data_5HRJ
# 
_entry.id   5HRJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.398 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   5HRJ         pdb_00005hrj 10.2210/pdb5hrj/pdb 
WWPDB D_1000217608 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2017-07-19 
2 'Structure model' 1 1 2017-10-04 
3 'Structure model' 1 2 2023-11-08 
4 'Structure model' 1 3 2024-11-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'        
2 3 'Structure model' 'Data collection'        
3 3 'Structure model' 'Database references'    
4 3 'Structure model' 'Refinement description' 
5 4 'Structure model' 'Structure summary'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' diffrn_detector               
2 3 'Structure model' chem_comp_atom                
3 3 'Structure model' chem_comp_bond                
4 3 'Structure model' database_2                    
5 3 'Structure model' pdbx_initial_refinement_model 
6 4 'Structure model' pdbx_entry_details            
7 4 'Structure model' pdbx_modification_feature     
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_diffrn_detector.detector'           
2 3 'Structure model' '_database_2.pdbx_DOI'                
3 3 'Structure model' '_database_2.pdbx_database_accession' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5HRJ 
_pdbx_database_status.recvd_initial_deposition_date   2016-01-23 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ma, H.'    1 
'Jiang, L.' 2 
'Qiao, S.'  3 
'Zhang, G.' 4 
'Li, R.'    5 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'To Be Published' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            0353 
_citation.journal_id_ISSN           ? 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            ? 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     'Crystal structure of the scavenger receptor cysteine-rich domain 5 (SRCR5) from porcine CD163' 
_citation.year                      ? 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Ma, H.'    1 ? 
primary 'Jiang, L.' 2 ? 
primary 'Qiao, S.'  3 ? 
primary 'Zhang, G.' 4 ? 
primary 'Li, R.'    5 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Scavenger receptor cysteine-rich type 1 protein M130' 11636.828 1  ? ? 
'scavenger receptor cysteine-rich domain 5 (SRCR5), UNP residues 477-577' ? 
2 water   nat water                                                  18.015    72 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;PRLVGGDIPCSGRVEVQHGDTWGTVCDSDFSLEAASVLCRELQCGTVVSLLGGAHFGEGSGQIWAEEFQCEGHESHLSLC
PVAPRPDGTCSHSRDVGVVCSVDHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;PRLVGGDIPCSGRVEVQHGDTWGTVCDSDFSLEAASVLCRELQCGTVVSLLGGAHFGEGSGQIWAEEFQCEGHESHLSLC
PVAPRPDGTCSHSRDVGVVCSVDHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PRO n 
1 2   ARG n 
1 3   LEU n 
1 4   VAL n 
1 5   GLY n 
1 6   GLY n 
1 7   ASP n 
1 8   ILE n 
1 9   PRO n 
1 10  CYS n 
1 11  SER n 
1 12  GLY n 
1 13  ARG n 
1 14  VAL n 
1 15  GLU n 
1 16  VAL n 
1 17  GLN n 
1 18  HIS n 
1 19  GLY n 
1 20  ASP n 
1 21  THR n 
1 22  TRP n 
1 23  GLY n 
1 24  THR n 
1 25  VAL n 
1 26  CYS n 
1 27  ASP n 
1 28  SER n 
1 29  ASP n 
1 30  PHE n 
1 31  SER n 
1 32  LEU n 
1 33  GLU n 
1 34  ALA n 
1 35  ALA n 
1 36  SER n 
1 37  VAL n 
1 38  LEU n 
1 39  CYS n 
1 40  ARG n 
1 41  GLU n 
1 42  LEU n 
1 43  GLN n 
1 44  CYS n 
1 45  GLY n 
1 46  THR n 
1 47  VAL n 
1 48  VAL n 
1 49  SER n 
1 50  LEU n 
1 51  LEU n 
1 52  GLY n 
1 53  GLY n 
1 54  ALA n 
1 55  HIS n 
1 56  PHE n 
1 57  GLY n 
1 58  GLU n 
1 59  GLY n 
1 60  SER n 
1 61  GLY n 
1 62  GLN n 
1 63  ILE n 
1 64  TRP n 
1 65  ALA n 
1 66  GLU n 
1 67  GLU n 
1 68  PHE n 
1 69  GLN n 
1 70  CYS n 
1 71  GLU n 
1 72  GLY n 
1 73  HIS n 
1 74  GLU n 
1 75  SER n 
1 76  HIS n 
1 77  LEU n 
1 78  SER n 
1 79  LEU n 
1 80  CYS n 
1 81  PRO n 
1 82  VAL n 
1 83  ALA n 
1 84  PRO n 
1 85  ARG n 
1 86  PRO n 
1 87  ASP n 
1 88  GLY n 
1 89  THR n 
1 90  CYS n 
1 91  SER n 
1 92  HIS n 
1 93  SER n 
1 94  ARG n 
1 95  ASP n 
1 96  VAL n 
1 97  GLY n 
1 98  VAL n 
1 99  VAL n 
1 100 CYS n 
1 101 SER n 
1 102 VAL n 
1 103 ASP n 
1 104 HIS n 
1 105 HIS n 
1 106 HIS n 
1 107 HIS n 
1 108 HIS n 
1 109 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   109 
_entity_src_gen.gene_src_common_name               Pig 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'CD163, M130' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Sus scrofa' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9823 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Pichia pastoris' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     4922 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               X-33 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pPICZ-alpha-A 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   PRO 1   477 477 PRO PRO A . n 
A 1 2   ARG 2   478 478 ARG ARG A . n 
A 1 3   LEU 3   479 479 LEU LEU A . n 
A 1 4   VAL 4   480 480 VAL VAL A . n 
A 1 5   GLY 5   481 481 GLY GLY A . n 
A 1 6   GLY 6   482 482 GLY GLY A . n 
A 1 7   ASP 7   483 483 ASP ASP A . n 
A 1 8   ILE 8   484 484 ILE ILE A . n 
A 1 9   PRO 9   485 485 PRO PRO A . n 
A 1 10  CYS 10  486 486 CYS CYS A . n 
A 1 11  SER 11  487 487 SER SER A . n 
A 1 12  GLY 12  488 488 GLY GLY A . n 
A 1 13  ARG 13  489 489 ARG ARG A . n 
A 1 14  VAL 14  490 490 VAL VAL A . n 
A 1 15  GLU 15  491 491 GLU GLU A . n 
A 1 16  VAL 16  492 492 VAL VAL A . n 
A 1 17  GLN 17  493 493 GLN GLN A . n 
A 1 18  HIS 18  494 494 HIS HIS A . n 
A 1 19  GLY 19  495 495 GLY GLY A . n 
A 1 20  ASP 20  496 496 ASP ASP A . n 
A 1 21  THR 21  497 497 THR THR A . n 
A 1 22  TRP 22  498 498 TRP TRP A . n 
A 1 23  GLY 23  499 499 GLY GLY A . n 
A 1 24  THR 24  500 500 THR THR A . n 
A 1 25  VAL 25  501 501 VAL VAL A . n 
A 1 26  CYS 26  502 502 CYS CYS A . n 
A 1 27  ASP 27  503 503 ASP ASP A . n 
A 1 28  SER 28  504 504 SER SER A . n 
A 1 29  ASP 29  505 505 ASP ASP A . n 
A 1 30  PHE 30  506 506 PHE PHE A . n 
A 1 31  SER 31  507 507 SER SER A . n 
A 1 32  LEU 32  508 508 LEU LEU A . n 
A 1 33  GLU 33  509 509 GLU GLU A . n 
A 1 34  ALA 34  510 510 ALA ALA A . n 
A 1 35  ALA 35  511 511 ALA ALA A . n 
A 1 36  SER 36  512 512 SER SER A . n 
A 1 37  VAL 37  513 513 VAL VAL A . n 
A 1 38  LEU 38  514 514 LEU LEU A . n 
A 1 39  CYS 39  515 515 CYS CYS A . n 
A 1 40  ARG 40  516 516 ARG ARG A . n 
A 1 41  GLU 41  517 517 GLU GLU A . n 
A 1 42  LEU 42  518 518 LEU LEU A . n 
A 1 43  GLN 43  519 519 GLN GLN A . n 
A 1 44  CYS 44  520 520 CYS CYS A . n 
A 1 45  GLY 45  521 521 GLY GLY A . n 
A 1 46  THR 46  522 522 THR THR A . n 
A 1 47  VAL 47  523 523 VAL VAL A . n 
A 1 48  VAL 48  524 524 VAL VAL A . n 
A 1 49  SER 49  525 525 SER SER A . n 
A 1 50  LEU 50  526 526 LEU LEU A . n 
A 1 51  LEU 51  527 527 LEU LEU A . n 
A 1 52  GLY 52  528 528 GLY GLY A . n 
A 1 53  GLY 53  529 529 GLY GLY A . n 
A 1 54  ALA 54  530 530 ALA ALA A . n 
A 1 55  HIS 55  531 531 HIS HIS A . n 
A 1 56  PHE 56  532 532 PHE PHE A . n 
A 1 57  GLY 57  533 533 GLY GLY A . n 
A 1 58  GLU 58  534 534 GLU GLU A . n 
A 1 59  GLY 59  535 535 GLY GLY A . n 
A 1 60  SER 60  536 536 SER SER A . n 
A 1 61  GLY 61  537 537 GLY GLY A . n 
A 1 62  GLN 62  538 538 GLN GLN A . n 
A 1 63  ILE 63  539 539 ILE ILE A . n 
A 1 64  TRP 64  540 540 TRP TRP A . n 
A 1 65  ALA 65  541 541 ALA ALA A . n 
A 1 66  GLU 66  542 542 GLU GLU A . n 
A 1 67  GLU 67  543 543 GLU GLU A . n 
A 1 68  PHE 68  544 544 PHE PHE A . n 
A 1 69  GLN 69  545 545 GLN GLN A . n 
A 1 70  CYS 70  546 546 CYS CYS A . n 
A 1 71  GLU 71  547 547 GLU GLU A . n 
A 1 72  GLY 72  548 548 GLY GLY A . n 
A 1 73  HIS 73  549 549 HIS HIS A . n 
A 1 74  GLU 74  550 550 GLU GLU A . n 
A 1 75  SER 75  551 551 SER SER A . n 
A 1 76  HIS 76  552 552 HIS HIS A . n 
A 1 77  LEU 77  553 553 LEU LEU A . n 
A 1 78  SER 78  554 554 SER SER A . n 
A 1 79  LEU 79  555 555 LEU LEU A . n 
A 1 80  CYS 80  556 556 CYS CYS A . n 
A 1 81  PRO 81  557 557 PRO PRO A . n 
A 1 82  VAL 82  558 558 VAL VAL A . n 
A 1 83  ALA 83  559 559 ALA ALA A . n 
A 1 84  PRO 84  560 560 PRO PRO A . n 
A 1 85  ARG 85  561 561 ARG ARG A . n 
A 1 86  PRO 86  562 562 PRO PRO A . n 
A 1 87  ASP 87  563 563 ASP ASP A . n 
A 1 88  GLY 88  564 564 GLY GLY A . n 
A 1 89  THR 89  565 565 THR THR A . n 
A 1 90  CYS 90  566 566 CYS CYS A . n 
A 1 91  SER 91  567 567 SER SER A . n 
A 1 92  HIS 92  568 568 HIS HIS A . n 
A 1 93  SER 93  569 569 SER SER A . n 
A 1 94  ARG 94  570 570 ARG ARG A . n 
A 1 95  ASP 95  571 571 ASP ASP A . n 
A 1 96  VAL 96  572 572 VAL VAL A . n 
A 1 97  GLY 97  573 573 GLY GLY A . n 
A 1 98  VAL 98  574 574 VAL VAL A . n 
A 1 99  VAL 99  575 575 VAL VAL A . n 
A 1 100 CYS 100 576 576 CYS CYS A . n 
A 1 101 SER 101 577 577 SER SER A . n 
A 1 102 VAL 102 578 ?   ?   ?   A . n 
A 1 103 ASP 103 579 ?   ?   ?   A . n 
A 1 104 HIS 104 580 ?   ?   ?   A . n 
A 1 105 HIS 105 581 ?   ?   ?   A . n 
A 1 106 HIS 106 582 ?   ?   ?   A . n 
A 1 107 HIS 107 583 ?   ?   ?   A . n 
A 1 108 HIS 108 584 ?   ?   ?   A . n 
A 1 109 HIS 109 585 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1  601 5  HOH HOH A . 
B 2 HOH 2  602 25 HOH HOH A . 
B 2 HOH 3  603 72 HOH HOH A . 
B 2 HOH 4  604 24 HOH HOH A . 
B 2 HOH 5  605 3  HOH HOH A . 
B 2 HOH 6  606 8  HOH HOH A . 
B 2 HOH 7  607 55 HOH HOH A . 
B 2 HOH 8  608 28 HOH HOH A . 
B 2 HOH 9  609 35 HOH HOH A . 
B 2 HOH 10 610 19 HOH HOH A . 
B 2 HOH 11 611 20 HOH HOH A . 
B 2 HOH 12 612 15 HOH HOH A . 
B 2 HOH 13 613 12 HOH HOH A . 
B 2 HOH 14 614 9  HOH HOH A . 
B 2 HOH 15 615 11 HOH HOH A . 
B 2 HOH 16 616 14 HOH HOH A . 
B 2 HOH 17 617 27 HOH HOH A . 
B 2 HOH 18 618 46 HOH HOH A . 
B 2 HOH 19 619 26 HOH HOH A . 
B 2 HOH 20 620 44 HOH HOH A . 
B 2 HOH 21 621 22 HOH HOH A . 
B 2 HOH 22 622 30 HOH HOH A . 
B 2 HOH 23 623 21 HOH HOH A . 
B 2 HOH 24 624 33 HOH HOH A . 
B 2 HOH 25 625 1  HOH HOH A . 
B 2 HOH 26 626 4  HOH HOH A . 
B 2 HOH 27 627 56 HOH HOH A . 
B 2 HOH 28 628 34 HOH HOH A . 
B 2 HOH 29 629 54 HOH HOH A . 
B 2 HOH 30 630 48 HOH HOH A . 
B 2 HOH 31 631 13 HOH HOH A . 
B 2 HOH 32 632 2  HOH HOH A . 
B 2 HOH 33 633 10 HOH HOH A . 
B 2 HOH 34 634 60 HOH HOH A . 
B 2 HOH 35 635 17 HOH HOH A . 
B 2 HOH 36 636 41 HOH HOH A . 
B 2 HOH 37 637 7  HOH HOH A . 
B 2 HOH 38 638 62 HOH HOH A . 
B 2 HOH 39 639 6  HOH HOH A . 
B 2 HOH 40 640 45 HOH HOH A . 
B 2 HOH 41 641 23 HOH HOH A . 
B 2 HOH 42 642 36 HOH HOH A . 
B 2 HOH 43 643 18 HOH HOH A . 
B 2 HOH 44 644 47 HOH HOH A . 
B 2 HOH 45 645 40 HOH HOH A . 
B 2 HOH 46 646 43 HOH HOH A . 
B 2 HOH 47 647 57 HOH HOH A . 
B 2 HOH 48 648 31 HOH HOH A . 
B 2 HOH 49 649 52 HOH HOH A . 
B 2 HOH 50 650 29 HOH HOH A . 
B 2 HOH 51 651 61 HOH HOH A . 
B 2 HOH 52 652 70 HOH HOH A . 
B 2 HOH 53 653 63 HOH HOH A . 
B 2 HOH 54 654 42 HOH HOH A . 
B 2 HOH 55 655 16 HOH HOH A . 
B 2 HOH 56 656 64 HOH HOH A . 
B 2 HOH 57 657 39 HOH HOH A . 
B 2 HOH 58 658 50 HOH HOH A . 
B 2 HOH 59 659 65 HOH HOH A . 
B 2 HOH 60 660 49 HOH HOH A . 
B 2 HOH 61 661 66 HOH HOH A . 
B 2 HOH 62 662 58 HOH HOH A . 
B 2 HOH 63 663 68 HOH HOH A . 
B 2 HOH 64 664 37 HOH HOH A . 
B 2 HOH 65 665 67 HOH HOH A . 
B 2 HOH 66 666 59 HOH HOH A . 
B 2 HOH 67 667 69 HOH HOH A . 
B 2 HOH 68 668 38 HOH HOH A . 
B 2 HOH 69 669 32 HOH HOH A . 
B 2 HOH 70 670 53 HOH HOH A . 
B 2 HOH 71 671 51 HOH HOH A . 
B 2 HOH 72 672 71 HOH HOH A . 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? REFMAC   ? ? ? 5.8.0103 1 
? 'data collection' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? .        2 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? XDS      ? ? ? .        3 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5HRJ 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     29.720 
_cell.length_a_esd                 ? 
_cell.length_b                     73.010 
_cell.length_b_esd                 ? 
_cell.length_c                     87.400 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5HRJ 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5HRJ 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            1.96 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         37.30 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              4.6 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '25% (w/v) PEG 4000, 200mM (NH4)2SO4, 100mM sodium acetate, pH 4.6' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-10-14 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'NFPSS BEAMLINE BL19U1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.979 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL19U1 
_diffrn_source.pdbx_synchrotron_site       NFPSS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5HRJ 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.80 
_reflns.d_resolution_low                 29.1 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       8953 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             97.7 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  13.1 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            29.1 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  . 
_reflns_shell.d_res_low                   ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            -0.57 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -0.00 
_refine.aniso_B[2][2]                            -0.95 
_refine.aniso_B[2][3]                            0.00 
_refine.aniso_B[3][3]                            1.52 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               16.370 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.917 
_refine.correlation_coeff_Fo_to_Fc_free          0.873 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5HRJ 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.80 
_refine.ls_d_res_low                             29.1 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     8487 
_refine.ls_number_reflns_R_free                  443 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    97.24 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.21495 
_refine.ls_R_factor_R_free                       0.25341 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.21300 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      1BY2 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.156 
_refine.pdbx_overall_ESU_R_Free                  0.145 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             2.888 
_refine.overall_SU_ML                            0.093 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        737 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             72 
_refine_hist.number_atoms_total               809 
_refine_hist.d_res_high                       1.80 
_refine_hist.d_res_low                        29.1 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.008  0.019  757  ? r_bond_refined_d             ? ? 
'X-RAY DIFFRACTION' ? 0.003  0.020  669  ? r_bond_other_d               ? ? 
'X-RAY DIFFRACTION' ? 1.333  1.933  1030 ? r_angle_refined_deg          ? ? 
'X-RAY DIFFRACTION' ? 0.925  3.000  1548 ? r_angle_other_deg            ? ? 
'X-RAY DIFFRACTION' ? 7.579  5.000  100  ? r_dihedral_angle_1_deg       ? ? 
'X-RAY DIFFRACTION' ? 26.722 23.939 33   ? r_dihedral_angle_2_deg       ? ? 
'X-RAY DIFFRACTION' ? 12.782 15.000 109  ? r_dihedral_angle_3_deg       ? ? 
'X-RAY DIFFRACTION' ? 17.037 15.000 5    ? r_dihedral_angle_4_deg       ? ? 
'X-RAY DIFFRACTION' ? 0.080  0.200  112  ? r_chiral_restr               ? ? 
'X-RAY DIFFRACTION' ? 0.005  0.021  880  ? r_gen_planes_refined         ? ? 
'X-RAY DIFFRACTION' ? 0.001  0.020  171  ? r_gen_planes_other           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbd_refined                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbd_other                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbtor_refined              ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbtor_other                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_xyhbond_nbd_refined        ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_xyhbond_nbd_other          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_metal_ion_refined          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_metal_ion_other            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_vdw_refined       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_vdw_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_hbond_refined     ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_hbond_other       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_metal_ion_refined ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_metal_ion_other   ? ? 
'X-RAY DIFFRACTION' ? 1.080  1.494  403  ? r_mcbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 1.075  1.492  402  ? r_mcbond_other               ? ? 
'X-RAY DIFFRACTION' ? 1.876  2.236  502  ? r_mcangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 1.876  2.238  503  ? r_mcangle_other              ? ? 
'X-RAY DIFFRACTION' ? 1.105  1.637  354  ? r_scbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 1.104  1.637  354  ? r_scbond_other               ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_scangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 1.814  2.415  529  ? r_scangle_other              ? ? 
'X-RAY DIFFRACTION' ? 5.114  12.915 864  ? r_long_range_B_refined       ? ? 
'X-RAY DIFFRACTION' ? 4.349  12.185 831  ? r_long_range_B_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_rigid_bond_restr           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_sphericity_free            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_sphericity_bonded          ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       1.800 
_refine_ls_shell.d_res_low                        1.847 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             34 
_refine_ls_shell.number_reflns_R_work             597 
_refine_ls_shell.percent_reflns_obs               95.61 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.211 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.194 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     5HRJ 
_struct.title                        
'Crystal structure of the scavenger receptor cysteine-rich domain 5 (SRCR5) from porcine CD163' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5HRJ 
_struct_keywords.text            'CD163, SRCR, PRRSV, BALBES NMR, ENDOCYTOSIS' 
_struct_keywords.pdbx_keywords   ENDOCYTOSIS 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    C163A_PIG 
_struct_ref.pdbx_db_accession          Q2VL90 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;PRLVGGDIPCSGRVEVQHGDTWGTVCDSDFSLEAASVLCRELQCGTVVSLLGGAHFGEGSGQIWAEEFQCEGHESHLSLC
PVAPRPDGTCSHSRDVGVVCS
;
_struct_ref.pdbx_align_begin           477 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              5HRJ 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 101 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q2VL90 
_struct_ref_seq.db_align_beg                  477 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  577 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       477 
_struct_ref_seq.pdbx_auth_seq_align_end       577 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5HRJ VAL A 102 ? UNP Q2VL90 ? ? 'expression tag' 578 1 
1 5HRJ ASP A 103 ? UNP Q2VL90 ? ? 'expression tag' 579 2 
1 5HRJ HIS A 104 ? UNP Q2VL90 ? ? 'expression tag' 580 3 
1 5HRJ HIS A 105 ? UNP Q2VL90 ? ? 'expression tag' 581 4 
1 5HRJ HIS A 106 ? UNP Q2VL90 ? ? 'expression tag' 582 5 
1 5HRJ HIS A 107 ? UNP Q2VL90 ? ? 'expression tag' 583 6 
1 5HRJ HIS A 108 ? UNP Q2VL90 ? ? 'expression tag' 584 7 
1 5HRJ HIS A 109 ? UNP Q2VL90 ? ? 'expression tag' 585 8 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 0    ? 
1 MORE         0    ? 
1 'SSA (A^2)'  5200 ? 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 SER A 31 ? LEU A 42 ? SER A 507 LEU A 518 1 ? 12 
HELX_P HELX_P2 AA2 HIS A 76 ? CYS A 80 ? HIS A 552 CYS A 556 5 ? 5  
HELX_P HELX_P3 AA3 SER A 91 ? ASP A 95 ? SER A 567 ASP A 571 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ? ? A CYS 10 SG ? ? ? 1_555 A CYS 44  SG ? ? A CYS 486 A CYS 520 1_555 ? ? ? ? ? ? ? 2.085 ? ? 
disulf2 disulf ? ? A CYS 26 SG ? ? ? 1_555 A CYS 90  SG ? ? A CYS 502 A CYS 566 1_555 ? ? ? ? ? ? ? 2.039 ? ? 
disulf3 disulf ? ? A CYS 39 SG ? ? ? 1_555 A CYS 100 SG ? ? A CYS 515 A CYS 576 1_555 ? ? ? ? ? ? ? 1.976 ? ? 
disulf4 disulf ? ? A CYS 70 SG ? ? ? 1_555 A CYS 80  SG ? ? A CYS 546 A CYS 556 1_555 ? ? ? ? ? ? ? 2.126 ? ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_modification_feature.ordinal 
_pdbx_modification_feature.label_comp_id 
_pdbx_modification_feature.label_asym_id 
_pdbx_modification_feature.label_seq_id 
_pdbx_modification_feature.label_alt_id 
_pdbx_modification_feature.modified_residue_label_comp_id 
_pdbx_modification_feature.modified_residue_label_asym_id 
_pdbx_modification_feature.modified_residue_label_seq_id 
_pdbx_modification_feature.modified_residue_label_alt_id 
_pdbx_modification_feature.auth_comp_id 
_pdbx_modification_feature.auth_asym_id 
_pdbx_modification_feature.auth_seq_id 
_pdbx_modification_feature.PDB_ins_code 
_pdbx_modification_feature.symmetry 
_pdbx_modification_feature.modified_residue_auth_comp_id 
_pdbx_modification_feature.modified_residue_auth_asym_id 
_pdbx_modification_feature.modified_residue_auth_seq_id 
_pdbx_modification_feature.modified_residue_PDB_ins_code 
_pdbx_modification_feature.modified_residue_symmetry 
_pdbx_modification_feature.comp_id_linking_atom 
_pdbx_modification_feature.modified_residue_id_linking_atom 
_pdbx_modification_feature.modified_residue_id 
_pdbx_modification_feature.ref_pcm_id 
_pdbx_modification_feature.ref_comp_id 
_pdbx_modification_feature.type 
_pdbx_modification_feature.category 
1 CYS A 10 ? CYS A 44  ? CYS A 486 ? 1_555 CYS A 520 ? 1_555 SG SG . . . None 'Disulfide bridge' 
2 CYS A 26 ? CYS A 90  ? CYS A 502 ? 1_555 CYS A 566 ? 1_555 SG SG . . . None 'Disulfide bridge' 
3 CYS A 39 ? CYS A 100 ? CYS A 515 ? 1_555 CYS A 576 ? 1_555 SG SG . . . None 'Disulfide bridge' 
4 CYS A 70 ? CYS A 80  ? CYS A 546 ? 1_555 CYS A 556 ? 1_555 SG SG . . . None 'Disulfide bridge' 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 4 ? 
AA3 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? parallel      
AA3 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ARG A 2  ? GLY A 5   ? ARG A 478 GLY A 481 
AA1 2 SER A 11 ? HIS A 18  ? SER A 487 HIS A 494 
AA1 3 GLY A 97 ? CYS A 100 ? GLY A 573 CYS A 576 
AA1 4 VAL A 47 ? LEU A 51  ? VAL A 523 LEU A 527 
AA2 1 ARG A 2  ? GLY A 5   ? ARG A 478 GLY A 481 
AA2 2 SER A 11 ? HIS A 18  ? SER A 487 HIS A 494 
AA2 3 THR A 21 ? THR A 24  ? THR A 497 THR A 500 
AA2 4 GLN A 62 ? ILE A 63  ? GLN A 538 ILE A 539 
AA3 1 GLU A 66 ? PHE A 68  ? GLU A 542 PHE A 544 
AA3 2 VAL A 82 ? PRO A 84  ? VAL A 558 PRO A 560 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N VAL A 4  ? N VAL A 480 O ARG A 13 ? O ARG A 489 
AA1 2 3 N GLY A 12 ? N GLY A 488 O VAL A 98 ? O VAL A 574 
AA1 3 4 O GLY A 97 ? O GLY A 573 N LEU A 51 ? N LEU A 527 
AA2 1 2 N VAL A 4  ? N VAL A 480 O ARG A 13 ? O ARG A 489 
AA2 2 3 N HIS A 18 ? N HIS A 494 O THR A 21 ? O THR A 497 
AA2 3 4 N THR A 24 ? N THR A 500 O GLN A 62 ? O GLN A 538 
AA3 1 2 N GLU A 67 ? N GLU A 543 O ALA A 83 ? O ALA A 559 
# 
_pdbx_entry_details.entry_id                   5HRJ 
_pdbx_entry_details.compound_details           ? 
_pdbx_entry_details.source_details             ? 
_pdbx_entry_details.nonpolymer_details         ? 
_pdbx_entry_details.sequence_details           ? 
_pdbx_entry_details.has_ligand_of_interest     ? 
_pdbx_entry_details.has_protein_modification   Y 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OG 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   SER 
_pdbx_validate_close_contact.auth_seq_id_1    504 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   NH2 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   ARG 
_pdbx_validate_close_contact.auth_seq_id_2    570 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.08 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 636 ? B HOH . 
2 1 A HOH 663 ? B HOH . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A VAL 578 ? A VAL 102 
2 1 Y 1 A ASP 579 ? A ASP 103 
3 1 Y 1 A HIS 580 ? A HIS 104 
4 1 Y 1 A HIS 581 ? A HIS 105 
5 1 Y 1 A HIS 582 ? A HIS 106 
6 1 Y 1 A HIS 583 ? A HIS 107 
7 1 Y 1 A HIS 584 ? A HIS 108 
8 1 Y 1 A HIS 585 ? A HIS 109 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASP N    N N N 41  
ASP CA   C N S 42  
ASP C    C N N 43  
ASP O    O N N 44  
ASP CB   C N N 45  
ASP CG   C N N 46  
ASP OD1  O N N 47  
ASP OD2  O N N 48  
ASP OXT  O N N 49  
ASP H    H N N 50  
ASP H2   H N N 51  
ASP HA   H N N 52  
ASP HB2  H N N 53  
ASP HB3  H N N 54  
ASP HD2  H N N 55  
ASP HXT  H N N 56  
CYS N    N N N 57  
CYS CA   C N R 58  
CYS C    C N N 59  
CYS O    O N N 60  
CYS CB   C N N 61  
CYS SG   S N N 62  
CYS OXT  O N N 63  
CYS H    H N N 64  
CYS H2   H N N 65  
CYS HA   H N N 66  
CYS HB2  H N N 67  
CYS HB3  H N N 68  
CYS HG   H N N 69  
CYS HXT  H N N 70  
GLN N    N N N 71  
GLN CA   C N S 72  
GLN C    C N N 73  
GLN O    O N N 74  
GLN CB   C N N 75  
GLN CG   C N N 76  
GLN CD   C N N 77  
GLN OE1  O N N 78  
GLN NE2  N N N 79  
GLN OXT  O N N 80  
GLN H    H N N 81  
GLN H2   H N N 82  
GLN HA   H N N 83  
GLN HB2  H N N 84  
GLN HB3  H N N 85  
GLN HG2  H N N 86  
GLN HG3  H N N 87  
GLN HE21 H N N 88  
GLN HE22 H N N 89  
GLN HXT  H N N 90  
GLU N    N N N 91  
GLU CA   C N S 92  
GLU C    C N N 93  
GLU O    O N N 94  
GLU CB   C N N 95  
GLU CG   C N N 96  
GLU CD   C N N 97  
GLU OE1  O N N 98  
GLU OE2  O N N 99  
GLU OXT  O N N 100 
GLU H    H N N 101 
GLU H2   H N N 102 
GLU HA   H N N 103 
GLU HB2  H N N 104 
GLU HB3  H N N 105 
GLU HG2  H N N 106 
GLU HG3  H N N 107 
GLU HE2  H N N 108 
GLU HXT  H N N 109 
GLY N    N N N 110 
GLY CA   C N N 111 
GLY C    C N N 112 
GLY O    O N N 113 
GLY OXT  O N N 114 
GLY H    H N N 115 
GLY H2   H N N 116 
GLY HA2  H N N 117 
GLY HA3  H N N 118 
GLY HXT  H N N 119 
HIS N    N N N 120 
HIS CA   C N S 121 
HIS C    C N N 122 
HIS O    O N N 123 
HIS CB   C N N 124 
HIS CG   C Y N 125 
HIS ND1  N Y N 126 
HIS CD2  C Y N 127 
HIS CE1  C Y N 128 
HIS NE2  N Y N 129 
HIS OXT  O N N 130 
HIS H    H N N 131 
HIS H2   H N N 132 
HIS HA   H N N 133 
HIS HB2  H N N 134 
HIS HB3  H N N 135 
HIS HD1  H N N 136 
HIS HD2  H N N 137 
HIS HE1  H N N 138 
HIS HE2  H N N 139 
HIS HXT  H N N 140 
HOH O    O N N 141 
HOH H1   H N N 142 
HOH H2   H N N 143 
ILE N    N N N 144 
ILE CA   C N S 145 
ILE C    C N N 146 
ILE O    O N N 147 
ILE CB   C N S 148 
ILE CG1  C N N 149 
ILE CG2  C N N 150 
ILE CD1  C N N 151 
ILE OXT  O N N 152 
ILE H    H N N 153 
ILE H2   H N N 154 
ILE HA   H N N 155 
ILE HB   H N N 156 
ILE HG12 H N N 157 
ILE HG13 H N N 158 
ILE HG21 H N N 159 
ILE HG22 H N N 160 
ILE HG23 H N N 161 
ILE HD11 H N N 162 
ILE HD12 H N N 163 
ILE HD13 H N N 164 
ILE HXT  H N N 165 
LEU N    N N N 166 
LEU CA   C N S 167 
LEU C    C N N 168 
LEU O    O N N 169 
LEU CB   C N N 170 
LEU CG   C N N 171 
LEU CD1  C N N 172 
LEU CD2  C N N 173 
LEU OXT  O N N 174 
LEU H    H N N 175 
LEU H2   H N N 176 
LEU HA   H N N 177 
LEU HB2  H N N 178 
LEU HB3  H N N 179 
LEU HG   H N N 180 
LEU HD11 H N N 181 
LEU HD12 H N N 182 
LEU HD13 H N N 183 
LEU HD21 H N N 184 
LEU HD22 H N N 185 
LEU HD23 H N N 186 
LEU HXT  H N N 187 
PHE N    N N N 188 
PHE CA   C N S 189 
PHE C    C N N 190 
PHE O    O N N 191 
PHE CB   C N N 192 
PHE CG   C Y N 193 
PHE CD1  C Y N 194 
PHE CD2  C Y N 195 
PHE CE1  C Y N 196 
PHE CE2  C Y N 197 
PHE CZ   C Y N 198 
PHE OXT  O N N 199 
PHE H    H N N 200 
PHE H2   H N N 201 
PHE HA   H N N 202 
PHE HB2  H N N 203 
PHE HB3  H N N 204 
PHE HD1  H N N 205 
PHE HD2  H N N 206 
PHE HE1  H N N 207 
PHE HE2  H N N 208 
PHE HZ   H N N 209 
PHE HXT  H N N 210 
PRO N    N N N 211 
PRO CA   C N S 212 
PRO C    C N N 213 
PRO O    O N N 214 
PRO CB   C N N 215 
PRO CG   C N N 216 
PRO CD   C N N 217 
PRO OXT  O N N 218 
PRO H    H N N 219 
PRO HA   H N N 220 
PRO HB2  H N N 221 
PRO HB3  H N N 222 
PRO HG2  H N N 223 
PRO HG3  H N N 224 
PRO HD2  H N N 225 
PRO HD3  H N N 226 
PRO HXT  H N N 227 
SER N    N N N 228 
SER CA   C N S 229 
SER C    C N N 230 
SER O    O N N 231 
SER CB   C N N 232 
SER OG   O N N 233 
SER OXT  O N N 234 
SER H    H N N 235 
SER H2   H N N 236 
SER HA   H N N 237 
SER HB2  H N N 238 
SER HB3  H N N 239 
SER HG   H N N 240 
SER HXT  H N N 241 
THR N    N N N 242 
THR CA   C N S 243 
THR C    C N N 244 
THR O    O N N 245 
THR CB   C N R 246 
THR OG1  O N N 247 
THR CG2  C N N 248 
THR OXT  O N N 249 
THR H    H N N 250 
THR H2   H N N 251 
THR HA   H N N 252 
THR HB   H N N 253 
THR HG1  H N N 254 
THR HG21 H N N 255 
THR HG22 H N N 256 
THR HG23 H N N 257 
THR HXT  H N N 258 
TRP N    N N N 259 
TRP CA   C N S 260 
TRP C    C N N 261 
TRP O    O N N 262 
TRP CB   C N N 263 
TRP CG   C Y N 264 
TRP CD1  C Y N 265 
TRP CD2  C Y N 266 
TRP NE1  N Y N 267 
TRP CE2  C Y N 268 
TRP CE3  C Y N 269 
TRP CZ2  C Y N 270 
TRP CZ3  C Y N 271 
TRP CH2  C Y N 272 
TRP OXT  O N N 273 
TRP H    H N N 274 
TRP H2   H N N 275 
TRP HA   H N N 276 
TRP HB2  H N N 277 
TRP HB3  H N N 278 
TRP HD1  H N N 279 
TRP HE1  H N N 280 
TRP HE3  H N N 281 
TRP HZ2  H N N 282 
TRP HZ3  H N N 283 
TRP HH2  H N N 284 
TRP HXT  H N N 285 
VAL N    N N N 286 
VAL CA   C N S 287 
VAL C    C N N 288 
VAL O    O N N 289 
VAL CB   C N N 290 
VAL CG1  C N N 291 
VAL CG2  C N N 292 
VAL OXT  O N N 293 
VAL H    H N N 294 
VAL H2   H N N 295 
VAL HA   H N N 296 
VAL HB   H N N 297 
VAL HG11 H N N 298 
VAL HG12 H N N 299 
VAL HG13 H N N 300 
VAL HG21 H N N 301 
VAL HG22 H N N 302 
VAL HG23 H N N 303 
VAL HXT  H N N 304 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASP N   CA   sing N N 39  
ASP N   H    sing N N 40  
ASP N   H2   sing N N 41  
ASP CA  C    sing N N 42  
ASP CA  CB   sing N N 43  
ASP CA  HA   sing N N 44  
ASP C   O    doub N N 45  
ASP C   OXT  sing N N 46  
ASP CB  CG   sing N N 47  
ASP CB  HB2  sing N N 48  
ASP CB  HB3  sing N N 49  
ASP CG  OD1  doub N N 50  
ASP CG  OD2  sing N N 51  
ASP OD2 HD2  sing N N 52  
ASP OXT HXT  sing N N 53  
CYS N   CA   sing N N 54  
CYS N   H    sing N N 55  
CYS N   H2   sing N N 56  
CYS CA  C    sing N N 57  
CYS CA  CB   sing N N 58  
CYS CA  HA   sing N N 59  
CYS C   O    doub N N 60  
CYS C   OXT  sing N N 61  
CYS CB  SG   sing N N 62  
CYS CB  HB2  sing N N 63  
CYS CB  HB3  sing N N 64  
CYS SG  HG   sing N N 65  
CYS OXT HXT  sing N N 66  
GLN N   CA   sing N N 67  
GLN N   H    sing N N 68  
GLN N   H2   sing N N 69  
GLN CA  C    sing N N 70  
GLN CA  CB   sing N N 71  
GLN CA  HA   sing N N 72  
GLN C   O    doub N N 73  
GLN C   OXT  sing N N 74  
GLN CB  CG   sing N N 75  
GLN CB  HB2  sing N N 76  
GLN CB  HB3  sing N N 77  
GLN CG  CD   sing N N 78  
GLN CG  HG2  sing N N 79  
GLN CG  HG3  sing N N 80  
GLN CD  OE1  doub N N 81  
GLN CD  NE2  sing N N 82  
GLN NE2 HE21 sing N N 83  
GLN NE2 HE22 sing N N 84  
GLN OXT HXT  sing N N 85  
GLU N   CA   sing N N 86  
GLU N   H    sing N N 87  
GLU N   H2   sing N N 88  
GLU CA  C    sing N N 89  
GLU CA  CB   sing N N 90  
GLU CA  HA   sing N N 91  
GLU C   O    doub N N 92  
GLU C   OXT  sing N N 93  
GLU CB  CG   sing N N 94  
GLU CB  HB2  sing N N 95  
GLU CB  HB3  sing N N 96  
GLU CG  CD   sing N N 97  
GLU CG  HG2  sing N N 98  
GLU CG  HG3  sing N N 99  
GLU CD  OE1  doub N N 100 
GLU CD  OE2  sing N N 101 
GLU OE2 HE2  sing N N 102 
GLU OXT HXT  sing N N 103 
GLY N   CA   sing N N 104 
GLY N   H    sing N N 105 
GLY N   H2   sing N N 106 
GLY CA  C    sing N N 107 
GLY CA  HA2  sing N N 108 
GLY CA  HA3  sing N N 109 
GLY C   O    doub N N 110 
GLY C   OXT  sing N N 111 
GLY OXT HXT  sing N N 112 
HIS N   CA   sing N N 113 
HIS N   H    sing N N 114 
HIS N   H2   sing N N 115 
HIS CA  C    sing N N 116 
HIS CA  CB   sing N N 117 
HIS CA  HA   sing N N 118 
HIS C   O    doub N N 119 
HIS C   OXT  sing N N 120 
HIS CB  CG   sing N N 121 
HIS CB  HB2  sing N N 122 
HIS CB  HB3  sing N N 123 
HIS CG  ND1  sing Y N 124 
HIS CG  CD2  doub Y N 125 
HIS ND1 CE1  doub Y N 126 
HIS ND1 HD1  sing N N 127 
HIS CD2 NE2  sing Y N 128 
HIS CD2 HD2  sing N N 129 
HIS CE1 NE2  sing Y N 130 
HIS CE1 HE1  sing N N 131 
HIS NE2 HE2  sing N N 132 
HIS OXT HXT  sing N N 133 
HOH O   H1   sing N N 134 
HOH O   H2   sing N N 135 
ILE N   CA   sing N N 136 
ILE N   H    sing N N 137 
ILE N   H2   sing N N 138 
ILE CA  C    sing N N 139 
ILE CA  CB   sing N N 140 
ILE CA  HA   sing N N 141 
ILE C   O    doub N N 142 
ILE C   OXT  sing N N 143 
ILE CB  CG1  sing N N 144 
ILE CB  CG2  sing N N 145 
ILE CB  HB   sing N N 146 
ILE CG1 CD1  sing N N 147 
ILE CG1 HG12 sing N N 148 
ILE CG1 HG13 sing N N 149 
ILE CG2 HG21 sing N N 150 
ILE CG2 HG22 sing N N 151 
ILE CG2 HG23 sing N N 152 
ILE CD1 HD11 sing N N 153 
ILE CD1 HD12 sing N N 154 
ILE CD1 HD13 sing N N 155 
ILE OXT HXT  sing N N 156 
LEU N   CA   sing N N 157 
LEU N   H    sing N N 158 
LEU N   H2   sing N N 159 
LEU CA  C    sing N N 160 
LEU CA  CB   sing N N 161 
LEU CA  HA   sing N N 162 
LEU C   O    doub N N 163 
LEU C   OXT  sing N N 164 
LEU CB  CG   sing N N 165 
LEU CB  HB2  sing N N 166 
LEU CB  HB3  sing N N 167 
LEU CG  CD1  sing N N 168 
LEU CG  CD2  sing N N 169 
LEU CG  HG   sing N N 170 
LEU CD1 HD11 sing N N 171 
LEU CD1 HD12 sing N N 172 
LEU CD1 HD13 sing N N 173 
LEU CD2 HD21 sing N N 174 
LEU CD2 HD22 sing N N 175 
LEU CD2 HD23 sing N N 176 
LEU OXT HXT  sing N N 177 
PHE N   CA   sing N N 178 
PHE N   H    sing N N 179 
PHE N   H2   sing N N 180 
PHE CA  C    sing N N 181 
PHE CA  CB   sing N N 182 
PHE CA  HA   sing N N 183 
PHE C   O    doub N N 184 
PHE C   OXT  sing N N 185 
PHE CB  CG   sing N N 186 
PHE CB  HB2  sing N N 187 
PHE CB  HB3  sing N N 188 
PHE CG  CD1  doub Y N 189 
PHE CG  CD2  sing Y N 190 
PHE CD1 CE1  sing Y N 191 
PHE CD1 HD1  sing N N 192 
PHE CD2 CE2  doub Y N 193 
PHE CD2 HD2  sing N N 194 
PHE CE1 CZ   doub Y N 195 
PHE CE1 HE1  sing N N 196 
PHE CE2 CZ   sing Y N 197 
PHE CE2 HE2  sing N N 198 
PHE CZ  HZ   sing N N 199 
PHE OXT HXT  sing N N 200 
PRO N   CA   sing N N 201 
PRO N   CD   sing N N 202 
PRO N   H    sing N N 203 
PRO CA  C    sing N N 204 
PRO CA  CB   sing N N 205 
PRO CA  HA   sing N N 206 
PRO C   O    doub N N 207 
PRO C   OXT  sing N N 208 
PRO CB  CG   sing N N 209 
PRO CB  HB2  sing N N 210 
PRO CB  HB3  sing N N 211 
PRO CG  CD   sing N N 212 
PRO CG  HG2  sing N N 213 
PRO CG  HG3  sing N N 214 
PRO CD  HD2  sing N N 215 
PRO CD  HD3  sing N N 216 
PRO OXT HXT  sing N N 217 
SER N   CA   sing N N 218 
SER N   H    sing N N 219 
SER N   H2   sing N N 220 
SER CA  C    sing N N 221 
SER CA  CB   sing N N 222 
SER CA  HA   sing N N 223 
SER C   O    doub N N 224 
SER C   OXT  sing N N 225 
SER CB  OG   sing N N 226 
SER CB  HB2  sing N N 227 
SER CB  HB3  sing N N 228 
SER OG  HG   sing N N 229 
SER OXT HXT  sing N N 230 
THR N   CA   sing N N 231 
THR N   H    sing N N 232 
THR N   H2   sing N N 233 
THR CA  C    sing N N 234 
THR CA  CB   sing N N 235 
THR CA  HA   sing N N 236 
THR C   O    doub N N 237 
THR C   OXT  sing N N 238 
THR CB  OG1  sing N N 239 
THR CB  CG2  sing N N 240 
THR CB  HB   sing N N 241 
THR OG1 HG1  sing N N 242 
THR CG2 HG21 sing N N 243 
THR CG2 HG22 sing N N 244 
THR CG2 HG23 sing N N 245 
THR OXT HXT  sing N N 246 
TRP N   CA   sing N N 247 
TRP N   H    sing N N 248 
TRP N   H2   sing N N 249 
TRP CA  C    sing N N 250 
TRP CA  CB   sing N N 251 
TRP CA  HA   sing N N 252 
TRP C   O    doub N N 253 
TRP C   OXT  sing N N 254 
TRP CB  CG   sing N N 255 
TRP CB  HB2  sing N N 256 
TRP CB  HB3  sing N N 257 
TRP CG  CD1  doub Y N 258 
TRP CG  CD2  sing Y N 259 
TRP CD1 NE1  sing Y N 260 
TRP CD1 HD1  sing N N 261 
TRP CD2 CE2  doub Y N 262 
TRP CD2 CE3  sing Y N 263 
TRP NE1 CE2  sing Y N 264 
TRP NE1 HE1  sing N N 265 
TRP CE2 CZ2  sing Y N 266 
TRP CE3 CZ3  doub Y N 267 
TRP CE3 HE3  sing N N 268 
TRP CZ2 CH2  doub Y N 269 
TRP CZ2 HZ2  sing N N 270 
TRP CZ3 CH2  sing Y N 271 
TRP CZ3 HZ3  sing N N 272 
TRP CH2 HH2  sing N N 273 
TRP OXT HXT  sing N N 274 
VAL N   CA   sing N N 275 
VAL N   H    sing N N 276 
VAL N   H2   sing N N 277 
VAL CA  C    sing N N 278 
VAL CA  CB   sing N N 279 
VAL CA  HA   sing N N 280 
VAL C   O    doub N N 281 
VAL C   OXT  sing N N 282 
VAL CB  CG1  sing N N 283 
VAL CB  CG2  sing N N 284 
VAL CB  HB   sing N N 285 
VAL CG1 HG11 sing N N 286 
VAL CG1 HG12 sing N N 287 
VAL CG1 HG13 sing N N 288 
VAL CG2 HG21 sing N N 289 
VAL CG2 HG22 sing N N 290 
VAL CG2 HG23 sing N N 291 
VAL OXT HXT  sing N N 292 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   1BY2 
_pdbx_initial_refinement_model.details          ? 
# 
_atom_sites.entry_id                    5HRJ 
_atom_sites.fract_transf_matrix[1][1]   0.033647 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013697 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011442 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_