data_5HRQ # _entry.id 5HRQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.321 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5HRQ WWPDB D_1000217539 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5HRQ _pdbx_database_status.recvd_initial_deposition_date 2016-01-24 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Lieblich, S.A.' 1 ? 'Fang, K.Y.' 2 ? 'Cahn, J.K.B.' 3 ? 'Tirrell, D.A.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Am. Chem. Soc.' _citation.journal_id_ASTM JACSAT _citation.journal_id_CSD ? _citation.journal_id_ISSN 1520-5126 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 139 _citation.language ? _citation.page_first 8384 _citation.page_last 8387 _citation.title '4S-Hydroxylation of Insulin at ProB28 Accelerates Hexamer Dissociation and Delays Fibrillation.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/jacs.7b00794 _citation.pdbx_database_id_PubMed 28598606 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lieblich, S.A.' 1 ? primary 'Fang, K.Y.' 2 ? primary 'Cahn, J.K.B.' 3 ? primary 'Rawson, J.' 4 ? primary 'LeBon, J.' 5 ? primary 'Ku, H.T.' 6 ? primary 'Tirrell, D.A.' 7 ? # _cell.entry_id 5HRQ _cell.length_a 47.156 _cell.length_b 60.680 _cell.length_c 60.665 _cell.angle_alpha 90.00 _cell.angle_beta 110.82 _cell.angle_gamma 90.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5HRQ _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Insulin A-Chain' 2383.698 6 ? ? ? ? 2 polymer man 'Insulin B-Chain' 3449.953 6 ? Pro28Hzp ? ? 3 non-polymer syn PHENOL 94.111 6 ? ? ? ? 4 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? 5 non-polymer syn 'CHLORIDE ION' 35.453 2 ? ? ? ? 6 water nat water 18.015 157 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN A,C,E,G,I,K ? 2 'polypeptide(L)' no yes 'FVNQHLCGSHLVEALYLVCGERGFFYT(HZP)KT' FVNQHLCGSHLVEALYLVCGERGFFYTPKT B,D,F,H,J,L ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ILE n 1 3 VAL n 1 4 GLU n 1 5 GLN n 1 6 CYS n 1 7 CYS n 1 8 THR n 1 9 SER n 1 10 ILE n 1 11 CYS n 1 12 SER n 1 13 LEU n 1 14 TYR n 1 15 GLN n 1 16 LEU n 1 17 GLU n 1 18 ASN n 1 19 TYR n 1 20 CYS n 1 21 ASN n 2 1 PHE n 2 2 VAL n 2 3 ASN n 2 4 GLN n 2 5 HIS n 2 6 LEU n 2 7 CYS n 2 8 GLY n 2 9 SER n 2 10 HIS n 2 11 LEU n 2 12 VAL n 2 13 GLU n 2 14 ALA n 2 15 LEU n 2 16 TYR n 2 17 LEU n 2 18 VAL n 2 19 CYS n 2 20 GLY n 2 21 GLU n 2 22 ARG n 2 23 GLY n 2 24 PHE n 2 25 PHE n 2 26 TYR n 2 27 THR n 2 28 HZP n 2 29 LYS n 2 30 THR n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 21 Human ? INS ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? CAG18515 ? ? ? ? ? ? ? ? ? ? ? pQE80L ? ? 2 1 sample 'Biological sequence' 1 30 Human ? INS ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? CAG18515 ? ? ? ? ? ? ? ? ? ? ? pQE80L ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP INS_HUMAN P01308 ? 1 GIVEQCCTSICSLYQLENYCN 90 2 UNP INS_HUMAN P01308 ? 2 FVNQHLCGSHLVEALYLVCGERGFFYTPKT 25 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5HRQ A 1 ? 21 ? P01308 90 ? 110 ? 1 21 2 2 5HRQ B 1 ? 30 ? P01308 25 ? 54 ? 1 30 3 1 5HRQ C 1 ? 21 ? P01308 90 ? 110 ? 1 21 4 2 5HRQ D 1 ? 30 ? P01308 25 ? 54 ? 1 30 5 1 5HRQ E 1 ? 21 ? P01308 90 ? 110 ? 1 21 6 2 5HRQ F 1 ? 30 ? P01308 25 ? 54 ? 1 30 7 1 5HRQ G 1 ? 21 ? P01308 90 ? 110 ? 1 21 8 2 5HRQ H 1 ? 30 ? P01308 25 ? 54 ? 1 30 9 1 5HRQ I 1 ? 21 ? P01308 90 ? 110 ? 1 21 10 2 5HRQ J 1 ? 30 ? P01308 25 ? 54 ? 1 30 11 1 5HRQ K 1 ? 21 ? P01308 90 ? 110 ? 1 21 12 2 5HRQ L 1 ? 30 ? P01308 25 ? 54 ? 1 30 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 HZP 'L-peptide linking' n '(4S)-4-hydroxy-L-proline' ? 'C5 H9 N O3' 131.130 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 IPH non-polymer . PHENOL ? 'C6 H6 O' 94.111 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5HRQ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.32 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 46.93 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '300 mM Tris, 17 mM zinc acetate, 1% phenol, 7.5% acetone, 2.675 M sodium citrate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-06-24 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'LIQUID NITROGEN-COOLED DOUBLE CRYSTAL K-B FOCUSING MIRRORS' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9795 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRL BEAMLINE BL12-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9795 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL12-2 _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5HRQ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.280 _reflns.d_resolution_low 56.70 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 79335 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.000 _reflns.pdbx_Rmerge_I_obs 0.042 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.600 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects 19 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.028 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 239532 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 1.280 1.300 ? 2.100 5692 ? ? 2613 ? 62.100 ? ? ? ? 0.451 ? ? ? ? ? ? ? ? 2.200 ? ? ? ? ? 0.359 0 1 1 0.678 ? 6.880 35.660 ? 33.000 1824 ? ? 560 ? 99.100 ? ? ? ? 0.039 ? ? ? ? ? ? ? ? 3.300 ? ? ? ? ? 0.026 0 2 1 0.989 ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 5HRQ _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 75363 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 56.70 _refine.ls_d_res_high 1.28 _refine.ls_percent_reflns_obs 95.91 _refine.ls_R_factor_obs 0.13672 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.13508 _refine.ls_R_factor_R_free 0.16843 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.0 _refine.ls_number_reflns_R_free 3951 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.977 _refine.correlation_coeff_Fo_to_Fc_free 0.968 _refine.B_iso_mean 23.477 _refine.aniso_B[1][1] 0.62 _refine.aniso_B[2][2] -0.41 _refine.aniso_B[3][3] -0.41 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.43 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.040 _refine.pdbx_overall_ESU_R_Free 0.042 _refine.overall_SU_ML 0.026 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 1.348 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2349 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 46 _refine_hist.number_atoms_solvent 157 _refine_hist.number_atoms_total 2552 _refine_hist.d_res_high 1.28 _refine_hist.d_res_low 56.70 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.014 0.019 ? 2574 'X-RAY DIFFRACTION' ? r_bond_other_d 0.008 0.020 ? 2322 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.259 1.979 ? 3485 'X-RAY DIFFRACTION' ? r_angle_other_deg 1.127 3.000 ? 5324 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_chiral_restr 0.125 0.200 ? 400 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.011 0.020 ? 2909 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.007 0.020 ? 653 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 5.000 2.033 ? 1247 'X-RAY DIFFRACTION' ? r_mcbond_other 5.013 2.028 ? 1246 'X-RAY DIFFRACTION' ? r_mcangle_it 5.657 2.972 ? 1515 'X-RAY DIFFRACTION' ? r_mcangle_other 5.657 2.976 ? 1516 'X-RAY DIFFRACTION' ? r_scbond_it 11.450 2.528 ? 1327 'X-RAY DIFFRACTION' ? r_scbond_other 11.446 2.527 ? 1328 'X-RAY DIFFRACTION' ? r_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_other 13.169 3.630 ? 1955 'X-RAY DIFFRACTION' ? r_long_range_B_refined 13.051 22.223 ? 2448 'X-RAY DIFFRACTION' ? r_long_range_B_other 13.048 22.220 ? 2449 'X-RAY DIFFRACTION' ? r_rigid_bond_restr 7.279 3.000 ? 4896 'X-RAY DIFFRACTION' ? r_sphericity_free 26.701 5.000 ? 37 'X-RAY DIFFRACTION' ? r_sphericity_bonded 23.676 5.000 ? 4942 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.278 _refine_ls_shell.d_res_low 1.311 _refine_ls_shell.number_reflns_R_work 4122 _refine_ls_shell.R_factor_R_work 0.206 _refine_ls_shell.percent_reflns_obs 71.57 _refine_ls_shell.R_factor_R_free 0.235 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 218 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.number_reflns_obs ? # _struct.entry_id 5HRQ _struct.title 'Insulin with proline analog HzP at position B28 in the R6 state' _struct.pdbx_descriptor 'Insulin A-Chain, Insulin B-Chain' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5HRQ _struct_keywords.text 'Insulin, non-canonical amino acid, hydroxyproline, non-natural amino acid, unnatural amino acid, HORMONE' _struct_keywords.pdbx_keywords HORMONE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 1 ? D N N 2 ? E N N 1 ? F N N 2 ? G N N 1 ? H N N 2 ? I N N 1 ? J N N 2 ? K N N 1 ? L N N 2 ? M N N 3 ? N N N 4 ? O N N 3 ? P N N 4 ? Q N N 3 ? R N N 5 ? S N N 3 ? T N N 5 ? U N N 3 ? V N N 3 ? W N N 6 ? X N N 6 ? Y N N 6 ? Z N N 6 ? AA N N 6 ? BA N N 6 ? CA N N 6 ? DA N N 6 ? EA N N 6 ? FA N N 6 ? GA N N 6 ? HA N N 6 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 1 ? CYS A 7 ? GLY A 1 CYS A 7 1 ? 7 HELX_P HELX_P2 AA2 SER A 12 ? ASN A 18 ? SER A 12 ASN A 18 1 ? 7 HELX_P HELX_P3 AA3 VAL B 2 ? GLY B 20 ? VAL B 2 GLY B 20 1 ? 19 HELX_P HELX_P4 AA4 GLU B 21 ? GLY B 23 ? GLU B 21 GLY B 23 5 ? 3 HELX_P HELX_P5 AA5 ILE C 2 ? CYS C 7 ? ILE C 2 CYS C 7 1 ? 6 HELX_P HELX_P6 AA6 SER C 12 ? ASN C 18 ? SER C 12 ASN C 18 1 ? 7 HELX_P HELX_P7 AA7 VAL D 2 ? GLY D 20 ? VAL D 2 GLY D 20 1 ? 19 HELX_P HELX_P8 AA8 GLU D 21 ? GLY D 23 ? GLU D 21 GLY D 23 5 ? 3 HELX_P HELX_P9 AA9 ILE E 2 ? CYS E 7 ? ILE E 2 CYS E 7 1 ? 6 HELX_P HELX_P10 AB1 SER E 12 ? ASN E 18 ? SER E 12 ASN E 18 1 ? 7 HELX_P HELX_P11 AB2 ASN F 3 ? GLY F 20 ? ASN F 3 GLY F 20 1 ? 18 HELX_P HELX_P12 AB3 GLU F 21 ? GLY F 23 ? GLU F 21 GLY F 23 5 ? 3 HELX_P HELX_P13 AB4 ILE G 2 ? CYS G 7 ? ILE G 2 CYS G 7 1 ? 6 HELX_P HELX_P14 AB5 SER G 12 ? ASN G 18 ? SER G 12 ASN G 18 1 ? 7 HELX_P HELX_P15 AB6 VAL H 2 ? GLY H 20 ? VAL H 2 GLY H 20 1 ? 19 HELX_P HELX_P16 AB7 GLU H 21 ? GLY H 23 ? GLU H 21 GLY H 23 5 ? 3 HELX_P HELX_P17 AB8 ILE I 2 ? CYS I 7 ? ILE I 2 CYS I 7 1 ? 6 HELX_P HELX_P18 AB9 SER I 12 ? ASN I 18 ? SER I 12 ASN I 18 1 ? 7 HELX_P HELX_P19 AC1 VAL J 2 ? GLY J 20 ? VAL J 2 GLY J 20 1 ? 19 HELX_P HELX_P20 AC2 GLU J 21 ? GLY J 23 ? GLU J 21 GLY J 23 5 ? 3 HELX_P HELX_P21 AC3 ILE K 2 ? CYS K 7 ? ILE K 2 CYS K 7 1 ? 6 HELX_P HELX_P22 AC4 SER K 12 ? ASN K 18 ? SER K 12 ASN K 18 1 ? 7 HELX_P HELX_P23 AC5 VAL L 2 ? CYS L 19 ? VAL L 2 CYS L 19 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 11 SG ? ? A CYS 6 A CYS 11 1_555 ? ? ? ? ? ? ? 2.046 ? disulf2 disulf ? ? A CYS 7 SG ? ? ? 1_555 B CYS 7 SG ? ? A CYS 7 B CYS 7 1_555 ? ? ? ? ? ? ? 2.131 ? disulf3 disulf ? ? A CYS 20 SG ? ? ? 1_555 B CYS 19 SG ? ? A CYS 20 B CYS 19 1_555 ? ? ? ? ? ? ? 2.037 ? disulf4 disulf ? ? C CYS 6 SG ? ? ? 1_555 C CYS 11 SG ? ? C CYS 6 C CYS 11 1_555 ? ? ? ? ? ? ? 2.030 ? disulf5 disulf ? ? C CYS 7 SG ? ? ? 1_555 D CYS 7 SG ? ? C CYS 7 D CYS 7 1_555 ? ? ? ? ? ? ? 2.116 ? disulf6 disulf ? ? C CYS 20 SG ? ? ? 1_555 D CYS 19 SG ? ? C CYS 20 D CYS 19 1_555 ? ? ? ? ? ? ? 2.031 ? disulf7 disulf ? ? E CYS 6 SG ? ? ? 1_555 E CYS 11 SG ? ? E CYS 6 E CYS 11 1_555 ? ? ? ? ? ? ? 2.029 ? disulf8 disulf ? ? E CYS 7 SG ? ? ? 1_555 F CYS 7 SG ? ? E CYS 7 F CYS 7 1_555 ? ? ? ? ? ? ? 2.112 ? disulf9 disulf ? ? E CYS 20 SG ? ? ? 1_555 F CYS 19 SG ? ? E CYS 20 F CYS 19 1_555 ? ? ? ? ? ? ? 2.034 ? disulf10 disulf ? ? G CYS 6 SG ? ? ? 1_555 G CYS 11 SG ? ? G CYS 6 G CYS 11 1_555 ? ? ? ? ? ? ? 2.064 ? disulf11 disulf ? ? G CYS 7 SG ? ? ? 1_555 H CYS 7 SG ? ? G CYS 7 H CYS 7 1_555 ? ? ? ? ? ? ? 2.113 ? disulf12 disulf ? ? G CYS 20 SG ? ? ? 1_555 H CYS 19 SG ? ? G CYS 20 H CYS 19 1_555 ? ? ? ? ? ? ? 2.017 ? disulf13 disulf ? ? I CYS 6 SG ? ? ? 1_555 I CYS 11 SG ? ? I CYS 6 I CYS 11 1_555 ? ? ? ? ? ? ? 2.041 ? disulf14 disulf ? ? I CYS 7 SG ? ? ? 1_555 J CYS 7 SG ? ? I CYS 7 J CYS 7 1_555 ? ? ? ? ? ? ? 2.078 ? disulf15 disulf ? ? I CYS 20 SG ? ? ? 1_555 J CYS 19 SG ? ? I CYS 20 J CYS 19 1_555 ? ? ? ? ? ? ? 2.021 ? disulf16 disulf ? ? K CYS 6 SG ? ? ? 1_555 K CYS 11 SG ? ? K CYS 6 K CYS 11 1_555 ? ? ? ? ? ? ? 2.079 ? disulf17 disulf ? ? K CYS 7 SG ? ? ? 1_555 L CYS 7 SG ? ? K CYS 7 L CYS 7 1_555 ? ? ? ? ? ? ? 2.065 ? disulf18 disulf ? ? K CYS 20 SG ? ? ? 1_555 L CYS 19 SG ? ? K CYS 20 L CYS 19 1_555 ? ? ? ? ? ? ? 2.001 ? metalc1 metalc ? ? B HIS 10 NE2 ? ? ? 1_555 N ZN . ZN ? ? B HIS 10 B ZN 301 1_555 ? ? ? ? ? ? ? 2.029 ? covale1 covale both ? B THR 27 C ? ? ? 1_555 B HZP 28 N ? ? B THR 27 B HZP 28 1_555 ? ? ? ? ? ? ? 1.331 ? covale2 covale both ? B HZP 28 C ? ? ? 1_555 B LYS 29 N ? ? B HZP 28 B LYS 29 1_555 ? ? ? ? ? ? ? 1.346 ? metalc2 metalc ? ? D HIS 10 NE2 ? ? ? 1_555 P ZN . ZN ? ? D HIS 10 D ZN 101 1_555 ? ? ? ? ? ? ? 2.060 ? covale3 covale both ? D THR 27 C ? ? ? 1_555 D HZP 28 N ? ? D THR 27 D HZP 28 1_555 ? ? ? ? ? ? ? 1.335 ? covale4 covale both ? D HZP 28 C ? ? ? 1_555 D LYS 29 N ? ? D HZP 28 D LYS 29 1_555 ? ? ? ? ? ? ? 1.327 ? metalc3 metalc ? ? F HIS 10 NE2 ? ? ? 1_555 N ZN . ZN ? ? F HIS 10 B ZN 301 1_555 ? ? ? ? ? ? ? 2.066 ? covale5 covale both ? F THR 27 C ? ? ? 1_555 F HZP 28 N ? ? F THR 27 F HZP 28 1_555 ? ? ? ? ? ? ? 1.317 ? covale6 covale both ? F HZP 28 C ? ? ? 1_555 F LYS 29 N ? ? F HZP 28 F LYS 29 1_555 ? ? ? ? ? ? ? 1.322 ? metalc4 metalc ? ? H HIS 10 NE2 ? ? ? 1_555 P ZN . ZN ? ? H HIS 10 D ZN 101 1_555 ? ? ? ? ? ? ? 2.023 ? covale7 covale both ? H THR 27 C ? ? ? 1_555 H HZP 28 N ? ? H THR 27 H HZP 28 1_555 ? ? ? ? ? ? ? 1.343 ? covale8 covale both ? H HZP 28 C ? ? ? 1_555 H LYS 29 N ? ? H HZP 28 H LYS 29 1_555 ? ? ? ? ? ? ? 1.308 ? metalc5 metalc ? ? J HIS 10 NE2 ? ? ? 1_555 N ZN . ZN ? ? J HIS 10 B ZN 301 1_555 ? ? ? ? ? ? ? 2.038 ? covale9 covale both ? J THR 27 C ? ? ? 1_555 J HZP 28 N ? ? J THR 27 J HZP 28 1_555 ? ? ? ? ? ? ? 1.347 ? covale10 covale both ? J HZP 28 C ? ? ? 1_555 J LYS 29 N ? ? J HZP 28 J LYS 29 1_555 ? ? ? ? ? ? ? 1.339 ? metalc6 metalc ? ? L HIS 10 NE2 ? ? ? 1_555 P ZN . ZN ? ? L HIS 10 D ZN 101 1_555 ? ? ? ? ? ? ? 2.064 ? covale11 covale both ? L THR 27 C ? ? ? 1_555 L HZP 28 N ? ? L THR 27 L HZP 28 1_555 ? ? ? ? ? ? ? 1.311 ? covale12 covale both ? L HZP 28 C ? ? ? 1_555 L LYS 29 N ? ? L HZP 28 L LYS 29 1_555 ? ? ? ? ? ? ? 1.358 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? covale ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 2 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE B 24 ? TYR B 26 ? PHE B 24 TYR B 26 AA1 2 PHE D 24 ? TYR D 26 ? PHE D 24 TYR D 26 AA2 1 PHE F 24 ? TYR F 26 ? PHE F 24 TYR F 26 AA2 2 PHE H 24 ? TYR H 26 ? PHE H 24 TYR H 26 AA3 1 PHE J 24 ? TYR J 26 ? PHE J 24 TYR J 26 AA3 2 PHE L 24 ? TYR L 26 ? PHE L 24 TYR L 26 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N PHE B 24 ? N PHE B 24 O TYR D 26 ? O TYR D 26 AA2 1 2 N PHE F 24 ? N PHE F 24 O TYR H 26 ? O TYR H 26 AA3 1 2 N TYR J 26 ? N TYR J 26 O PHE L 24 ? O PHE L 24 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A IPH 101 ? 6 'binding site for residue IPH A 101' AC2 Software B ZN 301 ? 4 'binding site for residue ZN B 301' AC3 Software C IPH 101 ? 4 'binding site for residue IPH C 101' AC4 Software D ZN 101 ? 4 'binding site for residue ZN D 101' AC5 Software E IPH 101 ? 4 'binding site for residue IPH E 101' AC6 Software F CL 101 ? 4 'binding site for residue CL F 101' AC7 Software G IPH 101 ? 6 'binding site for residue IPH G 101' AC8 Software H CL 101 ? 4 'binding site for residue CL H 101' AC9 Software I IPH 101 ? 5 'binding site for residue IPH I 101' AD1 Software K IPH 101 ? 5 'binding site for residue IPH K 101' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 CYS A 6 ? CYS A 6 . ? 1_555 ? 2 AC1 6 SER A 9 ? SER A 9 . ? 1_555 ? 3 AC1 6 ILE A 10 ? ILE A 10 . ? 1_555 ? 4 AC1 6 CYS A 11 ? CYS A 11 . ? 1_555 ? 5 AC1 6 LEU B 11 ? LEU B 11 . ? 1_555 ? 6 AC1 6 HIS F 5 ? HIS F 5 . ? 1_555 ? 7 AC2 4 HIS B 10 ? HIS B 10 . ? 1_555 ? 8 AC2 4 HIS F 10 ? HIS F 10 . ? 1_555 ? 9 AC2 4 CL R . ? CL F 101 . ? 1_555 ? 10 AC2 4 HIS J 10 ? HIS J 10 . ? 1_555 ? 11 AC3 4 CYS C 6 ? CYS C 6 . ? 1_555 ? 12 AC3 4 ILE C 10 ? ILE C 10 . ? 1_555 ? 13 AC3 4 CYS C 11 ? CYS C 11 . ? 1_555 ? 14 AC3 4 LEU D 11 ? LEU D 11 . ? 1_555 ? 15 AC4 4 HIS D 10 ? HIS D 10 . ? 1_555 ? 16 AC4 4 HIS H 10 ? HIS H 10 . ? 1_555 ? 17 AC4 4 CL T . ? CL H 101 . ? 1_555 ? 18 AC4 4 HIS L 10 ? HIS L 10 . ? 1_555 ? 19 AC5 4 CYS E 6 ? CYS E 6 . ? 1_555 ? 20 AC5 4 ILE E 10 ? ILE E 10 . ? 1_555 ? 21 AC5 4 CYS E 11 ? CYS E 11 . ? 1_555 ? 22 AC5 4 LEU F 11 ? LEU F 11 . ? 1_555 ? 23 AC6 4 HIS B 10 ? HIS B 10 . ? 1_555 ? 24 AC6 4 ZN N . ? ZN B 301 . ? 1_555 ? 25 AC6 4 HIS F 10 ? HIS F 10 . ? 1_555 ? 26 AC6 4 HIS J 10 ? HIS J 10 . ? 1_555 ? 27 AC7 6 HIS D 5 ? HIS D 5 . ? 1_555 ? 28 AC7 6 CYS G 6 ? CYS G 6 . ? 1_555 ? 29 AC7 6 SER G 9 ? SER G 9 . ? 1_555 ? 30 AC7 6 ILE G 10 ? ILE G 10 . ? 1_555 ? 31 AC7 6 CYS G 11 ? CYS G 11 . ? 1_555 ? 32 AC7 6 LEU H 11 ? LEU H 11 . ? 1_555 ? 33 AC8 4 HIS D 10 ? HIS D 10 . ? 1_555 ? 34 AC8 4 ZN P . ? ZN D 101 . ? 1_555 ? 35 AC8 4 HIS H 10 ? HIS H 10 . ? 1_555 ? 36 AC8 4 HIS L 10 ? HIS L 10 . ? 1_555 ? 37 AC9 5 HIS B 5 ? HIS B 5 . ? 1_555 ? 38 AC9 5 CYS I 6 ? CYS I 6 . ? 1_555 ? 39 AC9 5 ILE I 10 ? ILE I 10 . ? 1_555 ? 40 AC9 5 CYS I 11 ? CYS I 11 . ? 1_555 ? 41 AC9 5 LEU J 11 ? LEU J 11 . ? 1_555 ? 42 AD1 5 HIS H 5 ? HIS H 5 . ? 1_555 ? 43 AD1 5 CYS K 6 ? CYS K 6 . ? 1_555 ? 44 AD1 5 ILE K 10 ? ILE K 10 . ? 1_555 ? 45 AD1 5 CYS K 11 ? CYS K 11 . ? 1_555 ? 46 AD1 5 LEU L 11 ? LEU L 11 . ? 1_555 ? # _atom_sites.entry_id 5HRQ _atom_sites.fract_transf_matrix[1][1] 0.021206 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.008063 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016480 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017635 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 CYS 7 7 7 CYS CYS A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 ASN 21 21 21 ASN ASN A . n B 2 1 PHE 1 1 1 PHE PHE B . n B 2 2 VAL 2 2 2 VAL VAL B . n B 2 3 ASN 3 3 3 ASN ASN B . n B 2 4 GLN 4 4 4 GLN GLN B . n B 2 5 HIS 5 5 5 HIS HIS B . n B 2 6 LEU 6 6 6 LEU LEU B . n B 2 7 CYS 7 7 7 CYS CYS B . n B 2 8 GLY 8 8 8 GLY GLY B . n B 2 9 SER 9 9 9 SER SER B . n B 2 10 HIS 10 10 10 HIS HIS B . n B 2 11 LEU 11 11 11 LEU LEU B . n B 2 12 VAL 12 12 12 VAL VAL B . n B 2 13 GLU 13 13 13 GLU GLU B . n B 2 14 ALA 14 14 14 ALA ALA B . n B 2 15 LEU 15 15 15 LEU LEU B . n B 2 16 TYR 16 16 16 TYR TYR B . n B 2 17 LEU 17 17 17 LEU LEU B . n B 2 18 VAL 18 18 18 VAL VAL B . n B 2 19 CYS 19 19 19 CYS CYS B . n B 2 20 GLY 20 20 20 GLY GLY B . n B 2 21 GLU 21 21 21 GLU GLU B . n B 2 22 ARG 22 22 22 ARG ARG B . n B 2 23 GLY 23 23 23 GLY GLY B . n B 2 24 PHE 24 24 24 PHE PHE B . n B 2 25 PHE 25 25 25 PHE PHE B . n B 2 26 TYR 26 26 26 TYR TYR B . n B 2 27 THR 27 27 27 THR THR B . n B 2 28 HZP 28 28 28 HZP HZP B . n B 2 29 LYS 29 29 29 LYS LYS B . n B 2 30 THR 30 30 30 THR THR B . n C 1 1 GLY 1 1 1 GLY GLY C . n C 1 2 ILE 2 2 2 ILE ILE C . n C 1 3 VAL 3 3 3 VAL VAL C . n C 1 4 GLU 4 4 4 GLU GLU C . n C 1 5 GLN 5 5 5 GLN GLN C . n C 1 6 CYS 6 6 6 CYS CYS C . n C 1 7 CYS 7 7 7 CYS CYS C . n C 1 8 THR 8 8 8 THR THR C . n C 1 9 SER 9 9 9 SER SER C . n C 1 10 ILE 10 10 10 ILE ILE C . n C 1 11 CYS 11 11 11 CYS CYS C . n C 1 12 SER 12 12 12 SER SER C . n C 1 13 LEU 13 13 13 LEU LEU C . n C 1 14 TYR 14 14 14 TYR TYR C . n C 1 15 GLN 15 15 15 GLN GLN C . n C 1 16 LEU 16 16 16 LEU LEU C . n C 1 17 GLU 17 17 17 GLU GLU C . n C 1 18 ASN 18 18 18 ASN ASN C . n C 1 19 TYR 19 19 19 TYR TYR C . n C 1 20 CYS 20 20 20 CYS CYS C . n C 1 21 ASN 21 21 21 ASN ASN C . n D 2 1 PHE 1 1 1 PHE PHE D . n D 2 2 VAL 2 2 2 VAL VAL D . n D 2 3 ASN 3 3 3 ASN ASN D . n D 2 4 GLN 4 4 4 GLN GLN D . n D 2 5 HIS 5 5 5 HIS HIS D . n D 2 6 LEU 6 6 6 LEU LEU D . n D 2 7 CYS 7 7 7 CYS CYS D . n D 2 8 GLY 8 8 8 GLY GLY D . n D 2 9 SER 9 9 9 SER SER D . n D 2 10 HIS 10 10 10 HIS HIS D . n D 2 11 LEU 11 11 11 LEU LEU D . n D 2 12 VAL 12 12 12 VAL VAL D . n D 2 13 GLU 13 13 13 GLU GLU D . n D 2 14 ALA 14 14 14 ALA ALA D . n D 2 15 LEU 15 15 15 LEU LEU D . n D 2 16 TYR 16 16 16 TYR TYR D . n D 2 17 LEU 17 17 17 LEU LEU D . n D 2 18 VAL 18 18 18 VAL VAL D . n D 2 19 CYS 19 19 19 CYS CYS D . n D 2 20 GLY 20 20 20 GLY GLY D . n D 2 21 GLU 21 21 21 GLU GLU D . n D 2 22 ARG 22 22 22 ARG ARG D . n D 2 23 GLY 23 23 23 GLY GLY D . n D 2 24 PHE 24 24 24 PHE PHE D . n D 2 25 PHE 25 25 25 PHE PHE D . n D 2 26 TYR 26 26 26 TYR TYR D . n D 2 27 THR 27 27 27 THR THR D . n D 2 28 HZP 28 28 28 HZP HZP D . n D 2 29 LYS 29 29 29 LYS LYS D . n D 2 30 THR 30 30 30 THR THR D . n E 1 1 GLY 1 1 1 GLY GLY E . n E 1 2 ILE 2 2 2 ILE ILE E . n E 1 3 VAL 3 3 3 VAL VAL E . n E 1 4 GLU 4 4 4 GLU GLU E . n E 1 5 GLN 5 5 5 GLN GLN E . n E 1 6 CYS 6 6 6 CYS CYS E . n E 1 7 CYS 7 7 7 CYS CYS E . n E 1 8 THR 8 8 8 THR THR E . n E 1 9 SER 9 9 9 SER SER E . n E 1 10 ILE 10 10 10 ILE ILE E . n E 1 11 CYS 11 11 11 CYS CYS E . n E 1 12 SER 12 12 12 SER SER E . n E 1 13 LEU 13 13 13 LEU LEU E . n E 1 14 TYR 14 14 14 TYR TYR E . n E 1 15 GLN 15 15 15 GLN GLN E . n E 1 16 LEU 16 16 16 LEU LEU E . n E 1 17 GLU 17 17 17 GLU GLU E . n E 1 18 ASN 18 18 18 ASN ASN E . n E 1 19 TYR 19 19 19 TYR TYR E . n E 1 20 CYS 20 20 20 CYS CYS E . n E 1 21 ASN 21 21 21 ASN ASN E . n F 2 1 PHE 1 1 ? ? ? F . n F 2 2 VAL 2 2 2 VAL VAL F . n F 2 3 ASN 3 3 3 ASN ASN F . n F 2 4 GLN 4 4 4 GLN GLN F . n F 2 5 HIS 5 5 5 HIS HIS F . n F 2 6 LEU 6 6 6 LEU LEU F . n F 2 7 CYS 7 7 7 CYS CYS F . n F 2 8 GLY 8 8 8 GLY GLY F . n F 2 9 SER 9 9 9 SER SER F . n F 2 10 HIS 10 10 10 HIS HIS F . n F 2 11 LEU 11 11 11 LEU LEU F . n F 2 12 VAL 12 12 12 VAL VAL F . n F 2 13 GLU 13 13 13 GLU GLU F . n F 2 14 ALA 14 14 14 ALA ALA F . n F 2 15 LEU 15 15 15 LEU LEU F . n F 2 16 TYR 16 16 16 TYR TYR F . n F 2 17 LEU 17 17 17 LEU LEU F . n F 2 18 VAL 18 18 18 VAL VAL F . n F 2 19 CYS 19 19 19 CYS CYS F . n F 2 20 GLY 20 20 20 GLY GLY F . n F 2 21 GLU 21 21 21 GLU GLU F . n F 2 22 ARG 22 22 22 ARG ARG F . n F 2 23 GLY 23 23 23 GLY GLY F . n F 2 24 PHE 24 24 24 PHE PHE F . n F 2 25 PHE 25 25 25 PHE PHE F . n F 2 26 TYR 26 26 26 TYR TYR F . n F 2 27 THR 27 27 27 THR THR F . n F 2 28 HZP 28 28 28 HZP HZP F . n F 2 29 LYS 29 29 29 LYS LYS F . n F 2 30 THR 30 30 30 THR THR F . n G 1 1 GLY 1 1 1 GLY GLY G . n G 1 2 ILE 2 2 2 ILE ILE G . n G 1 3 VAL 3 3 3 VAL VAL G . n G 1 4 GLU 4 4 4 GLU GLU G . n G 1 5 GLN 5 5 5 GLN GLN G . n G 1 6 CYS 6 6 6 CYS CYS G . n G 1 7 CYS 7 7 7 CYS CYS G . n G 1 8 THR 8 8 8 THR THR G . n G 1 9 SER 9 9 9 SER SER G . n G 1 10 ILE 10 10 10 ILE ILE G . n G 1 11 CYS 11 11 11 CYS CYS G . n G 1 12 SER 12 12 12 SER SER G . n G 1 13 LEU 13 13 13 LEU LEU G . n G 1 14 TYR 14 14 14 TYR TYR G . n G 1 15 GLN 15 15 15 GLN GLN G . n G 1 16 LEU 16 16 16 LEU LEU G . n G 1 17 GLU 17 17 17 GLU GLU G . n G 1 18 ASN 18 18 18 ASN ASN G . n G 1 19 TYR 19 19 19 TYR TYR G . n G 1 20 CYS 20 20 20 CYS CYS G . n G 1 21 ASN 21 21 21 ASN ASN G . n H 2 1 PHE 1 1 1 PHE PHE H . n H 2 2 VAL 2 2 2 VAL VAL H . n H 2 3 ASN 3 3 3 ASN ASN H . n H 2 4 GLN 4 4 4 GLN GLN H . n H 2 5 HIS 5 5 5 HIS HIS H . n H 2 6 LEU 6 6 6 LEU LEU H . n H 2 7 CYS 7 7 7 CYS CYS H . n H 2 8 GLY 8 8 8 GLY GLY H . n H 2 9 SER 9 9 9 SER SER H . n H 2 10 HIS 10 10 10 HIS HIS H . n H 2 11 LEU 11 11 11 LEU LEU H . n H 2 12 VAL 12 12 12 VAL VAL H . n H 2 13 GLU 13 13 13 GLU GLU H . n H 2 14 ALA 14 14 14 ALA ALA H . n H 2 15 LEU 15 15 15 LEU LEU H . n H 2 16 TYR 16 16 16 TYR TYR H . n H 2 17 LEU 17 17 17 LEU LEU H . n H 2 18 VAL 18 18 18 VAL VAL H . n H 2 19 CYS 19 19 19 CYS CYS H . n H 2 20 GLY 20 20 20 GLY GLY H . n H 2 21 GLU 21 21 21 GLU GLU H . n H 2 22 ARG 22 22 22 ARG ARG H . n H 2 23 GLY 23 23 23 GLY GLY H . n H 2 24 PHE 24 24 24 PHE PHE H . n H 2 25 PHE 25 25 25 PHE PHE H . n H 2 26 TYR 26 26 26 TYR TYR H . n H 2 27 THR 27 27 27 THR THR H . n H 2 28 HZP 28 28 28 HZP HZP H . n H 2 29 LYS 29 29 29 LYS LYS H . n H 2 30 THR 30 30 30 THR THR H . n I 1 1 GLY 1 1 1 GLY GLY I . n I 1 2 ILE 2 2 2 ILE ILE I . n I 1 3 VAL 3 3 3 VAL VAL I . n I 1 4 GLU 4 4 4 GLU GLU I . n I 1 5 GLN 5 5 5 GLN GLN I . n I 1 6 CYS 6 6 6 CYS CYS I . n I 1 7 CYS 7 7 7 CYS CYS I . n I 1 8 THR 8 8 8 THR THR I . n I 1 9 SER 9 9 9 SER SER I . n I 1 10 ILE 10 10 10 ILE ILE I . n I 1 11 CYS 11 11 11 CYS CYS I . n I 1 12 SER 12 12 12 SER SER I . n I 1 13 LEU 13 13 13 LEU LEU I . n I 1 14 TYR 14 14 14 TYR TYR I . n I 1 15 GLN 15 15 15 GLN GLN I . n I 1 16 LEU 16 16 16 LEU LEU I . n I 1 17 GLU 17 17 17 GLU GLU I . n I 1 18 ASN 18 18 18 ASN ASN I . n I 1 19 TYR 19 19 19 TYR TYR I . n I 1 20 CYS 20 20 20 CYS CYS I . n I 1 21 ASN 21 21 21 ASN ASN I . n J 2 1 PHE 1 1 1 PHE PHE J . n J 2 2 VAL 2 2 2 VAL VAL J . n J 2 3 ASN 3 3 3 ASN ASN J . n J 2 4 GLN 4 4 4 GLN GLN J . n J 2 5 HIS 5 5 5 HIS HIS J . n J 2 6 LEU 6 6 6 LEU LEU J . n J 2 7 CYS 7 7 7 CYS CYS J . n J 2 8 GLY 8 8 8 GLY GLY J . n J 2 9 SER 9 9 9 SER SER J . n J 2 10 HIS 10 10 10 HIS HIS J . n J 2 11 LEU 11 11 11 LEU LEU J . n J 2 12 VAL 12 12 12 VAL VAL J . n J 2 13 GLU 13 13 13 GLU GLU J . n J 2 14 ALA 14 14 14 ALA ALA J . n J 2 15 LEU 15 15 15 LEU LEU J . n J 2 16 TYR 16 16 16 TYR TYR J . n J 2 17 LEU 17 17 17 LEU LEU J . n J 2 18 VAL 18 18 18 VAL VAL J . n J 2 19 CYS 19 19 19 CYS CYS J . n J 2 20 GLY 20 20 20 GLY GLY J . n J 2 21 GLU 21 21 21 GLU GLU J . n J 2 22 ARG 22 22 22 ARG ARG J . n J 2 23 GLY 23 23 23 GLY GLY J . n J 2 24 PHE 24 24 24 PHE PHE J . n J 2 25 PHE 25 25 25 PHE PHE J . n J 2 26 TYR 26 26 26 TYR TYR J . n J 2 27 THR 27 27 27 THR THR J . n J 2 28 HZP 28 28 28 HZP HZP J . n J 2 29 LYS 29 29 29 LYS LYS J . n J 2 30 THR 30 30 ? ? ? J . n K 1 1 GLY 1 1 1 GLY GLY K . n K 1 2 ILE 2 2 2 ILE ILE K . n K 1 3 VAL 3 3 3 VAL VAL K . n K 1 4 GLU 4 4 4 GLU GLU K . n K 1 5 GLN 5 5 5 GLN GLN K . n K 1 6 CYS 6 6 6 CYS CYS K . n K 1 7 CYS 7 7 7 CYS CYS K . n K 1 8 THR 8 8 8 THR THR K . n K 1 9 SER 9 9 9 SER SER K . n K 1 10 ILE 10 10 10 ILE ILE K . n K 1 11 CYS 11 11 11 CYS CYS K . n K 1 12 SER 12 12 12 SER SER K . n K 1 13 LEU 13 13 13 LEU LEU K . n K 1 14 TYR 14 14 14 TYR TYR K . n K 1 15 GLN 15 15 15 GLN GLN K . n K 1 16 LEU 16 16 16 LEU LEU K . n K 1 17 GLU 17 17 17 GLU GLU K . n K 1 18 ASN 18 18 18 ASN ASN K . n K 1 19 TYR 19 19 19 TYR TYR K . n K 1 20 CYS 20 20 20 CYS CYS K . n K 1 21 ASN 21 21 21 ASN ASN K . n L 2 1 PHE 1 1 1 PHE PHE L . n L 2 2 VAL 2 2 2 VAL VAL L . n L 2 3 ASN 3 3 3 ASN ASN L . n L 2 4 GLN 4 4 4 GLN GLN L . n L 2 5 HIS 5 5 5 HIS HIS L . n L 2 6 LEU 6 6 6 LEU LEU L . n L 2 7 CYS 7 7 7 CYS CYS L . n L 2 8 GLY 8 8 8 GLY GLY L . n L 2 9 SER 9 9 9 SER SER L . n L 2 10 HIS 10 10 10 HIS HIS L . n L 2 11 LEU 11 11 11 LEU LEU L . n L 2 12 VAL 12 12 12 VAL VAL L . n L 2 13 GLU 13 13 13 GLU GLU L . n L 2 14 ALA 14 14 14 ALA ALA L . n L 2 15 LEU 15 15 15 LEU LEU L . n L 2 16 TYR 16 16 16 TYR TYR L . n L 2 17 LEU 17 17 17 LEU LEU L . n L 2 18 VAL 18 18 18 VAL VAL L . n L 2 19 CYS 19 19 19 CYS CYS L . n L 2 20 GLY 20 20 20 GLY GLY L . n L 2 21 GLU 21 21 21 GLU GLU L . n L 2 22 ARG 22 22 22 ARG ARG L . n L 2 23 GLY 23 23 23 GLY GLY L . n L 2 24 PHE 24 24 24 PHE PHE L . n L 2 25 PHE 25 25 25 PHE PHE L . n L 2 26 TYR 26 26 26 TYR TYR L . n L 2 27 THR 27 27 27 THR THR L . n L 2 28 HZP 28 28 28 HZP HZP L . n L 2 29 LYS 29 29 29 LYS LYS L . n L 2 30 THR 30 30 ? ? ? L . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code M 3 IPH 1 101 1 IPH IPH A . N 4 ZN 1 301 301 ZN ZN B . O 3 IPH 1 101 2 IPH IPH C . P 4 ZN 1 101 302 ZN ZN D . Q 3 IPH 1 101 3 IPH IPH E . R 5 CL 1 101 303 CL CL F . S 3 IPH 1 101 4 IPH IPH G . T 5 CL 1 101 304 CL CL H . U 3 IPH 1 101 5 IPH IPH I . V 3 IPH 1 101 6 IPH IPH K . W 6 HOH 1 201 11 HOH HOH A . W 6 HOH 2 202 119 HOH HOH A . W 6 HOH 3 203 2 HOH HOH A . W 6 HOH 4 204 1 HOH HOH A . W 6 HOH 5 205 5 HOH HOH A . W 6 HOH 6 206 6 HOH HOH A . W 6 HOH 7 207 7 HOH HOH A . X 6 HOH 1 401 140 HOH HOH B . X 6 HOH 2 402 132 HOH HOH B . X 6 HOH 3 403 109 HOH HOH B . X 6 HOH 4 404 99 HOH HOH B . X 6 HOH 5 405 112 HOH HOH B . X 6 HOH 6 406 10 HOH HOH B . X 6 HOH 7 407 9 HOH HOH B . X 6 HOH 8 408 28 HOH HOH B . X 6 HOH 9 409 4 HOH HOH B . X 6 HOH 10 410 102 HOH HOH B . X 6 HOH 11 411 13 HOH HOH B . X 6 HOH 12 412 165 HOH HOH B . Y 6 HOH 1 201 47 HOH HOH C . Y 6 HOH 2 202 48 HOH HOH C . Y 6 HOH 3 203 84 HOH HOH C . Y 6 HOH 4 204 49 HOH HOH C . Y 6 HOH 5 205 94 HOH HOH C . Y 6 HOH 6 206 144 HOH HOH C . Y 6 HOH 7 207 14 HOH HOH C . Y 6 HOH 8 208 92 HOH HOH C . Y 6 HOH 9 209 98 HOH HOH C . Z 6 HOH 1 201 162 HOH HOH D . Z 6 HOH 2 202 108 HOH HOH D . Z 6 HOH 3 203 161 HOH HOH D . Z 6 HOH 4 204 138 HOH HOH D . Z 6 HOH 5 205 114 HOH HOH D . Z 6 HOH 6 206 123 HOH HOH D . Z 6 HOH 7 207 51 HOH HOH D . Z 6 HOH 8 208 136 HOH HOH D . Z 6 HOH 9 209 89 HOH HOH D . Z 6 HOH 10 210 110 HOH HOH D . Z 6 HOH 11 211 157 HOH HOH D . Z 6 HOH 12 212 149 HOH HOH D . Z 6 HOH 13 213 96 HOH HOH D . Z 6 HOH 14 214 142 HOH HOH D . Z 6 HOH 15 215 50 HOH HOH D . Z 6 HOH 16 216 95 HOH HOH D . Z 6 HOH 17 217 97 HOH HOH D . AA 6 HOH 1 201 126 HOH HOH E . AA 6 HOH 2 202 116 HOH HOH E . AA 6 HOH 3 203 15 HOH HOH E . AA 6 HOH 4 204 127 HOH HOH E . AA 6 HOH 5 205 70 HOH HOH E . AA 6 HOH 6 206 53 HOH HOH E . AA 6 HOH 7 207 16 HOH HOH E . AA 6 HOH 8 208 75 HOH HOH E . AA 6 HOH 9 209 85 HOH HOH E . AA 6 HOH 10 210 128 HOH HOH E . AA 6 HOH 11 211 54 HOH HOH E . AA 6 HOH 12 212 55 HOH HOH E . AA 6 HOH 13 213 120 HOH HOH E . AA 6 HOH 14 214 52 HOH HOH E . AA 6 HOH 15 215 101 HOH HOH E . BA 6 HOH 1 201 57 HOH HOH F . BA 6 HOH 2 202 164 HOH HOH F . BA 6 HOH 3 203 59 HOH HOH F . BA 6 HOH 4 204 103 HOH HOH F . BA 6 HOH 5 205 34 HOH HOH F . BA 6 HOH 6 206 72 HOH HOH F . BA 6 HOH 7 207 107 HOH HOH F . BA 6 HOH 8 208 32 HOH HOH F . BA 6 HOH 9 209 73 HOH HOH F . BA 6 HOH 10 210 160 HOH HOH F . BA 6 HOH 11 211 60 HOH HOH F . BA 6 HOH 12 212 150 HOH HOH F . BA 6 HOH 13 213 93 HOH HOH F . CA 6 HOH 1 201 19 HOH HOH G . CA 6 HOH 2 202 36 HOH HOH G . CA 6 HOH 3 203 146 HOH HOH G . CA 6 HOH 4 204 76 HOH HOH G . CA 6 HOH 5 205 151 HOH HOH G . CA 6 HOH 6 206 27 HOH HOH G . CA 6 HOH 7 207 104 HOH HOH G . CA 6 HOH 8 208 82 HOH HOH G . CA 6 HOH 9 209 122 HOH HOH G . CA 6 HOH 10 210 124 HOH HOH G . CA 6 HOH 11 211 20 HOH HOH G . CA 6 HOH 12 212 117 HOH HOH G . CA 6 HOH 13 213 113 HOH HOH G . CA 6 HOH 14 214 148 HOH HOH G . CA 6 HOH 15 215 106 HOH HOH G . CA 6 HOH 16 216 80 HOH HOH G . CA 6 HOH 17 217 74 HOH HOH G . DA 6 HOH 1 201 21 HOH HOH H . DA 6 HOH 2 202 44 HOH HOH H . DA 6 HOH 3 203 23 HOH HOH H . DA 6 HOH 4 204 62 HOH HOH H . DA 6 HOH 5 205 90 HOH HOH H . DA 6 HOH 6 206 39 HOH HOH H . DA 6 HOH 7 207 18 HOH HOH H . DA 6 HOH 8 208 61 HOH HOH H . DA 6 HOH 9 209 152 HOH HOH H . DA 6 HOH 10 210 118 HOH HOH H . DA 6 HOH 11 211 22 HOH HOH H . DA 6 HOH 12 212 17 HOH HOH H . DA 6 HOH 13 213 42 HOH HOH H . DA 6 HOH 14 214 100 HOH HOH H . DA 6 HOH 15 215 141 HOH HOH H . DA 6 HOH 16 216 115 HOH HOH H . DA 6 HOH 17 217 156 HOH HOH H . EA 6 HOH 1 201 83 HOH HOH I . EA 6 HOH 2 202 131 HOH HOH I . EA 6 HOH 3 203 63 HOH HOH I . EA 6 HOH 4 204 65 HOH HOH I . EA 6 HOH 5 205 154 HOH HOH I . EA 6 HOH 6 206 12 HOH HOH I . EA 6 HOH 7 207 8 HOH HOH I . EA 6 HOH 8 208 88 HOH HOH I . EA 6 HOH 9 209 133 HOH HOH I . EA 6 HOH 10 210 137 HOH HOH I . EA 6 HOH 11 211 111 HOH HOH I . EA 6 HOH 12 212 64 HOH HOH I . EA 6 HOH 13 213 153 HOH HOH I . EA 6 HOH 14 214 37 HOH HOH I . FA 6 HOH 1 101 143 HOH HOH J . FA 6 HOH 2 102 158 HOH HOH J . FA 6 HOH 3 103 86 HOH HOH J . FA 6 HOH 4 104 25 HOH HOH J . FA 6 HOH 5 105 33 HOH HOH J . FA 6 HOH 6 106 24 HOH HOH J . FA 6 HOH 7 107 38 HOH HOH J . FA 6 HOH 8 108 79 HOH HOH J . FA 6 HOH 9 109 78 HOH HOH J . FA 6 HOH 10 110 163 HOH HOH J . FA 6 HOH 11 111 77 HOH HOH J . FA 6 HOH 12 112 66 HOH HOH J . FA 6 HOH 13 113 155 HOH HOH J . GA 6 HOH 1 201 130 HOH HOH K . GA 6 HOH 2 202 145 HOH HOH K . GA 6 HOH 3 203 40 HOH HOH K . GA 6 HOH 4 204 31 HOH HOH K . GA 6 HOH 5 205 91 HOH HOH K . GA 6 HOH 6 206 139 HOH HOH K . GA 6 HOH 7 207 147 HOH HOH K . GA 6 HOH 8 208 41 HOH HOH K . GA 6 HOH 9 209 26 HOH HOH K . GA 6 HOH 10 210 29 HOH HOH K . GA 6 HOH 11 211 105 HOH HOH K . HA 6 HOH 1 101 43 HOH HOH L . HA 6 HOH 2 102 135 HOH HOH L . HA 6 HOH 3 103 125 HOH HOH L . HA 6 HOH 4 104 87 HOH HOH L . HA 6 HOH 5 105 129 HOH HOH L . HA 6 HOH 6 106 159 HOH HOH L . HA 6 HOH 7 107 81 HOH HOH L . HA 6 HOH 8 108 68 HOH HOH L . HA 6 HOH 9 109 134 HOH HOH L . HA 6 HOH 10 110 71 HOH HOH L . HA 6 HOH 11 111 69 HOH HOH L . HA 6 HOH 12 112 35 HOH HOH L . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 B HZP 28 B HZP 28 ? PRO 'modified residue' 2 D HZP 28 D HZP 28 ? PRO 'modified residue' 3 F HZP 28 F HZP 28 ? PRO 'modified residue' 4 H HZP 28 H HZP 28 ? PRO 'modified residue' 5 J HZP 28 J HZP 28 ? PRO 'modified residue' 6 L HZP 28 L HZP 28 ? PRO 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dodecameric _pdbx_struct_assembly.oligomeric_count 12 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,AA,BA,CA,DA,EA,FA,GA,HA # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 19620 ? 1 MORE -236 ? 1 'SSA (A^2)' 12830 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? B HIS 10 ? B HIS 10 ? 1_555 ZN ? N ZN . ? B ZN 301 ? 1_555 NE2 ? F HIS 10 ? F HIS 10 ? 1_555 106.5 ? 2 NE2 ? B HIS 10 ? B HIS 10 ? 1_555 ZN ? N ZN . ? B ZN 301 ? 1_555 NE2 ? J HIS 10 ? J HIS 10 ? 1_555 108.0 ? 3 NE2 ? F HIS 10 ? F HIS 10 ? 1_555 ZN ? N ZN . ? B ZN 301 ? 1_555 NE2 ? J HIS 10 ? J HIS 10 ? 1_555 106.2 ? 4 NE2 ? D HIS 10 ? D HIS 10 ? 1_555 ZN ? P ZN . ? D ZN 101 ? 1_555 NE2 ? H HIS 10 ? H HIS 10 ? 1_555 106.6 ? 5 NE2 ? D HIS 10 ? D HIS 10 ? 1_555 ZN ? P ZN . ? D ZN 101 ? 1_555 NE2 ? L HIS 10 ? L HIS 10 ? 1_555 106.4 ? 6 NE2 ? H HIS 10 ? H HIS 10 ? 1_555 ZN ? P ZN . ? D ZN 101 ? 1_555 NE2 ? L HIS 10 ? L HIS 10 ? 1_555 107.6 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-01-25 2 'Structure model' 1 1 2017-07-12 3 'Structure model' 1 2 2020-01-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Author supporting evidence' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' pdbx_audit_support # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 3 'Structure model' '_pdbx_audit_support.funding_organization' # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0069 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.3.11 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.5.6 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 CD2 D LEU 17 ? B O B HOH 410 ? ? 1.71 2 1 CD1 D LEU 17 ? B O D HOH 214 ? ? 1.78 3 1 OE2 F GLU 13 ? A O F HOH 201 ? ? 1.88 4 1 OD1 D ASN 3 ? ? O D HOH 201 ? ? 1.95 5 1 OE1 F GLU 13 ? A O F HOH 201 ? ? 2.01 6 1 CD F GLU 13 ? A O F HOH 201 ? ? 2.13 7 1 OE2 D GLU 13 ? B O D HOH 202 ? ? 2.16 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OXT _pdbx_validate_symm_contact.auth_asym_id_1 C _pdbx_validate_symm_contact.auth_comp_id_1 ASN _pdbx_validate_symm_contact.auth_seq_id_1 21 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 ND2 _pdbx_validate_symm_contact.auth_asym_id_2 J _pdbx_validate_symm_contact.auth_comp_id_2 ASN _pdbx_validate_symm_contact.auth_seq_id_2 3 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 2_548 _pdbx_validate_symm_contact.dist 2.05 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CD A GLU 4 ? ? OE1 A GLU 4 ? ? 1.340 1.252 0.088 0.011 N 2 1 CD H GLU 13 ? ? OE2 H GLU 13 ? ? 1.322 1.252 0.070 0.011 N 3 1 CB K SER 12 ? ? OG K SER 12 ? ? 1.709 1.418 0.291 0.013 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA B HZP 28 ? ? C B HZP 28 ? ? N B LYS 29 ? ? 100.36 117.20 -16.84 2.20 Y 2 1 O B HZP 28 ? ? C B HZP 28 ? ? N B LYS 29 ? ? 108.18 122.70 -14.52 1.60 Y 3 1 O L THR 27 ? ? C L THR 27 ? ? N L HZP 28 ? ? 112.54 122.70 -10.16 1.60 Y 4 1 C L HZP 28 ? ? N L LYS 29 ? ? CA L LYS 29 ? ? 140.44 121.70 18.74 2.50 Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HZP B 28 ? ? -17.62 -53.24 2 1 THR I 8 ? ? -120.87 -52.31 3 1 THR I 8 ? ? -120.87 -54.02 4 1 THR I 8 ? ? -120.87 -53.94 5 1 VAL J 2 ? ? -81.94 37.20 6 1 VAL L 2 ? ? -84.24 34.95 # loop_ _pdbx_validate_main_chain_plane.id _pdbx_validate_main_chain_plane.PDB_model_num _pdbx_validate_main_chain_plane.auth_comp_id _pdbx_validate_main_chain_plane.auth_asym_id _pdbx_validate_main_chain_plane.auth_seq_id _pdbx_validate_main_chain_plane.PDB_ins_code _pdbx_validate_main_chain_plane.label_alt_id _pdbx_validate_main_chain_plane.improper_torsion_angle 1 1 THR B 27 ? ? 11.55 2 1 HZP B 28 ? ? 31.48 3 1 THR D 27 ? ? -11.31 4 1 HZP D 28 ? ? 15.14 5 1 THR L 27 ? ? 14.03 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 206 ? 8.27 . 2 1 O ? A HOH 207 ? 12.03 . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A TYR 14 ? CG ? A TYR 14 CG 2 1 Y 1 A TYR 14 ? CD1 ? A TYR 14 CD1 3 1 Y 1 A TYR 14 ? CD2 ? A TYR 14 CD2 4 1 Y 1 A TYR 14 ? CE1 ? A TYR 14 CE1 5 1 Y 1 A TYR 14 ? CE2 ? A TYR 14 CE2 6 1 Y 1 A TYR 14 ? CZ ? A TYR 14 CZ 7 1 Y 1 A TYR 14 ? OH ? A TYR 14 OH 8 1 Y 1 B LYS 29 ? CG ? B LYS 29 CG 9 1 Y 1 B LYS 29 ? CD ? B LYS 29 CD 10 1 Y 1 B LYS 29 ? CE ? B LYS 29 CE 11 1 Y 1 B LYS 29 ? NZ ? B LYS 29 NZ 12 1 Y 1 B THR 30 ? OG1 ? B THR 30 OG1 13 1 Y 1 B THR 30 ? CG2 ? B THR 30 CG2 14 1 Y 1 C GLU 4 ? CD ? C GLU 4 CD 15 1 Y 1 C GLU 4 ? OE1 ? C GLU 4 OE1 16 1 Y 1 C GLU 4 ? OE2 ? C GLU 4 OE2 17 1 Y 1 D PHE 1 ? CG ? D PHE 1 CG 18 1 Y 1 D PHE 1 ? CD1 ? D PHE 1 CD1 19 1 Y 1 D PHE 1 ? CD2 ? D PHE 1 CD2 20 1 Y 1 D PHE 1 ? CE1 ? D PHE 1 CE1 21 1 Y 1 D PHE 1 ? CE2 ? D PHE 1 CE2 22 1 Y 1 D PHE 1 ? CZ ? D PHE 1 CZ 23 1 Y 1 D LYS 29 ? CG ? D LYS 29 CG 24 1 Y 1 D LYS 29 ? CD ? D LYS 29 CD 25 1 Y 1 D LYS 29 ? CE ? D LYS 29 CE 26 1 Y 1 D LYS 29 ? NZ ? D LYS 29 NZ 27 1 Y 1 F LYS 29 ? CG ? F LYS 29 CG 28 1 Y 1 F LYS 29 ? CD ? F LYS 29 CD 29 1 Y 1 F LYS 29 ? CE ? F LYS 29 CE 30 1 Y 1 F LYS 29 ? NZ ? F LYS 29 NZ 31 1 Y 1 G GLU 4 ? CG ? G GLU 4 CG 32 1 Y 1 G GLU 4 ? CD ? G GLU 4 CD 33 1 Y 1 G GLU 4 ? OE1 ? G GLU 4 OE1 34 1 Y 1 G GLU 4 ? OE2 ? G GLU 4 OE2 35 1 Y 1 H LYS 29 ? NZ ? H LYS 29 NZ 36 1 Y 1 I TYR 14 ? CG ? I TYR 14 CG 37 1 Y 1 I TYR 14 ? CD1 ? I TYR 14 CD1 38 1 Y 1 I TYR 14 ? CD2 ? I TYR 14 CD2 39 1 Y 1 I TYR 14 ? CE1 ? I TYR 14 CE1 40 1 Y 1 I TYR 14 ? CE2 ? I TYR 14 CE2 41 1 Y 1 I TYR 14 ? CZ ? I TYR 14 CZ 42 1 Y 1 I TYR 14 ? OH ? I TYR 14 OH 43 1 Y 1 L GLU 21 ? CG ? L GLU 21 CG 44 1 Y 1 L GLU 21 ? CD ? L GLU 21 CD 45 1 Y 1 L GLU 21 ? OE1 ? L GLU 21 OE1 46 1 Y 1 L GLU 21 ? OE2 ? L GLU 21 OE2 47 1 Y 1 L ARG 22 ? CG ? L ARG 22 CG 48 1 Y 1 L ARG 22 ? CD ? L ARG 22 CD 49 1 Y 1 L ARG 22 ? NE ? L ARG 22 NE 50 1 Y 1 L ARG 22 ? CZ ? L ARG 22 CZ 51 1 Y 1 L ARG 22 ? NH1 ? L ARG 22 NH1 52 1 Y 1 L ARG 22 ? NH2 ? L ARG 22 NH2 53 1 Y 1 L LYS 29 ? CG ? L LYS 29 CG 54 1 Y 1 L LYS 29 ? CD ? L LYS 29 CD 55 1 Y 1 L LYS 29 ? CE ? L LYS 29 CE 56 1 Y 1 L LYS 29 ? NZ ? L LYS 29 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 F PHE 1 ? F PHE 1 2 1 Y 1 J THR 30 ? J THR 30 3 1 Y 1 L THR 30 ? L THR 30 # _pdbx_audit_support.funding_organization 'Novo Nordisk Foundation' _pdbx_audit_support.country Denmark _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 PHENOL IPH 4 'ZINC ION' ZN 5 'CHLORIDE ION' CL 6 water HOH #