data_5HM6 # _entry.id 5HM6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5HM6 pdb_00005hm6 10.2210/pdb5hm6/pdb WWPDB D_1000217298 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.details 'C-terminal effector domain of BfmR from Acinetobacter baumannii' _pdbx_database_related.db_id 2NAZ _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5HM6 _pdbx_database_status.recvd_initial_deposition_date 2016-01-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Roth, B.R.' 1 'Davies, C.' 2 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Mol. Biol.' _citation.journal_id_ASTM JMOBAK _citation.journal_id_CSD 0070 _citation.journal_id_ISSN 1089-8638 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;The Structure of the Biofilm-controlling Response Regulator BfmR from Acinetobacter baumannii Reveals Details of Its DNA-binding Mechanism. ; _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jmb.2018.02.002 _citation.pdbx_database_id_PubMed 29438671 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Draughn, G.L.' 1 ? primary 'Milton, M.E.' 2 ? primary 'Feldmann, E.A.' 3 ? primary 'Bobay, B.G.' 4 ? primary 'Roth, B.M.' 5 ? primary 'Olson, A.L.' 6 ? primary 'Thompson, R.J.' 7 ? primary 'Actis, L.A.' 8 ? primary 'Davies, C.' 9 ? primary 'Cavanagh, J.' 10 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5HM6 _cell.details ? _cell.formula_units_Z ? _cell.length_a 51.800 _cell.length_a_esd ? _cell.length_b 51.800 _cell.length_b_esd ? _cell.length_c 197.600 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5HM6 _symmetry.cell_setting ? _symmetry.Int_Tables_number 170 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man BfmR 15115.442 2 ? ? 'N-terminal domain (UNP residues 1-130)' ? 2 water nat water 18.015 34 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Chemotaxis protein CheY,Transcriptional regulatory protein RstA,Transcriptional regulatory protein rstA,Transcriptional regulatory,C terminal family protein,Two-component regulatory system response regulator,Two-component system response regulator,Two-component system response regulator protein ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMSQEEKLPKILIVEDDERLARLTQEYLIRNGLEVGVETDGNRAIRRIISEQPDLVVLDVMLPGADGLTVCREVRPHY HQPILMLTARTEDMDQVLGLEMGADDYVAKPVQPRVLLARIRALLRRTDKTVE ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMSQEEKLPKILIVEDDERLARLTQEYLIRNGLEVGVETDGNRAIRRIISEQPDLVVLDVMLPGADGLTVCREVRPHY HQPILMLTARTEDMDQVLGLEMGADDYVAKPVQPRVLLARIRALLRRTDKTVE ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 SER n 1 6 GLN n 1 7 GLU n 1 8 GLU n 1 9 LYS n 1 10 LEU n 1 11 PRO n 1 12 LYS n 1 13 ILE n 1 14 LEU n 1 15 ILE n 1 16 VAL n 1 17 GLU n 1 18 ASP n 1 19 ASP n 1 20 GLU n 1 21 ARG n 1 22 LEU n 1 23 ALA n 1 24 ARG n 1 25 LEU n 1 26 THR n 1 27 GLN n 1 28 GLU n 1 29 TYR n 1 30 LEU n 1 31 ILE n 1 32 ARG n 1 33 ASN n 1 34 GLY n 1 35 LEU n 1 36 GLU n 1 37 VAL n 1 38 GLY n 1 39 VAL n 1 40 GLU n 1 41 THR n 1 42 ASP n 1 43 GLY n 1 44 ASN n 1 45 ARG n 1 46 ALA n 1 47 ILE n 1 48 ARG n 1 49 ARG n 1 50 ILE n 1 51 ILE n 1 52 SER n 1 53 GLU n 1 54 GLN n 1 55 PRO n 1 56 ASP n 1 57 LEU n 1 58 VAL n 1 59 VAL n 1 60 LEU n 1 61 ASP n 1 62 VAL n 1 63 MET n 1 64 LEU n 1 65 PRO n 1 66 GLY n 1 67 ALA n 1 68 ASP n 1 69 GLY n 1 70 LEU n 1 71 THR n 1 72 VAL n 1 73 CYS n 1 74 ARG n 1 75 GLU n 1 76 VAL n 1 77 ARG n 1 78 PRO n 1 79 HIS n 1 80 TYR n 1 81 HIS n 1 82 GLN n 1 83 PRO n 1 84 ILE n 1 85 LEU n 1 86 MET n 1 87 LEU n 1 88 THR n 1 89 ALA n 1 90 ARG n 1 91 THR n 1 92 GLU n 1 93 ASP n 1 94 MET n 1 95 ASP n 1 96 GLN n 1 97 VAL n 1 98 LEU n 1 99 GLY n 1 100 LEU n 1 101 GLU n 1 102 MET n 1 103 GLY n 1 104 ALA n 1 105 ASP n 1 106 ASP n 1 107 TYR n 1 108 VAL n 1 109 ALA n 1 110 LYS n 1 111 PRO n 1 112 VAL n 1 113 GLN n 1 114 PRO n 1 115 ARG n 1 116 VAL n 1 117 LEU n 1 118 LEU n 1 119 ALA n 1 120 ARG n 1 121 ILE n 1 122 ARG n 1 123 ALA n 1 124 LEU n 1 125 LEU n 1 126 ARG n 1 127 ARG n 1 128 THR n 1 129 ASP n 1 130 LYS n 1 131 THR n 1 132 VAL n 1 133 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 133 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'bfmR, rstA' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Acinetobacter baumannii' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 470 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21 ' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q2VSW6_ACIBA _struct_ref.pdbx_db_accession Q2VSW6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSQEEKLPKILIVEDDERLARLTQEYLIRNGLEVGVETDGNRAIRRIISEQPDLVVLDVMLPGADGLTVCREVRPHYHQP ILMLTARTEDMDQVLGLEMGADDYVAKPVQPRVLLARIRALLRRTDKTVE ; _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5HM6 A 4 ? 133 ? Q2VSW6 1 ? 130 ? 1 130 2 1 5HM6 B 4 ? 133 ? Q2VSW6 1 ? 130 ? 1 130 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5HM6 GLY A 1 ? UNP Q2VSW6 ? ? 'expression tag' -2 1 1 5HM6 SER A 2 ? UNP Q2VSW6 ? ? 'expression tag' -1 2 1 5HM6 HIS A 3 ? UNP Q2VSW6 ? ? 'expression tag' 0 3 2 5HM6 GLY B 1 ? UNP Q2VSW6 ? ? 'expression tag' -2 4 2 5HM6 SER B 2 ? UNP Q2VSW6 ? ? 'expression tag' -1 5 2 5HM6 HIS B 3 ? UNP Q2VSW6 ? ? 'expression tag' 0 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5HM6 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.53 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 51.41 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M Bis-Tris propane pH 8.0 and 20% (v/v) MeOH' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 225 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-06-10 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 22-BM' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.00 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 22-BM _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 25.8 _reflns.entry_id 5HM6 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.0 _reflns.d_resolution_low 45.0 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 20243 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F 0.0 _reflns.observed_criterion_sigma_I 0.0 _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.0 _reflns.pdbx_Rmerge_I_obs 0.101 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI 20.0 _reflns.pdbx_netI_over_sigmaI 20.0 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.00 _reflns_shell.d_res_low 2.03 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.1 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 99.6 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.617 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 5.5 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 0.19 _refine.aniso_B[1][2] 0.10 _refine.aniso_B[1][3] -0.00 _refine.aniso_B[2][2] 0.19 _refine.aniso_B[2][3] -0.00 _refine.aniso_B[3][3] -0.63 _refine.B_iso_max ? _refine.B_iso_mean 31.1 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.948 _refine.correlation_coeff_Fo_to_Fc_free 0.943 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5HM6 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.00 _refine.ls_d_res_low 44.86 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 19174 _refine.ls_number_reflns_R_free 989 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.93 _refine.ls_percent_reflns_R_free 4.9 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.20241 _refine.ls_R_factor_R_free 0.227 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.201 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'FOURIER SYNTHESIS' _refine.pdbx_starting_model 3NHZ _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.168 _refine.pdbx_overall_ESU_R_Free 0.146 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 4.093 _refine.overall_SU_ML 0.112 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1894 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 34 _refine_hist.number_atoms_total 1928 _refine_hist.d_res_high 2.00 _refine_hist.d_res_low 44.86 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 0.019 1916 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.428 2.010 2592 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.580 5.000 236 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 40.824 22.667 90 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 16.315 15.000 364 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 20.471 15.000 28 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.089 0.200 310 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 0.021 1412 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 1.538 2.897 950 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 2.420 4.330 1184 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 2.377 3.251 966 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 5.264 24.237 2850 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.000 _refine_ls_shell.d_res_low 2.052 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 72 _refine_ls_shell.number_reflns_R_work 1383 _refine_ls_shell.percent_reflns_obs 99.66 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.277 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.270 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5HM6 _struct.title 'N-terminal domain of BfmR from Acinetobacter baumannii' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5HM6 _struct_keywords.text 'response regulator, biofilm, two-component system, A. baumannii, TRANSCRIPTION REGULATOR' _struct_keywords.pdbx_keywords 'TRANSCRIPTION REGULATOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 19 ? ARG A 32 ? ASP A 16 ARG A 29 1 ? 14 HELX_P HELX_P2 AA2 ASP A 42 ? GLN A 54 ? ASP A 39 GLN A 51 1 ? 13 HELX_P HELX_P3 AA3 ASP A 68 ? ARG A 77 ? ASP A 65 ARG A 74 1 ? 10 HELX_P HELX_P4 AA4 PRO A 78 ? TYR A 80 ? PRO A 75 TYR A 77 5 ? 3 HELX_P HELX_P5 AA5 GLU A 92 ? GLY A 103 ? GLU A 89 GLY A 100 1 ? 12 HELX_P HELX_P6 AA6 GLN A 113 ? ARG A 127 ? GLN A 110 ARG A 124 1 ? 15 HELX_P HELX_P7 AA7 ASP B 19 ? ARG B 32 ? ASP B 16 ARG B 29 1 ? 14 HELX_P HELX_P8 AA8 ASP B 42 ? GLN B 54 ? ASP B 39 GLN B 51 1 ? 13 HELX_P HELX_P9 AA9 ASP B 68 ? ARG B 77 ? ASP B 65 ARG B 74 1 ? 10 HELX_P HELX_P10 AB1 PRO B 78 ? TYR B 80 ? PRO B 75 TYR B 77 5 ? 3 HELX_P HELX_P11 AB2 GLU B 92 ? MET B 102 ? GLU B 89 MET B 99 1 ? 11 HELX_P HELX_P12 AB3 GLN B 113 ? ARG B 127 ? GLN B 110 ARG B 124 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 LYS 110 A . ? LYS 107 A PRO 111 A ? PRO 108 A 1 -5.25 2 LYS 110 B . ? LYS 107 B PRO 111 B ? PRO 108 B 1 -8.08 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA2 1 2 ? parallel AA2 2 3 ? parallel AA2 3 4 ? parallel AA2 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 36 ? GLU A 40 ? GLU A 33 GLU A 37 AA1 2 LYS A 12 ? VAL A 16 ? LYS A 9 VAL A 13 AA1 3 LEU A 57 ? LEU A 60 ? LEU A 54 LEU A 57 AA1 4 ILE A 84 ? THR A 88 ? ILE A 81 THR A 85 AA1 5 ASP A 106 ? ALA A 109 ? ASP A 103 ALA A 106 AA2 1 GLU B 36 ? GLU B 40 ? GLU B 33 GLU B 37 AA2 2 LYS B 12 ? VAL B 16 ? LYS B 9 VAL B 13 AA2 3 LEU B 57 ? LEU B 60 ? LEU B 54 LEU B 57 AA2 4 ILE B 84 ? THR B 88 ? ILE B 81 THR B 85 AA2 5 ASP B 106 ? ALA B 109 ? ASP B 103 ALA B 106 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLU A 36 ? O GLU A 33 N ILE A 13 ? N ILE A 10 AA1 2 3 N VAL A 16 ? N VAL A 13 O VAL A 59 ? O VAL A 56 AA1 3 4 N VAL A 58 ? N VAL A 55 O LEU A 85 ? O LEU A 82 AA1 4 5 N MET A 86 ? N MET A 83 O VAL A 108 ? O VAL A 105 AA2 1 2 O GLU B 36 ? O GLU B 33 N ILE B 13 ? N ILE B 10 AA2 2 3 N VAL B 16 ? N VAL B 13 O VAL B 59 ? O VAL B 56 AA2 3 4 N VAL B 58 ? N VAL B 55 O LEU B 85 ? O LEU B 82 AA2 4 5 N MET B 86 ? N MET B 83 O VAL B 108 ? O VAL B 105 # _atom_sites.entry_id 5HM6 _atom_sites.fract_transf_matrix[1][1] 0.019305 _atom_sites.fract_transf_matrix[1][2] 0.011146 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022292 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005061 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 ? ? ? A . n A 1 2 SER 2 -1 ? ? ? A . n A 1 3 HIS 3 0 ? ? ? A . n A 1 4 MET 4 1 ? ? ? A . n A 1 5 SER 5 2 ? ? ? A . n A 1 6 GLN 6 3 ? ? ? A . n A 1 7 GLU 7 4 ? ? ? A . n A 1 8 GLU 8 5 ? ? ? A . n A 1 9 LYS 9 6 7 LYS LYS A . n A 1 10 LEU 10 7 8 LEU LEU A . n A 1 11 PRO 11 8 9 PRO PRO A . n A 1 12 LYS 12 9 10 LYS LYS A . n A 1 13 ILE 13 10 11 ILE ILE A . n A 1 14 LEU 14 11 12 LEU LEU A . n A 1 15 ILE 15 12 13 ILE ILE A . n A 1 16 VAL 16 13 14 VAL VAL A . n A 1 17 GLU 17 14 15 GLU GLU A . n A 1 18 ASP 18 15 16 ASP ASP A . n A 1 19 ASP 19 16 17 ASP ASP A . n A 1 20 GLU 20 17 18 GLU GLU A . n A 1 21 ARG 21 18 19 ARG ARG A . n A 1 22 LEU 22 19 20 LEU LEU A . n A 1 23 ALA 23 20 21 ALA ALA A . n A 1 24 ARG 24 21 22 ARG ARG A . n A 1 25 LEU 25 22 23 LEU LEU A . n A 1 26 THR 26 23 24 THR THR A . n A 1 27 GLN 27 24 25 GLN GLN A . n A 1 28 GLU 28 25 26 GLU GLU A . n A 1 29 TYR 29 26 27 TYR TYR A . n A 1 30 LEU 30 27 28 LEU LEU A . n A 1 31 ILE 31 28 29 ILE ILE A . n A 1 32 ARG 32 29 30 ARG ARG A . n A 1 33 ASN 33 30 31 ASN ASN A . n A 1 34 GLY 34 31 32 GLY GLY A . n A 1 35 LEU 35 32 33 LEU LEU A . n A 1 36 GLU 36 33 34 GLU GLU A . n A 1 37 VAL 37 34 35 VAL VAL A . n A 1 38 GLY 38 35 36 GLY GLY A . n A 1 39 VAL 39 36 37 VAL VAL A . n A 1 40 GLU 40 37 38 GLU GLU A . n A 1 41 THR 41 38 39 THR THR A . n A 1 42 ASP 42 39 40 ASP ASP A . n A 1 43 GLY 43 40 41 GLY GLY A . n A 1 44 ASN 44 41 42 ASN ASN A . n A 1 45 ARG 45 42 43 ARG ARG A . n A 1 46 ALA 46 43 44 ALA ALA A . n A 1 47 ILE 47 44 45 ILE ILE A . n A 1 48 ARG 48 45 46 ARG ARG A . n A 1 49 ARG 49 46 47 ARG ARG A . n A 1 50 ILE 50 47 48 ILE ILE A . n A 1 51 ILE 51 48 49 ILE ILE A . n A 1 52 SER 52 49 50 SER SER A . n A 1 53 GLU 53 50 51 GLU GLU A . n A 1 54 GLN 54 51 52 GLN GLN A . n A 1 55 PRO 55 52 53 PRO PRO A . n A 1 56 ASP 56 53 54 ASP ASP A . n A 1 57 LEU 57 54 55 LEU LEU A . n A 1 58 VAL 58 55 56 VAL VAL A . n A 1 59 VAL 59 56 57 VAL VAL A . n A 1 60 LEU 60 57 58 LEU LEU A . n A 1 61 ASP 61 58 59 ASP ASP A . n A 1 62 VAL 62 59 60 VAL VAL A . n A 1 63 MET 63 60 61 MET MET A . n A 1 64 LEU 64 61 62 LEU LEU A . n A 1 65 PRO 65 62 63 PRO PRO A . n A 1 66 GLY 66 63 64 GLY GLY A . n A 1 67 ALA 67 64 65 ALA ALA A . n A 1 68 ASP 68 65 66 ASP ASP A . n A 1 69 GLY 69 66 67 GLY GLY A . n A 1 70 LEU 70 67 68 LEU LEU A . n A 1 71 THR 71 68 69 THR THR A . n A 1 72 VAL 72 69 70 VAL VAL A . n A 1 73 CYS 73 70 71 CYS CYS A . n A 1 74 ARG 74 71 72 ARG ARG A . n A 1 75 GLU 75 72 73 GLU GLU A . n A 1 76 VAL 76 73 74 VAL VAL A . n A 1 77 ARG 77 74 75 ARG ARG A . n A 1 78 PRO 78 75 76 PRO PRO A . n A 1 79 HIS 79 76 77 HIS HIS A . n A 1 80 TYR 80 77 78 TYR TYR A . n A 1 81 HIS 81 78 79 HIS HIS A . n A 1 82 GLN 82 79 80 GLN GLN A . n A 1 83 PRO 83 80 81 PRO PRO A . n A 1 84 ILE 84 81 82 ILE ILE A . n A 1 85 LEU 85 82 83 LEU LEU A . n A 1 86 MET 86 83 84 MET MET A . n A 1 87 LEU 87 84 85 LEU LEU A . n A 1 88 THR 88 85 86 THR THR A . n A 1 89 ALA 89 86 87 ALA ALA A . n A 1 90 ARG 90 87 88 ARG ARG A . n A 1 91 THR 91 88 89 THR THR A . n A 1 92 GLU 92 89 90 GLU GLU A . n A 1 93 ASP 93 90 91 ASP ASP A . n A 1 94 MET 94 91 92 MET MET A . n A 1 95 ASP 95 92 93 ASP ASP A . n A 1 96 GLN 96 93 94 GLN GLN A . n A 1 97 VAL 97 94 95 VAL VAL A . n A 1 98 LEU 98 95 96 LEU LEU A . n A 1 99 GLY 99 96 97 GLY GLY A . n A 1 100 LEU 100 97 98 LEU LEU A . n A 1 101 GLU 101 98 99 GLU GLU A . n A 1 102 MET 102 99 100 MET MET A . n A 1 103 GLY 103 100 101 GLY GLY A . n A 1 104 ALA 104 101 102 ALA ALA A . n A 1 105 ASP 105 102 103 ASP ASP A . n A 1 106 ASP 106 103 104 ASP ASP A . n A 1 107 TYR 107 104 105 TYR TYR A . n A 1 108 VAL 108 105 106 VAL VAL A . n A 1 109 ALA 109 106 107 ALA ALA A . n A 1 110 LYS 110 107 108 LYS LYS A . n A 1 111 PRO 111 108 109 PRO PRO A . n A 1 112 VAL 112 109 110 VAL VAL A . n A 1 113 GLN 113 110 111 GLN GLN A . n A 1 114 PRO 114 111 112 PRO PRO A . n A 1 115 ARG 115 112 113 ARG ARG A . n A 1 116 VAL 116 113 114 VAL VAL A . n A 1 117 LEU 117 114 115 LEU LEU A . n A 1 118 LEU 118 115 116 LEU LEU A . n A 1 119 ALA 119 116 117 ALA ALA A . n A 1 120 ARG 120 117 118 ARG ARG A . n A 1 121 ILE 121 118 119 ILE ILE A . n A 1 122 ARG 122 119 120 ARG ARG A . n A 1 123 ALA 123 120 121 ALA ALA A . n A 1 124 LEU 124 121 122 LEU LEU A . n A 1 125 LEU 125 122 123 LEU LEU A . n A 1 126 ARG 126 123 124 ARG ARG A . n A 1 127 ARG 127 124 125 ARG ARG A . n A 1 128 THR 128 125 ? ? ? A . n A 1 129 ASP 129 126 ? ? ? A . n A 1 130 LYS 130 127 ? ? ? A . n A 1 131 THR 131 128 ? ? ? A . n A 1 132 VAL 132 129 ? ? ? A . n A 1 133 GLU 133 130 ? ? ? A . n B 1 1 GLY 1 -2 ? ? ? B . n B 1 2 SER 2 -1 ? ? ? B . n B 1 3 HIS 3 0 ? ? ? B . n B 1 4 MET 4 1 ? ? ? B . n B 1 5 SER 5 2 ? ? ? B . n B 1 6 GLN 6 3 ? ? ? B . n B 1 7 GLU 7 4 ? ? ? B . n B 1 8 GLU 8 5 ? ? ? B . n B 1 9 LYS 9 6 7 LYS LYS B . n B 1 10 LEU 10 7 8 LEU LEU B . n B 1 11 PRO 11 8 9 PRO PRO B . n B 1 12 LYS 12 9 10 LYS LYS B . n B 1 13 ILE 13 10 11 ILE ILE B . n B 1 14 LEU 14 11 12 LEU LEU B . n B 1 15 ILE 15 12 13 ILE ILE B . n B 1 16 VAL 16 13 14 VAL VAL B . n B 1 17 GLU 17 14 15 GLU GLU B . n B 1 18 ASP 18 15 16 ASP ASP B . n B 1 19 ASP 19 16 17 ASP ASP B . n B 1 20 GLU 20 17 18 GLU GLU B . n B 1 21 ARG 21 18 19 ARG ARG B . n B 1 22 LEU 22 19 20 LEU LEU B . n B 1 23 ALA 23 20 21 ALA ALA B . n B 1 24 ARG 24 21 22 ARG ARG B . n B 1 25 LEU 25 22 23 LEU LEU B . n B 1 26 THR 26 23 24 THR THR B . n B 1 27 GLN 27 24 25 GLN GLN B . n B 1 28 GLU 28 25 26 GLU GLU B . n B 1 29 TYR 29 26 27 TYR TYR B . n B 1 30 LEU 30 27 28 LEU LEU B . n B 1 31 ILE 31 28 29 ILE ILE B . n B 1 32 ARG 32 29 30 ARG ARG B . n B 1 33 ASN 33 30 31 ASN ASN B . n B 1 34 GLY 34 31 32 GLY GLY B . n B 1 35 LEU 35 32 33 LEU LEU B . n B 1 36 GLU 36 33 34 GLU GLU B . n B 1 37 VAL 37 34 35 VAL VAL B . n B 1 38 GLY 38 35 36 GLY GLY B . n B 1 39 VAL 39 36 37 VAL VAL B . n B 1 40 GLU 40 37 38 GLU GLU B . n B 1 41 THR 41 38 39 THR THR B . n B 1 42 ASP 42 39 40 ASP ASP B . n B 1 43 GLY 43 40 41 GLY GLY B . n B 1 44 ASN 44 41 42 ASN ASN B . n B 1 45 ARG 45 42 43 ARG ARG B . n B 1 46 ALA 46 43 44 ALA ALA B . n B 1 47 ILE 47 44 45 ILE ILE B . n B 1 48 ARG 48 45 46 ARG ARG B . n B 1 49 ARG 49 46 47 ARG ARG B . n B 1 50 ILE 50 47 48 ILE ILE B . n B 1 51 ILE 51 48 49 ILE ILE B . n B 1 52 SER 52 49 50 SER SER B . n B 1 53 GLU 53 50 51 GLU GLU B . n B 1 54 GLN 54 51 52 GLN GLN B . n B 1 55 PRO 55 52 53 PRO PRO B . n B 1 56 ASP 56 53 54 ASP ASP B . n B 1 57 LEU 57 54 55 LEU LEU B . n B 1 58 VAL 58 55 56 VAL VAL B . n B 1 59 VAL 59 56 57 VAL VAL B . n B 1 60 LEU 60 57 58 LEU LEU B . n B 1 61 ASP 61 58 59 ASP ASP B . n B 1 62 VAL 62 59 60 VAL VAL B . n B 1 63 MET 63 60 61 MET MET B . n B 1 64 LEU 64 61 62 LEU LEU B . n B 1 65 PRO 65 62 63 PRO PRO B . n B 1 66 GLY 66 63 64 GLY GLY B . n B 1 67 ALA 67 64 65 ALA ALA B . n B 1 68 ASP 68 65 66 ASP ASP B . n B 1 69 GLY 69 66 67 GLY GLY B . n B 1 70 LEU 70 67 68 LEU LEU B . n B 1 71 THR 71 68 69 THR THR B . n B 1 72 VAL 72 69 70 VAL VAL B . n B 1 73 CYS 73 70 71 CYS CYS B . n B 1 74 ARG 74 71 72 ARG ARG B . n B 1 75 GLU 75 72 73 GLU GLU B . n B 1 76 VAL 76 73 74 VAL VAL B . n B 1 77 ARG 77 74 75 ARG ARG B . n B 1 78 PRO 78 75 76 PRO PRO B . n B 1 79 HIS 79 76 77 HIS HIS B . n B 1 80 TYR 80 77 78 TYR TYR B . n B 1 81 HIS 81 78 79 HIS HIS B . n B 1 82 GLN 82 79 80 GLN GLN B . n B 1 83 PRO 83 80 81 PRO PRO B . n B 1 84 ILE 84 81 82 ILE ILE B . n B 1 85 LEU 85 82 83 LEU LEU B . n B 1 86 MET 86 83 84 MET MET B . n B 1 87 LEU 87 84 85 LEU LEU B . n B 1 88 THR 88 85 86 THR THR B . n B 1 89 ALA 89 86 87 ALA ALA B . n B 1 90 ARG 90 87 88 ARG ARG B . n B 1 91 THR 91 88 89 THR THR B . n B 1 92 GLU 92 89 90 GLU GLU B . n B 1 93 ASP 93 90 91 ASP ASP B . n B 1 94 MET 94 91 92 MET MET B . n B 1 95 ASP 95 92 93 ASP ASP B . n B 1 96 GLN 96 93 94 GLN GLN B . n B 1 97 VAL 97 94 95 VAL VAL B . n B 1 98 LEU 98 95 96 LEU LEU B . n B 1 99 GLY 99 96 97 GLY GLY B . n B 1 100 LEU 100 97 98 LEU LEU B . n B 1 101 GLU 101 98 99 GLU GLU B . n B 1 102 MET 102 99 100 MET MET B . n B 1 103 GLY 103 100 101 GLY GLY B . n B 1 104 ALA 104 101 102 ALA ALA B . n B 1 105 ASP 105 102 103 ASP ASP B . n B 1 106 ASP 106 103 104 ASP ASP B . n B 1 107 TYR 107 104 105 TYR TYR B . n B 1 108 VAL 108 105 106 VAL VAL B . n B 1 109 ALA 109 106 107 ALA ALA B . n B 1 110 LYS 110 107 108 LYS LYS B . n B 1 111 PRO 111 108 109 PRO PRO B . n B 1 112 VAL 112 109 110 VAL VAL B . n B 1 113 GLN 113 110 111 GLN GLN B . n B 1 114 PRO 114 111 112 PRO PRO B . n B 1 115 ARG 115 112 113 ARG ARG B . n B 1 116 VAL 116 113 114 VAL VAL B . n B 1 117 LEU 117 114 115 LEU LEU B . n B 1 118 LEU 118 115 116 LEU LEU B . n B 1 119 ALA 119 116 117 ALA ALA B . n B 1 120 ARG 120 117 118 ARG ARG B . n B 1 121 ILE 121 118 119 ILE ILE B . n B 1 122 ARG 122 119 120 ARG ARG B . n B 1 123 ALA 123 120 121 ALA ALA B . n B 1 124 LEU 124 121 122 LEU LEU B . n B 1 125 LEU 125 122 123 LEU LEU B . n B 1 126 ARG 126 123 124 ARG ARG B . n B 1 127 ARG 127 124 125 ARG ARG B . n B 1 128 THR 128 125 ? ? ? B . n B 1 129 ASP 129 126 ? ? ? B . n B 1 130 LYS 130 127 ? ? ? B . n B 1 131 THR 131 128 ? ? ? B . n B 1 132 VAL 132 129 ? ? ? B . n B 1 133 GLU 133 130 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 HOH 1 201 29 HOH HOH A . C 2 HOH 2 202 21 HOH HOH A . C 2 HOH 3 203 13 HOH HOH A . C 2 HOH 4 204 15 HOH HOH A . C 2 HOH 5 205 28 HOH HOH A . C 2 HOH 6 206 12 HOH HOH A . C 2 HOH 7 207 4 HOH HOH A . C 2 HOH 8 208 25 HOH HOH A . C 2 HOH 9 209 27 HOH HOH A . C 2 HOH 10 210 30 HOH HOH A . C 2 HOH 11 211 20 HOH HOH A . C 2 HOH 12 212 14 HOH HOH A . C 2 HOH 13 213 18 HOH HOH A . C 2 HOH 14 214 26 HOH HOH A . C 2 HOH 15 215 24 HOH HOH A . C 2 HOH 16 216 33 HOH HOH A . C 2 HOH 17 217 2 HOH HOH A . D 2 HOH 1 201 19 HOH HOH B . D 2 HOH 2 202 23 HOH HOH B . D 2 HOH 3 203 16 HOH HOH B . D 2 HOH 4 204 11 HOH HOH B . D 2 HOH 5 205 31 HOH HOH B . D 2 HOH 6 206 17 HOH HOH B . D 2 HOH 7 207 8 HOH HOH B . D 2 HOH 8 208 6 HOH HOH B . D 2 HOH 9 209 3 HOH HOH B . D 2 HOH 10 210 9 HOH HOH B . D 2 HOH 11 211 1 HOH HOH B . D 2 HOH 12 212 10 HOH HOH B . D 2 HOH 13 213 22 HOH HOH B . D 2 HOH 14 214 5 HOH HOH B . D 2 HOH 15 215 7 HOH HOH B . D 2 HOH 16 216 34 HOH HOH B . D 2 HOH 17 217 32 HOH HOH B . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA dimeric 2 2 software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D 2 1 A,C 2 2 B,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1920 ? 1 MORE 3 ? 1 'SSA (A^2)' 11270 ? 2 'ABSA (A^2)' 800 ? 2 MORE -11 ? 2 'SSA (A^2)' 12390 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_565 y,-x+y+1,z+1/6 0.5000000000 0.8660254038 0.0000000000 -25.9000000000 -0.8660254038 0.5000000000 0.0000000000 44.8601159160 0.0000000000 0.0000000000 1.0000000000 32.9333333333 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-01-18 2 'Structure model' 1 1 2017-09-27 3 'Structure model' 1 2 2018-03-07 4 'Structure model' 1 3 2019-12-25 5 'Structure model' 1 4 2023-09-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Source and taxonomy' 4 4 'Structure model' 'Author supporting evidence' 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Database references' 7 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_audit_support 2 3 'Structure model' citation 3 3 'Structure model' citation_author 4 3 'Structure model' entity_src_gen 5 4 'Structure model' pdbx_audit_support 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond 8 5 'Structure model' database_2 9 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_audit_support.funding_organization' 2 3 'Structure model' '_citation.country' 3 3 'Structure model' '_citation.journal_abbrev' 4 3 'Structure model' '_citation.journal_id_ASTM' 5 3 'Structure model' '_citation.journal_id_CSD' 6 3 'Structure model' '_citation.journal_id_ISSN' 7 3 'Structure model' '_citation.pdbx_database_id_DOI' 8 3 'Structure model' '_citation.pdbx_database_id_PubMed' 9 3 'Structure model' '_citation.title' 10 3 'Structure model' '_citation.year' 11 3 'Structure model' '_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id' 12 3 'Structure model' '_entity_src_gen.pdbx_host_org_scientific_name' 13 4 'Structure model' '_pdbx_audit_support.funding_organization' 14 5 'Structure model' '_database_2.pdbx_DOI' 15 5 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0135 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -2 ? A GLY 1 2 1 Y 1 A SER -1 ? A SER 2 3 1 Y 1 A HIS 0 ? A HIS 3 4 1 Y 1 A MET 1 ? A MET 4 5 1 Y 1 A SER 2 ? A SER 5 6 1 Y 1 A GLN 3 ? A GLN 6 7 1 Y 1 A GLU 4 ? A GLU 7 8 1 Y 1 A GLU 5 ? A GLU 8 9 1 Y 1 A THR 125 ? A THR 128 10 1 Y 1 A ASP 126 ? A ASP 129 11 1 Y 1 A LYS 127 ? A LYS 130 12 1 Y 1 A THR 128 ? A THR 131 13 1 Y 1 A VAL 129 ? A VAL 132 14 1 Y 1 A GLU 130 ? A GLU 133 15 1 Y 1 B GLY -2 ? B GLY 1 16 1 Y 1 B SER -1 ? B SER 2 17 1 Y 1 B HIS 0 ? B HIS 3 18 1 Y 1 B MET 1 ? B MET 4 19 1 Y 1 B SER 2 ? B SER 5 20 1 Y 1 B GLN 3 ? B GLN 6 21 1 Y 1 B GLU 4 ? B GLU 7 22 1 Y 1 B GLU 5 ? B GLU 8 23 1 Y 1 B THR 125 ? B THR 128 24 1 Y 1 B ASP 126 ? B ASP 129 25 1 Y 1 B LYS 127 ? B LYS 130 26 1 Y 1 B THR 128 ? B THR 131 27 1 Y 1 B VAL 129 ? B VAL 132 28 1 Y 1 B GLU 130 ? B GLU 133 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PRO N N N N 250 PRO CA C N S 251 PRO C C N N 252 PRO O O N N 253 PRO CB C N N 254 PRO CG C N N 255 PRO CD C N N 256 PRO OXT O N N 257 PRO H H N N 258 PRO HA H N N 259 PRO HB2 H N N 260 PRO HB3 H N N 261 PRO HG2 H N N 262 PRO HG3 H N N 263 PRO HD2 H N N 264 PRO HD3 H N N 265 PRO HXT H N N 266 SER N N N N 267 SER CA C N S 268 SER C C N N 269 SER O O N N 270 SER CB C N N 271 SER OG O N N 272 SER OXT O N N 273 SER H H N N 274 SER H2 H N N 275 SER HA H N N 276 SER HB2 H N N 277 SER HB3 H N N 278 SER HG H N N 279 SER HXT H N N 280 THR N N N N 281 THR CA C N S 282 THR C C N N 283 THR O O N N 284 THR CB C N R 285 THR OG1 O N N 286 THR CG2 C N N 287 THR OXT O N N 288 THR H H N N 289 THR H2 H N N 290 THR HA H N N 291 THR HB H N N 292 THR HG1 H N N 293 THR HG21 H N N 294 THR HG22 H N N 295 THR HG23 H N N 296 THR HXT H N N 297 TYR N N N N 298 TYR CA C N S 299 TYR C C N N 300 TYR O O N N 301 TYR CB C N N 302 TYR CG C Y N 303 TYR CD1 C Y N 304 TYR CD2 C Y N 305 TYR CE1 C Y N 306 TYR CE2 C Y N 307 TYR CZ C Y N 308 TYR OH O N N 309 TYR OXT O N N 310 TYR H H N N 311 TYR H2 H N N 312 TYR HA H N N 313 TYR HB2 H N N 314 TYR HB3 H N N 315 TYR HD1 H N N 316 TYR HD2 H N N 317 TYR HE1 H N N 318 TYR HE2 H N N 319 TYR HH H N N 320 TYR HXT H N N 321 VAL N N N N 322 VAL CA C N S 323 VAL C C N N 324 VAL O O N N 325 VAL CB C N N 326 VAL CG1 C N N 327 VAL CG2 C N N 328 VAL OXT O N N 329 VAL H H N N 330 VAL H2 H N N 331 VAL HA H N N 332 VAL HB H N N 333 VAL HG11 H N N 334 VAL HG12 H N N 335 VAL HG13 H N N 336 VAL HG21 H N N 337 VAL HG22 H N N 338 VAL HG23 H N N 339 VAL HXT H N N 340 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PRO N CA sing N N 237 PRO N CD sing N N 238 PRO N H sing N N 239 PRO CA C sing N N 240 PRO CA CB sing N N 241 PRO CA HA sing N N 242 PRO C O doub N N 243 PRO C OXT sing N N 244 PRO CB CG sing N N 245 PRO CB HB2 sing N N 246 PRO CB HB3 sing N N 247 PRO CG CD sing N N 248 PRO CG HG2 sing N N 249 PRO CG HG3 sing N N 250 PRO CD HD2 sing N N 251 PRO CD HD3 sing N N 252 PRO OXT HXT sing N N 253 SER N CA sing N N 254 SER N H sing N N 255 SER N H2 sing N N 256 SER CA C sing N N 257 SER CA CB sing N N 258 SER CA HA sing N N 259 SER C O doub N N 260 SER C OXT sing N N 261 SER CB OG sing N N 262 SER CB HB2 sing N N 263 SER CB HB3 sing N N 264 SER OG HG sing N N 265 SER OXT HXT sing N N 266 THR N CA sing N N 267 THR N H sing N N 268 THR N H2 sing N N 269 THR CA C sing N N 270 THR CA CB sing N N 271 THR CA HA sing N N 272 THR C O doub N N 273 THR C OXT sing N N 274 THR CB OG1 sing N N 275 THR CB CG2 sing N N 276 THR CB HB sing N N 277 THR OG1 HG1 sing N N 278 THR CG2 HG21 sing N N 279 THR CG2 HG22 sing N N 280 THR CG2 HG23 sing N N 281 THR OXT HXT sing N N 282 TYR N CA sing N N 283 TYR N H sing N N 284 TYR N H2 sing N N 285 TYR CA C sing N N 286 TYR CA CB sing N N 287 TYR CA HA sing N N 288 TYR C O doub N N 289 TYR C OXT sing N N 290 TYR CB CG sing N N 291 TYR CB HB2 sing N N 292 TYR CB HB3 sing N N 293 TYR CG CD1 doub Y N 294 TYR CG CD2 sing Y N 295 TYR CD1 CE1 sing Y N 296 TYR CD1 HD1 sing N N 297 TYR CD2 CE2 doub Y N 298 TYR CD2 HD2 sing N N 299 TYR CE1 CZ doub Y N 300 TYR CE1 HE1 sing N N 301 TYR CE2 CZ sing Y N 302 TYR CE2 HE2 sing N N 303 TYR CZ OH sing N N 304 TYR OH HH sing N N 305 TYR OXT HXT sing N N 306 VAL N CA sing N N 307 VAL N H sing N N 308 VAL N H2 sing N N 309 VAL CA C sing N N 310 VAL CA CB sing N N 311 VAL CA HA sing N N 312 VAL C O doub N N 313 VAL C OXT sing N N 314 VAL CB CG1 sing N N 315 VAL CB CG2 sing N N 316 VAL CB HB sing N N 317 VAL CG1 HG11 sing N N 318 VAL CG1 HG12 sing N N 319 VAL CG1 HG13 sing N N 320 VAL CG2 HG21 sing N N 321 VAL CG2 HG22 sing N N 322 VAL CG2 HG23 sing N N 323 VAL OXT HXT sing N N 324 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number GM055769 _pdbx_audit_support.ordinal 1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3NHZ _pdbx_initial_refinement_model.details ? #