data_5HMC # _entry.id 5HMC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.389 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5HMC pdb_00005hmc 10.2210/pdb5hmc/pdb WWPDB D_1000217234 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-02-03 2 'Structure model' 1 1 2016-02-17 3 'Structure model' 1 2 2024-03-06 4 'Structure model' 1 3 2024-04-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' chem_comp_atom 2 3 'Structure model' chem_comp_bond 3 3 'Structure model' citation 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_citation.journal_id_CSD' 2 3 'Structure model' '_database_2.pdbx_DOI' 3 3 'Structure model' '_database_2.pdbx_database_accession' 4 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5HMC _pdbx_database_status.recvd_initial_deposition_date 2016-01-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.content_type unspecified _pdbx_database_related.db_id 5HMB _pdbx_database_related.db_name PDB _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zhang, Y.' 1 'Erb, M.S.' 2 'Ealick, S.E.' 3 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochemistry _citation.journal_id_ASTM BICHAW _citation.journal_id_CSD 0033 _citation.journal_id_ISSN 0006-2960 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 55 _citation.language ? _citation.page_first 704 _citation.page_last 714 _citation.title ;Polyketide Ring Expansion Mediated by a Thioesterase, Chain Elongation and Cyclization Domain, in Azinomycin Biosynthesis: Characterization of AziB and AziG. ; _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.biochem.5b01050 _citation.pdbx_database_id_PubMed 26731610 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mori, S.' 1 ? primary 'Simkhada, D.' 2 ? primary 'Zhang, H.' 3 ? primary 'Erb, M.S.' 4 ? primary 'Zhang, Y.' 5 ? primary 'Williams, H.' 6 ? primary 'Fedoseyenko, D.' 7 ? primary 'Russell, W.K.' 8 ? primary 'Kim, D.' 9 ? primary 'Fleer, N.' 10 ? primary 'Ealick, S.E.' 11 ? primary 'Watanabe, C.M.' 12 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Azi13 15416.212 1 ? ? ? ? 2 non-polymer syn '5-methylnaphthalene-1-carboxylic acid' 186.207 1 ? ? ? ? 3 non-polymer nat 'SULFATE ION' 96.063 2 ? ? ? ? 4 water nat water 18.015 30 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MTTTDKTDSRLGPYVEHLGLQFERIDPDRAVAYWSVRADLLQPHGILHGGVHCAVVESVASAAADRWLGDRGTVVGVSNS TDFFAPATVADGRLTSTALPVHRGATQQVWSVETVDAAGRLVARGQVRLHNLRLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MTTTDKTDSRLGPYVEHLGLQFERIDPDRAVAYWSVRADLLQPHGILHGGVHCAVVESVASAAADRWLGDRGTVVGVSNS TDFFAPATVADGRLTSTALPVHRGATQQVWSVETVDAAGRLVARGQVRLHNLRLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '5-methylnaphthalene-1-carboxylic acid' 5NE 3 'SULFATE ION' SO4 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 THR n 1 4 THR n 1 5 ASP n 1 6 LYS n 1 7 THR n 1 8 ASP n 1 9 SER n 1 10 ARG n 1 11 LEU n 1 12 GLY n 1 13 PRO n 1 14 TYR n 1 15 VAL n 1 16 GLU n 1 17 HIS n 1 18 LEU n 1 19 GLY n 1 20 LEU n 1 21 GLN n 1 22 PHE n 1 23 GLU n 1 24 ARG n 1 25 ILE n 1 26 ASP n 1 27 PRO n 1 28 ASP n 1 29 ARG n 1 30 ALA n 1 31 VAL n 1 32 ALA n 1 33 TYR n 1 34 TRP n 1 35 SER n 1 36 VAL n 1 37 ARG n 1 38 ALA n 1 39 ASP n 1 40 LEU n 1 41 LEU n 1 42 GLN n 1 43 PRO n 1 44 HIS n 1 45 GLY n 1 46 ILE n 1 47 LEU n 1 48 HIS n 1 49 GLY n 1 50 GLY n 1 51 VAL n 1 52 HIS n 1 53 CYS n 1 54 ALA n 1 55 VAL n 1 56 VAL n 1 57 GLU n 1 58 SER n 1 59 VAL n 1 60 ALA n 1 61 SER n 1 62 ALA n 1 63 ALA n 1 64 ALA n 1 65 ASP n 1 66 ARG n 1 67 TRP n 1 68 LEU n 1 69 GLY n 1 70 ASP n 1 71 ARG n 1 72 GLY n 1 73 THR n 1 74 VAL n 1 75 VAL n 1 76 GLY n 1 77 VAL n 1 78 SER n 1 79 ASN n 1 80 SER n 1 81 THR n 1 82 ASP n 1 83 PHE n 1 84 PHE n 1 85 ALA n 1 86 PRO n 1 87 ALA n 1 88 THR n 1 89 VAL n 1 90 ALA n 1 91 ASP n 1 92 GLY n 1 93 ARG n 1 94 LEU n 1 95 THR n 1 96 SER n 1 97 THR n 1 98 ALA n 1 99 LEU n 1 100 PRO n 1 101 VAL n 1 102 HIS n 1 103 ARG n 1 104 GLY n 1 105 ALA n 1 106 THR n 1 107 GLN n 1 108 GLN n 1 109 VAL n 1 110 TRP n 1 111 SER n 1 112 VAL n 1 113 GLU n 1 114 THR n 1 115 VAL n 1 116 ASP n 1 117 ALA n 1 118 ALA n 1 119 GLY n 1 120 ARG n 1 121 LEU n 1 122 VAL n 1 123 ALA n 1 124 ARG n 1 125 GLY n 1 126 GLN n 1 127 VAL n 1 128 ARG n 1 129 LEU n 1 130 HIS n 1 131 ASN n 1 132 LEU n 1 133 ARG n 1 134 LEU n 1 135 GLU n 1 136 HIS n 1 137 HIS n 1 138 HIS n 1 139 HIS n 1 140 HIS n 1 141 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 141 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene azi13 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptomyces sahachiroi' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 285525 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET24 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 5NE non-polymer . '5-methylnaphthalene-1-carboxylic acid' ? 'C12 H10 O2' 186.207 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 THR 2 2 ? ? ? A . n A 1 3 THR 3 3 ? ? ? A . n A 1 4 THR 4 4 ? ? ? A . n A 1 5 ASP 5 5 ? ? ? A . n A 1 6 LYS 6 6 ? ? ? A . n A 1 7 THR 7 7 ? ? ? A . n A 1 8 ASP 8 8 ? ? ? A . n A 1 9 SER 9 9 ? ? ? A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 HIS 17 17 17 HIS HIS A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 TRP 34 34 34 TRP TRP A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 HIS 44 44 44 HIS HIS A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 HIS 48 48 48 HIS HIS A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 HIS 52 52 52 HIS HIS A . n A 1 53 CYS 53 53 53 CYS CYS A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 TRP 67 67 67 TRP TRP A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 PHE 83 83 83 PHE PHE A . n A 1 84 PHE 84 84 84 PHE PHE A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 PRO 86 86 86 PRO PRO A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 THR 88 88 88 THR THR A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 PRO 100 100 100 PRO PRO A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 HIS 102 102 102 HIS HIS A . n A 1 103 ARG 103 103 103 ARG ARG A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 THR 106 106 106 THR THR A . n A 1 107 GLN 107 107 107 GLN GLN A . n A 1 108 GLN 108 108 108 GLN GLN A . n A 1 109 VAL 109 109 109 VAL VAL A . n A 1 110 TRP 110 110 110 TRP TRP A . n A 1 111 SER 111 111 111 SER SER A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 VAL 115 115 115 VAL VAL A . n A 1 116 ASP 116 116 116 ASP ASP A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 ARG 120 120 120 ARG ARG A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 ARG 124 124 124 ARG ARG A . n A 1 125 GLY 125 125 125 GLY GLY A . n A 1 126 GLN 126 126 126 GLN GLN A . n A 1 127 VAL 127 127 127 VAL VAL A . n A 1 128 ARG 128 128 128 ARG ARG A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 HIS 130 130 130 HIS HIS A . n A 1 131 ASN 131 131 131 ASN ASN A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 ARG 133 133 133 ARG ARG A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 GLU 135 135 ? ? ? A . n A 1 136 HIS 136 136 ? ? ? A . n A 1 137 HIS 137 137 ? ? ? A . n A 1 138 HIS 138 138 ? ? ? A . n A 1 139 HIS 139 139 ? ? ? A . n A 1 140 HIS 140 140 ? ? ? A . n A 1 141 HIS 141 141 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 5NE 1 300 300 5NE 5NE A . C 3 SO4 1 301 301 SO4 SO4 A . D 3 SO4 1 302 302 SO4 SO4 A . E 4 HOH 1 401 16 HOH HOH A . E 4 HOH 2 402 10 HOH HOH A . E 4 HOH 3 403 19 HOH HOH A . E 4 HOH 4 404 2 HOH HOH A . E 4 HOH 5 405 1 HOH HOH A . E 4 HOH 6 406 20 HOH HOH A . E 4 HOH 7 407 18 HOH HOH A . E 4 HOH 8 408 29 HOH HOH A . E 4 HOH 9 409 12 HOH HOH A . E 4 HOH 10 410 30 HOH HOH A . E 4 HOH 11 411 7 HOH HOH A . E 4 HOH 12 412 6 HOH HOH A . E 4 HOH 13 413 9 HOH HOH A . E 4 HOH 14 414 8 HOH HOH A . E 4 HOH 15 415 5 HOH HOH A . E 4 HOH 16 416 4 HOH HOH A . E 4 HOH 17 417 15 HOH HOH A . E 4 HOH 18 418 22 HOH HOH A . E 4 HOH 19 419 3 HOH HOH A . E 4 HOH 20 420 13 HOH HOH A . E 4 HOH 21 421 17 HOH HOH A . E 4 HOH 22 422 11 HOH HOH A . E 4 HOH 23 423 28 HOH HOH A . E 4 HOH 24 424 27 HOH HOH A . E 4 HOH 25 425 24 HOH HOH A . E 4 HOH 26 426 26 HOH HOH A . E 4 HOH 27 427 21 HOH HOH A . E 4 HOH 28 428 25 HOH HOH A . E 4 HOH 29 429 23 HOH HOH A . E 4 HOH 30 430 14 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 10 ? CG ? A ARG 10 CG 2 1 Y 1 A ARG 10 ? CD ? A ARG 10 CD 3 1 Y 1 A ARG 10 ? NE ? A ARG 10 NE 4 1 Y 1 A ARG 10 ? CZ ? A ARG 10 CZ 5 1 Y 1 A ARG 10 ? NH1 ? A ARG 10 NH1 6 1 Y 1 A ARG 10 ? NH2 ? A ARG 10 NH2 7 1 Y 1 A TYR 14 ? OH ? A TYR 14 OH 8 1 Y 1 A GLU 16 ? CG ? A GLU 16 CG 9 1 Y 1 A GLU 16 ? CD ? A GLU 16 CD 10 1 Y 1 A GLU 16 ? OE1 ? A GLU 16 OE1 11 1 Y 1 A GLU 16 ? OE2 ? A GLU 16 OE2 12 1 Y 1 A ASP 70 ? CG ? A ASP 70 CG 13 1 Y 1 A ASP 70 ? OD1 ? A ASP 70 OD1 14 1 Y 1 A ASP 70 ? OD2 ? A ASP 70 OD2 15 1 Y 1 A ARG 71 ? CG ? A ARG 71 CG 16 1 Y 1 A ARG 71 ? CD ? A ARG 71 CD 17 1 Y 1 A ARG 71 ? NE ? A ARG 71 NE 18 1 Y 1 A ARG 71 ? CZ ? A ARG 71 CZ 19 1 Y 1 A ARG 71 ? NH1 ? A ARG 71 NH1 20 1 Y 1 A ARG 71 ? NH2 ? A ARG 71 NH2 21 1 Y 1 A LEU 134 ? CG ? A LEU 134 CG 22 1 Y 1 A LEU 134 ? CD1 ? A LEU 134 CD1 23 1 Y 1 A LEU 134 ? CD2 ? A LEU 134 CD2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.1.27 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5HMC _cell.details ? _cell.formula_units_Z ? _cell.length_a 67.771 _cell.length_a_esd ? _cell.length_b 67.771 _cell.length_b_esd ? _cell.length_c 140.278 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5HMC _symmetry.cell_setting ? _symmetry.Int_Tables_number 98 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 41 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5HMC _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.61 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 52.91 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1.25 M ammonium sulfate and 0.1 M cacodylate pH 6.0' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-02-12 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9792 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-C' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9792 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-C _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 44.150 _reflns.entry_id 5HMC _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.950 _reflns.d_resolution_low 70.140 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12265 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.400 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.000 _reflns.pdbx_Rmerge_I_obs 0.056 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 20.900 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.023 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 85401 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.000 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 1.950 2.060 ? 1.300 ? ? ? ? ? 96.600 ? ? ? ? 1.116 ? ? ? ? ? ? ? ? 6.200 ? ? ? ? ? ? ? 1 1 ? ? 6.170 70.140 ? 80.200 ? ? ? ? ? 99.300 ? ? ? ? 0.017 ? ? ? ? ? ? ? ? 6.200 ? ? ? ? ? ? ? 2 1 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 94.360 _refine.B_iso_mean 48.3142 _refine.B_iso_min 32.810 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5HMC _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.2000 _refine.ls_d_res_low 61.0230 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8634 _refine.ls_number_reflns_R_free 418 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.5600 _refine.ls_percent_reflns_R_free 4.8400 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1861 _refine.ls_R_factor_R_free 0.2192 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1844 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.380 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'FOURIER SYNTHESIS' _refine.pdbx_starting_model D_1000217232 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.9600 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2400 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFRACTION' _refine_hist.d_res_high 2.2000 _refine_hist.d_res_low 61.0230 _refine_hist.pdbx_number_atoms_ligand 24 _refine_hist.number_atoms_solvent 30 _refine_hist.number_atoms_total 982 _refine_hist.pdbx_number_residues_total 125 _refine_hist.pdbx_B_iso_mean_ligand 54.03 _refine_hist.pdbx_B_iso_mean_solvent 50.96 _refine_hist.pdbx_number_atoms_protein 928 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 ? 979 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.784 ? 1342 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.053 ? 152 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 174 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 15.207 ? 552 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.2004 2.5188 2814 . 144 2670 99.0000 . . . 0.2729 . 0.2202 . . . . . . 3 . . . 'X-RAY DIFFRACTION' 2.5188 3.1734 2830 . 129 2701 100.0000 . . . 0.2960 . 0.2195 . . . . . . 3 . . . 'X-RAY DIFFRACTION' 3.1734 61.0461 2990 . 145 2845 100.0000 . . . 0.1892 . 0.1664 . . . . . . 3 . . . # _struct.entry_id 5HMC _struct.title 'Crystal structure of S. sahachiroi AziG complexed with 5-methyl naphthoic acid' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5HMC _struct_keywords.text 'azinomycin biosynthesis, polyketide synthase, thioesterase, naphthoate, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code B4XYA6_STREG _struct_ref.pdbx_db_accession B4XYA6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTTTDKTDSRLGPYVEHLGLQFERIDPDRAVAYWSVRADLLQPHGILHGGVHCAVVESVASAAADRWLGDRGTVVGVSNS TDFFAPATVADGRLTSTALPVHRGATQQVWSVETVDAAGRLVARGQVRLHNLR ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5HMC _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 133 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession B4XYA6 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 133 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 133 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5HMC LEU A 134 ? UNP B4XYA6 ? ? 'expression tag' 134 1 1 5HMC GLU A 135 ? UNP B4XYA6 ? ? 'expression tag' 135 2 1 5HMC HIS A 136 ? UNP B4XYA6 ? ? 'expression tag' 136 3 1 5HMC HIS A 137 ? UNP B4XYA6 ? ? 'expression tag' 137 4 1 5HMC HIS A 138 ? UNP B4XYA6 ? ? 'expression tag' 138 5 1 5HMC HIS A 139 ? UNP B4XYA6 ? ? 'expression tag' 139 6 1 5HMC HIS A 140 ? UNP B4XYA6 ? ? 'expression tag' 140 7 1 5HMC HIS A 141 ? UNP B4XYA6 ? ? 'expression tag' 141 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 8960 ? 1 MORE -139 ? 1 'SSA (A^2)' 18170 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_555 -y,-x,-z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 3 'crystal symmetry operation' 10_645 -x+1,-y-1,z -1.0000000000 0.0000000000 0.0000000000 67.7710000000 0.0000000000 -1.0000000000 0.0000000000 -67.7710000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 15_645 y+1,x-1,-z 0.0000000000 1.0000000000 0.0000000000 67.7710000000 1.0000000000 0.0000000000 0.0000000000 -67.7710000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 12 ? GLY A 19 ? GLY A 12 GLY A 19 1 ? 8 HELX_P HELX_P2 AA2 ARG A 37 ? LEU A 41 ? ARG A 37 LEU A 41 5 ? 5 HELX_P HELX_P3 AA3 HIS A 48 ? GLY A 69 ? HIS A 48 GLY A 69 1 ? 22 HELX_P HELX_P4 AA4 THR A 88 ? ASP A 91 ? THR A 88 ASP A 91 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLN A 21 ? ASP A 26 ? GLN A 21 ASP A 26 AA1 2 ARG A 29 ? SER A 35 ? ARG A 29 SER A 35 AA1 3 ARG A 93 ? ARG A 103 ? ARG A 93 ARG A 103 AA1 4 GLN A 107 ? VAL A 115 ? GLN A 107 VAL A 115 AA1 5 LEU A 121 ? ARG A 133 ? LEU A 121 ARG A 133 AA1 6 GLY A 72 ? PHE A 83 ? GLY A 72 PHE A 83 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ASP A 26 ? N ASP A 26 O ARG A 29 ? O ARG A 29 AA1 2 3 N ALA A 32 ? N ALA A 32 O SER A 96 ? O SER A 96 AA1 3 4 N LEU A 99 ? N LEU A 99 O SER A 111 ? O SER A 111 AA1 4 5 N GLN A 108 ? N GLN A 108 O LEU A 129 ? O LEU A 129 AA1 5 6 O LEU A 132 ? O LEU A 132 N THR A 73 ? N THR A 73 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A 5NE 300 ? 8 'binding site for residue 5NE A 300' AC2 Software A SO4 301 ? 4 'binding site for residue SO4 A 301' AC3 Software A SO4 302 ? 5 'binding site for residue SO4 A 302' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 8 GLN A 42 ? GLN A 42 . ? 8_555 ? 2 AC1 8 PRO A 43 ? PRO A 43 . ? 8_555 ? 3 AC1 8 HIS A 44 ? HIS A 44 . ? 8_555 ? 4 AC1 8 HIS A 48 ? HIS A 48 . ? 8_555 ? 5 AC1 8 GLY A 49 ? GLY A 49 . ? 8_555 ? 6 AC1 8 GLU A 57 ? GLU A 57 . ? 1_555 ? 7 AC1 8 SER A 61 ? SER A 61 . ? 1_555 ? 8 AC1 8 VAL A 74 ? VAL A 74 . ? 1_555 ? 9 AC2 4 HIS A 102 ? HIS A 102 . ? 1_555 ? 10 AC2 4 ARG A 103 ? ARG A 103 . ? 1_555 ? 11 AC2 4 HOH E . ? HOH A 406 . ? 1_555 ? 12 AC2 4 HOH E . ? HOH A 409 . ? 1_555 ? 13 AC3 5 HIS A 102 ? HIS A 102 . ? 1_555 ? 14 AC3 5 GLY A 104 ? GLY A 104 . ? 1_555 ? 15 AC3 5 ALA A 105 ? ALA A 105 . ? 1_555 ? 16 AC3 5 THR A 106 ? THR A 106 . ? 1_555 ? 17 AC3 5 GLN A 107 ? GLN A 107 . ? 1_555 ? # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ARG _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 29 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -170.33 _pdbx_validate_torsion.psi 141.24 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 417 ? E HOH . 2 1 A HOH 425 ? E HOH . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A THR 2 ? A THR 2 3 1 Y 1 A THR 3 ? A THR 3 4 1 Y 1 A THR 4 ? A THR 4 5 1 Y 1 A ASP 5 ? A ASP 5 6 1 Y 1 A LYS 6 ? A LYS 6 7 1 Y 1 A THR 7 ? A THR 7 8 1 Y 1 A ASP 8 ? A ASP 8 9 1 Y 1 A SER 9 ? A SER 9 10 1 Y 1 A GLU 135 ? A GLU 135 11 1 Y 1 A HIS 136 ? A HIS 136 12 1 Y 1 A HIS 137 ? A HIS 137 13 1 Y 1 A HIS 138 ? A HIS 138 14 1 Y 1 A HIS 139 ? A HIS 139 15 1 Y 1 A HIS 140 ? A HIS 140 16 1 Y 1 A HIS 141 ? A HIS 141 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 5NE O1N O N N 1 5NE C1L C N N 2 5NE O1M O N N 3 5NE C1J C Y N 4 5NE C1E C Y N 5 5NE C1F C Y N 6 5NE C1A C Y N 7 5NE C1I C Y N 8 5NE C1H C Y N 9 5NE C1G C Y N 10 5NE C1D C Y N 11 5NE C1C C Y N 12 5NE C1O C N N 13 5NE C1B C Y N 14 5NE H1 H N N 15 5NE H2 H N N 16 5NE H3 H N N 17 5NE H4 H N N 18 5NE H5 H N N 19 5NE H6 H N N 20 5NE H7 H N N 21 5NE H8 H N N 22 5NE H9 H N N 23 5NE H10 H N N 24 ALA N N N N 25 ALA CA C N S 26 ALA C C N N 27 ALA O O N N 28 ALA CB C N N 29 ALA OXT O N N 30 ALA H H N N 31 ALA H2 H N N 32 ALA HA H N N 33 ALA HB1 H N N 34 ALA HB2 H N N 35 ALA HB3 H N N 36 ALA HXT H N N 37 ARG N N N N 38 ARG CA C N S 39 ARG C C N N 40 ARG O O N N 41 ARG CB C N N 42 ARG CG C N N 43 ARG CD C N N 44 ARG NE N N N 45 ARG CZ C N N 46 ARG NH1 N N N 47 ARG NH2 N N N 48 ARG OXT O N N 49 ARG H H N N 50 ARG H2 H N N 51 ARG HA H N N 52 ARG HB2 H N N 53 ARG HB3 H N N 54 ARG HG2 H N N 55 ARG HG3 H N N 56 ARG HD2 H N N 57 ARG HD3 H N N 58 ARG HE H N N 59 ARG HH11 H N N 60 ARG HH12 H N N 61 ARG HH21 H N N 62 ARG HH22 H N N 63 ARG HXT H N N 64 ASN N N N N 65 ASN CA C N S 66 ASN C C N N 67 ASN O O N N 68 ASN CB C N N 69 ASN CG C N N 70 ASN OD1 O N N 71 ASN ND2 N N N 72 ASN OXT O N N 73 ASN H H N N 74 ASN H2 H N N 75 ASN HA H N N 76 ASN HB2 H N N 77 ASN HB3 H N N 78 ASN HD21 H N N 79 ASN HD22 H N N 80 ASN HXT H N N 81 ASP N N N N 82 ASP CA C N S 83 ASP C C N N 84 ASP O O N N 85 ASP CB C N N 86 ASP CG C N N 87 ASP OD1 O N N 88 ASP OD2 O N N 89 ASP OXT O N N 90 ASP H H N N 91 ASP H2 H N N 92 ASP HA H N N 93 ASP HB2 H N N 94 ASP HB3 H N N 95 ASP HD2 H N N 96 ASP HXT H N N 97 CYS N N N N 98 CYS CA C N R 99 CYS C C N N 100 CYS O O N N 101 CYS CB C N N 102 CYS SG S N N 103 CYS OXT O N N 104 CYS H H N N 105 CYS H2 H N N 106 CYS HA H N N 107 CYS HB2 H N N 108 CYS HB3 H N N 109 CYS HG H N N 110 CYS HXT H N N 111 GLN N N N N 112 GLN CA C N S 113 GLN C C N N 114 GLN O O N N 115 GLN CB C N N 116 GLN CG C N N 117 GLN CD C N N 118 GLN OE1 O N N 119 GLN NE2 N N N 120 GLN OXT O N N 121 GLN H H N N 122 GLN H2 H N N 123 GLN HA H N N 124 GLN HB2 H N N 125 GLN HB3 H N N 126 GLN HG2 H N N 127 GLN HG3 H N N 128 GLN HE21 H N N 129 GLN HE22 H N N 130 GLN HXT H N N 131 GLU N N N N 132 GLU CA C N S 133 GLU C C N N 134 GLU O O N N 135 GLU CB C N N 136 GLU CG C N N 137 GLU CD C N N 138 GLU OE1 O N N 139 GLU OE2 O N N 140 GLU OXT O N N 141 GLU H H N N 142 GLU H2 H N N 143 GLU HA H N N 144 GLU HB2 H N N 145 GLU HB3 H N N 146 GLU HG2 H N N 147 GLU HG3 H N N 148 GLU HE2 H N N 149 GLU HXT H N N 150 GLY N N N N 151 GLY CA C N N 152 GLY C C N N 153 GLY O O N N 154 GLY OXT O N N 155 GLY H H N N 156 GLY H2 H N N 157 GLY HA2 H N N 158 GLY HA3 H N N 159 GLY HXT H N N 160 HIS N N N N 161 HIS CA C N S 162 HIS C C N N 163 HIS O O N N 164 HIS CB C N N 165 HIS CG C Y N 166 HIS ND1 N Y N 167 HIS CD2 C Y N 168 HIS CE1 C Y N 169 HIS NE2 N Y N 170 HIS OXT O N N 171 HIS H H N N 172 HIS H2 H N N 173 HIS HA H N N 174 HIS HB2 H N N 175 HIS HB3 H N N 176 HIS HD1 H N N 177 HIS HD2 H N N 178 HIS HE1 H N N 179 HIS HE2 H N N 180 HIS HXT H N N 181 HOH O O N N 182 HOH H1 H N N 183 HOH H2 H N N 184 ILE N N N N 185 ILE CA C N S 186 ILE C C N N 187 ILE O O N N 188 ILE CB C N S 189 ILE CG1 C N N 190 ILE CG2 C N N 191 ILE CD1 C N N 192 ILE OXT O N N 193 ILE H H N N 194 ILE H2 H N N 195 ILE HA H N N 196 ILE HB H N N 197 ILE HG12 H N N 198 ILE HG13 H N N 199 ILE HG21 H N N 200 ILE HG22 H N N 201 ILE HG23 H N N 202 ILE HD11 H N N 203 ILE HD12 H N N 204 ILE HD13 H N N 205 ILE HXT H N N 206 LEU N N N N 207 LEU CA C N S 208 LEU C C N N 209 LEU O O N N 210 LEU CB C N N 211 LEU CG C N N 212 LEU CD1 C N N 213 LEU CD2 C N N 214 LEU OXT O N N 215 LEU H H N N 216 LEU H2 H N N 217 LEU HA H N N 218 LEU HB2 H N N 219 LEU HB3 H N N 220 LEU HG H N N 221 LEU HD11 H N N 222 LEU HD12 H N N 223 LEU HD13 H N N 224 LEU HD21 H N N 225 LEU HD22 H N N 226 LEU HD23 H N N 227 LEU HXT H N N 228 LYS N N N N 229 LYS CA C N S 230 LYS C C N N 231 LYS O O N N 232 LYS CB C N N 233 LYS CG C N N 234 LYS CD C N N 235 LYS CE C N N 236 LYS NZ N N N 237 LYS OXT O N N 238 LYS H H N N 239 LYS H2 H N N 240 LYS HA H N N 241 LYS HB2 H N N 242 LYS HB3 H N N 243 LYS HG2 H N N 244 LYS HG3 H N N 245 LYS HD2 H N N 246 LYS HD3 H N N 247 LYS HE2 H N N 248 LYS HE3 H N N 249 LYS HZ1 H N N 250 LYS HZ2 H N N 251 LYS HZ3 H N N 252 LYS HXT H N N 253 MET N N N N 254 MET CA C N S 255 MET C C N N 256 MET O O N N 257 MET CB C N N 258 MET CG C N N 259 MET SD S N N 260 MET CE C N N 261 MET OXT O N N 262 MET H H N N 263 MET H2 H N N 264 MET HA H N N 265 MET HB2 H N N 266 MET HB3 H N N 267 MET HG2 H N N 268 MET HG3 H N N 269 MET HE1 H N N 270 MET HE2 H N N 271 MET HE3 H N N 272 MET HXT H N N 273 PHE N N N N 274 PHE CA C N S 275 PHE C C N N 276 PHE O O N N 277 PHE CB C N N 278 PHE CG C Y N 279 PHE CD1 C Y N 280 PHE CD2 C Y N 281 PHE CE1 C Y N 282 PHE CE2 C Y N 283 PHE CZ C Y N 284 PHE OXT O N N 285 PHE H H N N 286 PHE H2 H N N 287 PHE HA H N N 288 PHE HB2 H N N 289 PHE HB3 H N N 290 PHE HD1 H N N 291 PHE HD2 H N N 292 PHE HE1 H N N 293 PHE HE2 H N N 294 PHE HZ H N N 295 PHE HXT H N N 296 PRO N N N N 297 PRO CA C N S 298 PRO C C N N 299 PRO O O N N 300 PRO CB C N N 301 PRO CG C N N 302 PRO CD C N N 303 PRO OXT O N N 304 PRO H H N N 305 PRO HA H N N 306 PRO HB2 H N N 307 PRO HB3 H N N 308 PRO HG2 H N N 309 PRO HG3 H N N 310 PRO HD2 H N N 311 PRO HD3 H N N 312 PRO HXT H N N 313 SER N N N N 314 SER CA C N S 315 SER C C N N 316 SER O O N N 317 SER CB C N N 318 SER OG O N N 319 SER OXT O N N 320 SER H H N N 321 SER H2 H N N 322 SER HA H N N 323 SER HB2 H N N 324 SER HB3 H N N 325 SER HG H N N 326 SER HXT H N N 327 SO4 S S N N 328 SO4 O1 O N N 329 SO4 O2 O N N 330 SO4 O3 O N N 331 SO4 O4 O N N 332 THR N N N N 333 THR CA C N S 334 THR C C N N 335 THR O O N N 336 THR CB C N R 337 THR OG1 O N N 338 THR CG2 C N N 339 THR OXT O N N 340 THR H H N N 341 THR H2 H N N 342 THR HA H N N 343 THR HB H N N 344 THR HG1 H N N 345 THR HG21 H N N 346 THR HG22 H N N 347 THR HG23 H N N 348 THR HXT H N N 349 TRP N N N N 350 TRP CA C N S 351 TRP C C N N 352 TRP O O N N 353 TRP CB C N N 354 TRP CG C Y N 355 TRP CD1 C Y N 356 TRP CD2 C Y N 357 TRP NE1 N Y N 358 TRP CE2 C Y N 359 TRP CE3 C Y N 360 TRP CZ2 C Y N 361 TRP CZ3 C Y N 362 TRP CH2 C Y N 363 TRP OXT O N N 364 TRP H H N N 365 TRP H2 H N N 366 TRP HA H N N 367 TRP HB2 H N N 368 TRP HB3 H N N 369 TRP HD1 H N N 370 TRP HE1 H N N 371 TRP HE3 H N N 372 TRP HZ2 H N N 373 TRP HZ3 H N N 374 TRP HH2 H N N 375 TRP HXT H N N 376 TYR N N N N 377 TYR CA C N S 378 TYR C C N N 379 TYR O O N N 380 TYR CB C N N 381 TYR CG C Y N 382 TYR CD1 C Y N 383 TYR CD2 C Y N 384 TYR CE1 C Y N 385 TYR CE2 C Y N 386 TYR CZ C Y N 387 TYR OH O N N 388 TYR OXT O N N 389 TYR H H N N 390 TYR H2 H N N 391 TYR HA H N N 392 TYR HB2 H N N 393 TYR HB3 H N N 394 TYR HD1 H N N 395 TYR HD2 H N N 396 TYR HE1 H N N 397 TYR HE2 H N N 398 TYR HH H N N 399 TYR HXT H N N 400 VAL N N N N 401 VAL CA C N S 402 VAL C C N N 403 VAL O O N N 404 VAL CB C N N 405 VAL CG1 C N N 406 VAL CG2 C N N 407 VAL OXT O N N 408 VAL H H N N 409 VAL H2 H N N 410 VAL HA H N N 411 VAL HB H N N 412 VAL HG11 H N N 413 VAL HG12 H N N 414 VAL HG13 H N N 415 VAL HG21 H N N 416 VAL HG22 H N N 417 VAL HG23 H N N 418 VAL HXT H N N 419 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 5NE C1B C1A doub Y N 1 5NE C1B C1C sing Y N 2 5NE C1A C1F sing Y N 3 5NE C1O C1C sing N N 4 5NE C1C C1D doub Y N 5 5NE C1F C1E doub Y N 6 5NE C1D C1E sing Y N 7 5NE C1D C1G sing Y N 8 5NE C1E C1J sing Y N 9 5NE C1G C1H doub Y N 10 5NE C1J C1L sing N N 11 5NE C1J C1I doub Y N 12 5NE O1N C1L doub N N 13 5NE C1L O1M sing N N 14 5NE C1H C1I sing Y N 15 5NE O1M H1 sing N N 16 5NE C1F H2 sing N N 17 5NE C1A H3 sing N N 18 5NE C1I H4 sing N N 19 5NE C1H H5 sing N N 20 5NE C1G H6 sing N N 21 5NE C1O H7 sing N N 22 5NE C1O H8 sing N N 23 5NE C1O H9 sing N N 24 5NE C1B H10 sing N N 25 ALA N CA sing N N 26 ALA N H sing N N 27 ALA N H2 sing N N 28 ALA CA C sing N N 29 ALA CA CB sing N N 30 ALA CA HA sing N N 31 ALA C O doub N N 32 ALA C OXT sing N N 33 ALA CB HB1 sing N N 34 ALA CB HB2 sing N N 35 ALA CB HB3 sing N N 36 ALA OXT HXT sing N N 37 ARG N CA sing N N 38 ARG N H sing N N 39 ARG N H2 sing N N 40 ARG CA C sing N N 41 ARG CA CB sing N N 42 ARG CA HA sing N N 43 ARG C O doub N N 44 ARG C OXT sing N N 45 ARG CB CG sing N N 46 ARG CB HB2 sing N N 47 ARG CB HB3 sing N N 48 ARG CG CD sing N N 49 ARG CG HG2 sing N N 50 ARG CG HG3 sing N N 51 ARG CD NE sing N N 52 ARG CD HD2 sing N N 53 ARG CD HD3 sing N N 54 ARG NE CZ sing N N 55 ARG NE HE sing N N 56 ARG CZ NH1 sing N N 57 ARG CZ NH2 doub N N 58 ARG NH1 HH11 sing N N 59 ARG NH1 HH12 sing N N 60 ARG NH2 HH21 sing N N 61 ARG NH2 HH22 sing N N 62 ARG OXT HXT sing N N 63 ASN N CA sing N N 64 ASN N H sing N N 65 ASN N H2 sing N N 66 ASN CA C sing N N 67 ASN CA CB sing N N 68 ASN CA HA sing N N 69 ASN C O doub N N 70 ASN C OXT sing N N 71 ASN CB CG sing N N 72 ASN CB HB2 sing N N 73 ASN CB HB3 sing N N 74 ASN CG OD1 doub N N 75 ASN CG ND2 sing N N 76 ASN ND2 HD21 sing N N 77 ASN ND2 HD22 sing N N 78 ASN OXT HXT sing N N 79 ASP N CA sing N N 80 ASP N H sing N N 81 ASP N H2 sing N N 82 ASP CA C sing N N 83 ASP CA CB sing N N 84 ASP CA HA sing N N 85 ASP C O doub N N 86 ASP C OXT sing N N 87 ASP CB CG sing N N 88 ASP CB HB2 sing N N 89 ASP CB HB3 sing N N 90 ASP CG OD1 doub N N 91 ASP CG OD2 sing N N 92 ASP OD2 HD2 sing N N 93 ASP OXT HXT sing N N 94 CYS N CA sing N N 95 CYS N H sing N N 96 CYS N H2 sing N N 97 CYS CA C sing N N 98 CYS CA CB sing N N 99 CYS CA HA sing N N 100 CYS C O doub N N 101 CYS C OXT sing N N 102 CYS CB SG sing N N 103 CYS CB HB2 sing N N 104 CYS CB HB3 sing N N 105 CYS SG HG sing N N 106 CYS OXT HXT sing N N 107 GLN N CA sing N N 108 GLN N H sing N N 109 GLN N H2 sing N N 110 GLN CA C sing N N 111 GLN CA CB sing N N 112 GLN CA HA sing N N 113 GLN C O doub N N 114 GLN C OXT sing N N 115 GLN CB CG sing N N 116 GLN CB HB2 sing N N 117 GLN CB HB3 sing N N 118 GLN CG CD sing N N 119 GLN CG HG2 sing N N 120 GLN CG HG3 sing N N 121 GLN CD OE1 doub N N 122 GLN CD NE2 sing N N 123 GLN NE2 HE21 sing N N 124 GLN NE2 HE22 sing N N 125 GLN OXT HXT sing N N 126 GLU N CA sing N N 127 GLU N H sing N N 128 GLU N H2 sing N N 129 GLU CA C sing N N 130 GLU CA CB sing N N 131 GLU CA HA sing N N 132 GLU C O doub N N 133 GLU C OXT sing N N 134 GLU CB CG sing N N 135 GLU CB HB2 sing N N 136 GLU CB HB3 sing N N 137 GLU CG CD sing N N 138 GLU CG HG2 sing N N 139 GLU CG HG3 sing N N 140 GLU CD OE1 doub N N 141 GLU CD OE2 sing N N 142 GLU OE2 HE2 sing N N 143 GLU OXT HXT sing N N 144 GLY N CA sing N N 145 GLY N H sing N N 146 GLY N H2 sing N N 147 GLY CA C sing N N 148 GLY CA HA2 sing N N 149 GLY CA HA3 sing N N 150 GLY C O doub N N 151 GLY C OXT sing N N 152 GLY OXT HXT sing N N 153 HIS N CA sing N N 154 HIS N H sing N N 155 HIS N H2 sing N N 156 HIS CA C sing N N 157 HIS CA CB sing N N 158 HIS CA HA sing N N 159 HIS C O doub N N 160 HIS C OXT sing N N 161 HIS CB CG sing N N 162 HIS CB HB2 sing N N 163 HIS CB HB3 sing N N 164 HIS CG ND1 sing Y N 165 HIS CG CD2 doub Y N 166 HIS ND1 CE1 doub Y N 167 HIS ND1 HD1 sing N N 168 HIS CD2 NE2 sing Y N 169 HIS CD2 HD2 sing N N 170 HIS CE1 NE2 sing Y N 171 HIS CE1 HE1 sing N N 172 HIS NE2 HE2 sing N N 173 HIS OXT HXT sing N N 174 HOH O H1 sing N N 175 HOH O H2 sing N N 176 ILE N CA sing N N 177 ILE N H sing N N 178 ILE N H2 sing N N 179 ILE CA C sing N N 180 ILE CA CB sing N N 181 ILE CA HA sing N N 182 ILE C O doub N N 183 ILE C OXT sing N N 184 ILE CB CG1 sing N N 185 ILE CB CG2 sing N N 186 ILE CB HB sing N N 187 ILE CG1 CD1 sing N N 188 ILE CG1 HG12 sing N N 189 ILE CG1 HG13 sing N N 190 ILE CG2 HG21 sing N N 191 ILE CG2 HG22 sing N N 192 ILE CG2 HG23 sing N N 193 ILE CD1 HD11 sing N N 194 ILE CD1 HD12 sing N N 195 ILE CD1 HD13 sing N N 196 ILE OXT HXT sing N N 197 LEU N CA sing N N 198 LEU N H sing N N 199 LEU N H2 sing N N 200 LEU CA C sing N N 201 LEU CA CB sing N N 202 LEU CA HA sing N N 203 LEU C O doub N N 204 LEU C OXT sing N N 205 LEU CB CG sing N N 206 LEU CB HB2 sing N N 207 LEU CB HB3 sing N N 208 LEU CG CD1 sing N N 209 LEU CG CD2 sing N N 210 LEU CG HG sing N N 211 LEU CD1 HD11 sing N N 212 LEU CD1 HD12 sing N N 213 LEU CD1 HD13 sing N N 214 LEU CD2 HD21 sing N N 215 LEU CD2 HD22 sing N N 216 LEU CD2 HD23 sing N N 217 LEU OXT HXT sing N N 218 LYS N CA sing N N 219 LYS N H sing N N 220 LYS N H2 sing N N 221 LYS CA C sing N N 222 LYS CA CB sing N N 223 LYS CA HA sing N N 224 LYS C O doub N N 225 LYS C OXT sing N N 226 LYS CB CG sing N N 227 LYS CB HB2 sing N N 228 LYS CB HB3 sing N N 229 LYS CG CD sing N N 230 LYS CG HG2 sing N N 231 LYS CG HG3 sing N N 232 LYS CD CE sing N N 233 LYS CD HD2 sing N N 234 LYS CD HD3 sing N N 235 LYS CE NZ sing N N 236 LYS CE HE2 sing N N 237 LYS CE HE3 sing N N 238 LYS NZ HZ1 sing N N 239 LYS NZ HZ2 sing N N 240 LYS NZ HZ3 sing N N 241 LYS OXT HXT sing N N 242 MET N CA sing N N 243 MET N H sing N N 244 MET N H2 sing N N 245 MET CA C sing N N 246 MET CA CB sing N N 247 MET CA HA sing N N 248 MET C O doub N N 249 MET C OXT sing N N 250 MET CB CG sing N N 251 MET CB HB2 sing N N 252 MET CB HB3 sing N N 253 MET CG SD sing N N 254 MET CG HG2 sing N N 255 MET CG HG3 sing N N 256 MET SD CE sing N N 257 MET CE HE1 sing N N 258 MET CE HE2 sing N N 259 MET CE HE3 sing N N 260 MET OXT HXT sing N N 261 PHE N CA sing N N 262 PHE N H sing N N 263 PHE N H2 sing N N 264 PHE CA C sing N N 265 PHE CA CB sing N N 266 PHE CA HA sing N N 267 PHE C O doub N N 268 PHE C OXT sing N N 269 PHE CB CG sing N N 270 PHE CB HB2 sing N N 271 PHE CB HB3 sing N N 272 PHE CG CD1 doub Y N 273 PHE CG CD2 sing Y N 274 PHE CD1 CE1 sing Y N 275 PHE CD1 HD1 sing N N 276 PHE CD2 CE2 doub Y N 277 PHE CD2 HD2 sing N N 278 PHE CE1 CZ doub Y N 279 PHE CE1 HE1 sing N N 280 PHE CE2 CZ sing Y N 281 PHE CE2 HE2 sing N N 282 PHE CZ HZ sing N N 283 PHE OXT HXT sing N N 284 PRO N CA sing N N 285 PRO N CD sing N N 286 PRO N H sing N N 287 PRO CA C sing N N 288 PRO CA CB sing N N 289 PRO CA HA sing N N 290 PRO C O doub N N 291 PRO C OXT sing N N 292 PRO CB CG sing N N 293 PRO CB HB2 sing N N 294 PRO CB HB3 sing N N 295 PRO CG CD sing N N 296 PRO CG HG2 sing N N 297 PRO CG HG3 sing N N 298 PRO CD HD2 sing N N 299 PRO CD HD3 sing N N 300 PRO OXT HXT sing N N 301 SER N CA sing N N 302 SER N H sing N N 303 SER N H2 sing N N 304 SER CA C sing N N 305 SER CA CB sing N N 306 SER CA HA sing N N 307 SER C O doub N N 308 SER C OXT sing N N 309 SER CB OG sing N N 310 SER CB HB2 sing N N 311 SER CB HB3 sing N N 312 SER OG HG sing N N 313 SER OXT HXT sing N N 314 SO4 S O1 doub N N 315 SO4 S O2 doub N N 316 SO4 S O3 sing N N 317 SO4 S O4 sing N N 318 THR N CA sing N N 319 THR N H sing N N 320 THR N H2 sing N N 321 THR CA C sing N N 322 THR CA CB sing N N 323 THR CA HA sing N N 324 THR C O doub N N 325 THR C OXT sing N N 326 THR CB OG1 sing N N 327 THR CB CG2 sing N N 328 THR CB HB sing N N 329 THR OG1 HG1 sing N N 330 THR CG2 HG21 sing N N 331 THR CG2 HG22 sing N N 332 THR CG2 HG23 sing N N 333 THR OXT HXT sing N N 334 TRP N CA sing N N 335 TRP N H sing N N 336 TRP N H2 sing N N 337 TRP CA C sing N N 338 TRP CA CB sing N N 339 TRP CA HA sing N N 340 TRP C O doub N N 341 TRP C OXT sing N N 342 TRP CB CG sing N N 343 TRP CB HB2 sing N N 344 TRP CB HB3 sing N N 345 TRP CG CD1 doub Y N 346 TRP CG CD2 sing Y N 347 TRP CD1 NE1 sing Y N 348 TRP CD1 HD1 sing N N 349 TRP CD2 CE2 doub Y N 350 TRP CD2 CE3 sing Y N 351 TRP NE1 CE2 sing Y N 352 TRP NE1 HE1 sing N N 353 TRP CE2 CZ2 sing Y N 354 TRP CE3 CZ3 doub Y N 355 TRP CE3 HE3 sing N N 356 TRP CZ2 CH2 doub Y N 357 TRP CZ2 HZ2 sing N N 358 TRP CZ3 CH2 sing Y N 359 TRP CZ3 HZ3 sing N N 360 TRP CH2 HH2 sing N N 361 TRP OXT HXT sing N N 362 TYR N CA sing N N 363 TYR N H sing N N 364 TYR N H2 sing N N 365 TYR CA C sing N N 366 TYR CA CB sing N N 367 TYR CA HA sing N N 368 TYR C O doub N N 369 TYR C OXT sing N N 370 TYR CB CG sing N N 371 TYR CB HB2 sing N N 372 TYR CB HB3 sing N N 373 TYR CG CD1 doub Y N 374 TYR CG CD2 sing Y N 375 TYR CD1 CE1 sing Y N 376 TYR CD1 HD1 sing N N 377 TYR CD2 CE2 doub Y N 378 TYR CD2 HD2 sing N N 379 TYR CE1 CZ doub Y N 380 TYR CE1 HE1 sing N N 381 TYR CE2 CZ sing Y N 382 TYR CE2 HE2 sing N N 383 TYR CZ OH sing N N 384 TYR OH HH sing N N 385 TYR OXT HXT sing N N 386 VAL N CA sing N N 387 VAL N H sing N N 388 VAL N H2 sing N N 389 VAL CA C sing N N 390 VAL CA CB sing N N 391 VAL CA HA sing N N 392 VAL C O doub N N 393 VAL C OXT sing N N 394 VAL CB CG1 sing N N 395 VAL CB CG2 sing N N 396 VAL CB HB sing N N 397 VAL CG1 HG11 sing N N 398 VAL CG1 HG12 sing N N 399 VAL CG1 HG13 sing N N 400 VAL CG2 HG21 sing N N 401 VAL CG2 HG22 sing N N 402 VAL CG2 HG23 sing N N 403 VAL OXT HXT sing N N 404 # _pdbx_initial_refinement_model.accession_code 5HMB _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.details D_1000217232 # _atom_sites.entry_id 5HMC _atom_sites.fract_transf_matrix[1][1] 0.014756 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014756 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007129 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_