34 380 380 ASP ASP A . n A 1 35 ALA 35 381 381 ALA ALA A . n A 1 36 ASP 36 382 382 ASP ASP A . n A 1 37 LYS 37 383 383 LYS LYS A . n A 1 38 GLY 38 384 384 GLY GLY A . n A 1 39 PHE 39 385 385 PHE PHE A . n A 1 40 ASN 40 386 386 ASN ASN A . n A 1 41 PHE 41 387 387 PHE PHE A . n A 1 42 SER 42 388 388 SER SER A . n A 1 43 VAL 43 389 389 VAL VAL A . n A 1 44 GLY 44 390 390 GLY GLY A . n A 1 45 ASP 45 391 391 ASP ASP A . n A 1 46 ASP 46 392 392 ASP ASP A . n A 1 47 ALA 47 393 393 ALA ALA A . n A 1 48 PHE 48 394 394 PHE PHE A . n A 1 49 VAL 49 395 395 VAL VAL A . n A 1 50 CYS 50 396 396 CYS CYS A . n A 1 51 GLN 51 397 397 GLN GLN A . n A 1 52 LYS 52 398 398 LYS LYS A . n A 1 53 LYS 53 399 399 LYS LYS A . n A 1 54 ASN 54 400 400 ASN ASN A . n A 1 55 HIS 55 401 401 HIS HIS A . n A 1 56 PHE 56 402 402 PHE PHE A . n A 1 57 GLN 57 403 403 GLN GLN A . n A 1 58 VAL 58 404 404 VAL VAL A . n A 1 59 THR 59 405 405 THR THR A . n A 1 60 VAL 60 406 406 VAL VAL A . n A 1 61 TYR 61 407 407 TYR TYR A . n A 1 62 ILE 62 408 408 ILE ILE A . n A 1 63 GLY 63 409 409 GLY GLY A . n A 1 64 MSE 64 410 410 MSE MSE A . n A 1 65 LEU 65 411 411 LEU LEU A . n A 1 66 GLY 66 412 412 GLY GLY A . n A 1 67 GLU 67 413 413 GLU GLU A . n A 1 68 PRO 68 414 414 PRO PRO A . n A 1 69 LYS 69 415 415 LYS LYS A . n A 1 70 TYR 70 416 416 TYR TYR A . n A 1 71 VAL 71 417 417 VAL VAL A . n A 1 72 LYS 72 418 418 LYS LYS A . n A 1 73 THR 73 419 419 THR THR A . n A 1 74 PRO 74 420 420 PRO PRO A . n A 1 75 GLU 75 421 421 GLU GLU A . n A 1 76 GLY 76 422 422 GLY GLY A . n A 1 77 LEU 77 423 423 LEU LEU A . n A 1 78 LYS 78 424 424 LYS LYS A . n A 1 79 PRO 79 425 425 PRO PRO A . n A 1 80 LEU 80 426 426 LEU LEU A . n A 1 81 ASP 81 427 427 ASP ASP A . n A 1 82 CYS 82 428 428 CYS CYS A . n A 1 83 PHE 83 429 429 PHE PHE A . n A 1 84 TYR 84 430 430 TYR TYR A . n A 1 85 LEU 85 431 431 LEU LEU A . n A 1 86 LYS 86 432 432 LYS LYS A . n A 1 87 LEU 87 433 433 LEU LEU A . n A 1 88 HIS 88 434 434 HIS HIS A . n A 1 89 GLY 89 435 435 GLY GLY A . n A 1 90 VAL 90 436 436 VAL VAL A . n A 1 91 LYS 91 437 437 LYS LYS A . n A 1 92 LEU 92 438 438 LEU LEU A . n A 1 93 GLU 93 439 439 GLU GLU A . n A 1 94 ALA 94 440 440 ALA ALA A . n A 1 95 LEU 95 441 441 LEU LEU A . n A 1 96 ASN 96 442 442 ASN ASN A . n A 1 97 GLN 97 443 443 GLN GLN A . n A 1 98 SER 98 444 444 SER SER A . n A 1 99 ILE 99 445 445 ILE ILE A . n A 1 100 ASN 100 446 446 ASN ASN A . n A 1 101 ILE 101 447 447 ILE ILE A . n A 1 102 GLU 102 448 448 GLU GLU A . n A 1 103 GLN 103 449 449 GLN GLN A . n A 1 104 SER 104 450 450 SER SER A . n A 1 105 GLN 105 451 451 GLN GLN A . n A 1 106 SER 106 452 452 SER SER A . n A 1 107 ASP 107 453 453 ASP ASP A . n A 1 108 ARG 108 454 454 ARG ARG A . n A 1 109 SER 109 455 455 SER SER A . n A 1 110 LYS 110 456 456 LYS LYS A . n A 1 111 ARG 111 457 457 ARG ARG A . n A 1 112 PRO 112 458 458 PRO PRO A . n A 1 113 PHE 113 459 459 PHE PHE A . n A 1 114 ASN 114 460 460 ASN ASN A . n A 1 115 PRO 115 461 461 PRO PRO A . n A 1 116 VAL 116 462 462 VAL VAL A . n A 1 117 THR 117 463 463 THR THR A . n A 1 118 VAL 118 464 464 VAL VAL A . n A 1 119 ASN 119 465 465 ASN ASN A . n A 1 120 LEU 120 466 466 LEU LEU A . n A 1 121 PRO 121 467 467 PRO PRO A . n A 1 122 PRO 122 468 468 PRO PRO A . n A 1 123 GLU 123 469 469 GLU GLU A . n A 1 124 GLN 124 470 470 GLN GLN A . n A 1 125 VAL 125 471 471 VAL VAL A . n A 1 126 THR 126 472 472 THR THR A . n A 1 127 LYS 127 473 473 LYS LYS A . n A 1 128 VAL 128 474 474 VAL VAL A . n A 1 129 THR 129 475 475 THR THR A . n A 1 130 VAL 130 476 476 VAL VAL A . n A 1 131 GLY 131 477 477 GLY GLY A . n A 1 132 ARG 132 478 478 ARG ARG A . n A 1 133 LEU 133 479 479 LEU LEU A . n A 1 134 HIS 134 480 480 HIS HIS A . n A 1 135 PHE 135 481 481 PHE PHE A . n A 1 136 SER 136 482 482 SER SER A . n A 1 137 GLU 137 483 483 GLU GLU A . n A 1 138 THR 138 484 484 THR THR A . n A 1 139 THR 139 485 485 THR THR A . n A 1 140 ALA 140 486 486 ALA ALA A . n A 1 141 ASN 141 487 487 ASN ASN A . n A 1 142 ASN 142 488 488 ASN ASN A . n A 1 143 MSE 143 489 489 MSE MSE A . n A 1 144 ARG 144 490 490 ARG ARG A . n A 1 145 LYS 145 491 491 LYS LYS A . n A 1 146 LYS 146 492 492 LYS LYS A . n A 1 147 GLY 147 493 493 GLY GLY A . n A 1 148 LYS 148 494 494 LYS LYS A . n A 1 149 PRO 149 495 495 PRO PRO A . n A 1 150 ASN 150 496 496 ASN ASN A . n A 1 151 PRO 151 497 497 PRO PRO A . n A 1 152 ASP 152 498 498 ASP ASP A . n A 1 153 GLN 153 499 499 GLN GLN A . n A 1 154 ARG 154 500 500 ARG ARG A . n A 1 155 TYR 155 501 501 TYR TYR A . n A 1 156 PHE 156 502 502 PHE PHE A . n A 1 157 MSE 157 503 503 MSE MSE A . n A 1 158 LEU 158 504 504 LEU LEU A . n A 1 159 VAL 159 505 505 VAL VAL A . n A 1 160 VAL 160 506 506 VAL VAL A . n A 1 161 ALA 161 507 507 ALA ALA A . n A 1 162 LEU 162 508 508 LEU LEU A . n A 1 163 GLN 163 509 509 GLN GLN A . n A 1 164 ALA 164 510 510 ALA ALA A . n A 1 165 HIS 165 511 511 HIS HIS A . n A 1 166 ALA 166 512 512 ALA ALA A . n A 1 167 GLN 167 513 513 GLN GLN A . n A 1 168 ASN 168 514 514 ASN ASN A . n A 1 169 GLN 169 515 515 GLN GLN A . n A 1 170 ASN 170 516 516 ASN ASN A . n A 1 171 TYR 171 517 517 TYR TYR A . n A 1 172 THR 172 518 518 THR THR A . n A 1 173 LEU 173 519 519 LEU LEU A . n A 1 174 ALA 174 520 520 ALA ALA A . n A 1 175 ALA 175 521 521 ALA ALA A . n A 1 176 GLN 176 522 522 GLN GLN A . n A 1 177 ILE 177 523 523 ILE ILE A . n A 1 178 SER 178 524 524 SER SER A . n A 1 179 GLU 179 525 525 GLU GLU A . n A 1 180 ARG 180 526 526 ARG ARG A . n A 1 181 ILE 181 527 527 ILE ILE A . n A 1 182 ILE 182 528 528 ILE ILE A . n A 1 183 VAL 183 529 529 VAL VAL A . n A 1 184 ARG 184 530 530 ARG ARG A . n A 1 185 ALA 185 531 531 ALA ALA A . n A 1 186 SER 186 532 532 SER SER A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 601 2 HOH HOH A . B 2 HOH 2 602 8 HOH HOH A . B 2 HOH 3 603 11 HOH HOH A . B 2 HOH 4 604 1 HOH HOH A . B 2 HOH 5 605 17 HOH HOH A . B 2 HOH 6 606 3 HOH HOH A . B 2 HOH 7 607 5 HOH HOH A . B 2 HOH 8 608 7 HOH HOH A . B 2 HOH 9 609 16 HOH HOH A . B 2 HOH 10 610 21 HOH HOH A . B 2 HOH 11 611 20 HOH HOH A . B 2 HOH 12 612 15 HOH HOH A . B 2 HOH 13 613 9 HOH HOH A . B 2 HOH 14 614 10 HOH HOH A . B 2 HOH 15 615 4 HOH HOH A . B 2 HOH 16 616 18 HOH HOH A . B 2 HOH 17 617 14 HOH HOH A . B 2 HOH 18 618 19 HOH HOH A . B 2 HOH 19 619 6 HOH HOH A . B 2 HOH 20 620 12 HOH HOH A . B 2 HOH 21 621 13 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 28 A MSE 374 ? MET 'modified residue' 2 A MSE 64 A MSE 410 ? MET 'modified residue' 3 A MSE 143 A MSE 489 ? MET 'modified residue' 4 A MSE 157 A MSE 503 ? MET 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B 1 2 A,B 1 3 A,B # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_545 -y,x-y-1,z -0.5000000000 -0.8660254038 0.0000000000 51.9850000000 0.8660254038 -0.5000000000 0.0000000000 -90.0406612315 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_655 -x+y+1,-x,z -0.5000000000 0.8660254038 0.0000000000 103.9700000000 -0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-06-28 2 'Structure model' 1 1 2017-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Author supporting evidence' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 2 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category pdbx_audit_support # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 2 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_audit_support.funding_organization' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 382 ? ? -76.72 -77.84 2 1 LYS A 415 ? ? -140.50 -29.03 3 1 ALA A 440 ? ? -155.26 76.61 4 1 ARG A 454 ? ? 59.67 18.34 5 1 GLU A 469 ? ? 57.24 18.25 6 1 ASN A 487 ? ? 70.77 35.61 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 347 ? A GLY 1 2 1 Y 1 A PRO 348 ? A PRO 2 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Natural Science Foundation of China' China 31570763 1 'Chinese Academy of Sciences' China '100 Talents Program' 2 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #