data_5HW9 # _entry.id 5HW9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.381 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5HW9 pdb_00005hw9 10.2210/pdb5hw9/pdb WWPDB D_1000217849 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'the same protein but viewed in different space group' 5HGE unspecified PDB 'the same protein but viewed in different space group' 5HBD unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5HW9 _pdbx_database_status.recvd_initial_deposition_date 2016-01-29 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Sawaya, M.R.' 1 'Heller, D.M.' 2 'McPartland, L.' 3 'Hochschild, A.' 4 'Eisenberg, D.S.' 5 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'to be published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Green Fluorescent Protein Fusion that Self Assembles as Polar Filaments' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sawaya, M.R.' 1 ? primary 'Hochschild, A.' 2 ? primary 'Heller, D.M.' 3 ? primary 'McPartland, L.' 4 ? primary 'Eisenberg, D.S.' 5 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 95.960 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5HW9 _cell.details ? _cell.formula_units_Z ? _cell.length_a 45.730 _cell.length_a_esd ? _cell.length_b 51.800 _cell.length_b_esd ? _cell.length_c 54.790 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5HW9 _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Green fluorescent protein' 28950.619 1 ? 'S65A, V68L, S72A' ? ? 2 water nat water 18.015 6 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTF(PIA)LQCFARYPDHM KQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQK NGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK AMAKETAAAKFDHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFAYGLQCFARYPDHMKQ HDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNG IKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYKAM AKETAAAKFDHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 LYS n 1 4 GLY n 1 5 GLU n 1 6 GLU n 1 7 LEU n 1 8 PHE n 1 9 THR n 1 10 GLY n 1 11 VAL n 1 12 VAL n 1 13 PRO n 1 14 ILE n 1 15 LEU n 1 16 VAL n 1 17 GLU n 1 18 LEU n 1 19 ASP n 1 20 GLY n 1 21 ASP n 1 22 VAL n 1 23 ASN n 1 24 GLY n 1 25 HIS n 1 26 LYS n 1 27 PHE n 1 28 SER n 1 29 VAL n 1 30 SER n 1 31 GLY n 1 32 GLU n 1 33 GLY n 1 34 GLU n 1 35 GLY n 1 36 ASP n 1 37 ALA n 1 38 THR n 1 39 TYR n 1 40 GLY n 1 41 LYS n 1 42 LEU n 1 43 THR n 1 44 LEU n 1 45 LYS n 1 46 PHE n 1 47 ILE n 1 48 CYS n 1 49 THR n 1 50 THR n 1 51 GLY n 1 52 LYS n 1 53 LEU n 1 54 PRO n 1 55 VAL n 1 56 PRO n 1 57 TRP n 1 58 PRO n 1 59 THR n 1 60 LEU n 1 61 VAL n 1 62 THR n 1 63 THR n 1 64 PHE n 1 65 PIA n 1 66 LEU n 1 67 GLN n 1 68 CYS n 1 69 PHE n 1 70 ALA n 1 71 ARG n 1 72 TYR n 1 73 PRO n 1 74 ASP n 1 75 HIS n 1 76 MET n 1 77 LYS n 1 78 GLN n 1 79 HIS n 1 80 ASP n 1 81 PHE n 1 82 PHE n 1 83 LYS n 1 84 SER n 1 85 ALA n 1 86 MET n 1 87 PRO n 1 88 GLU n 1 89 GLY n 1 90 TYR n 1 91 VAL n 1 92 GLN n 1 93 GLU n 1 94 ARG n 1 95 THR n 1 96 ILE n 1 97 PHE n 1 98 PHE n 1 99 LYS n 1 100 ASP n 1 101 ASP n 1 102 GLY n 1 103 ASN n 1 104 TYR n 1 105 LYS n 1 106 THR n 1 107 ARG n 1 108 ALA n 1 109 GLU n 1 110 VAL n 1 111 LYS n 1 112 PHE n 1 113 GLU n 1 114 GLY n 1 115 ASP n 1 116 THR n 1 117 LEU n 1 118 VAL n 1 119 ASN n 1 120 ARG n 1 121 ILE n 1 122 GLU n 1 123 LEU n 1 124 LYS n 1 125 GLY n 1 126 ILE n 1 127 ASP n 1 128 PHE n 1 129 LYS n 1 130 GLU n 1 131 ASP n 1 132 GLY n 1 133 ASN n 1 134 ILE n 1 135 LEU n 1 136 GLY n 1 137 HIS n 1 138 LYS n 1 139 LEU n 1 140 GLU n 1 141 TYR n 1 142 ASN n 1 143 TYR n 1 144 ASN n 1 145 SER n 1 146 HIS n 1 147 ASN n 1 148 VAL n 1 149 TYR n 1 150 ILE n 1 151 MET n 1 152 ALA n 1 153 ASP n 1 154 LYS n 1 155 GLN n 1 156 LYS n 1 157 ASN n 1 158 GLY n 1 159 ILE n 1 160 LYS n 1 161 VAL n 1 162 ASN n 1 163 PHE n 1 164 LYS n 1 165 ILE n 1 166 ARG n 1 167 HIS n 1 168 ASN n 1 169 ILE n 1 170 GLU n 1 171 ASP n 1 172 GLY n 1 173 SER n 1 174 VAL n 1 175 GLN n 1 176 LEU n 1 177 ALA n 1 178 ASP n 1 179 HIS n 1 180 TYR n 1 181 GLN n 1 182 GLN n 1 183 ASN n 1 184 THR n 1 185 PRO n 1 186 ILE n 1 187 GLY n 1 188 ASP n 1 189 GLY n 1 190 PRO n 1 191 VAL n 1 192 LEU n 1 193 LEU n 1 194 PRO n 1 195 ASP n 1 196 ASN n 1 197 HIS n 1 198 TYR n 1 199 LEU n 1 200 SER n 1 201 THR n 1 202 GLN n 1 203 SER n 1 204 ALA n 1 205 LEU n 1 206 SER n 1 207 LYS n 1 208 ASP n 1 209 PRO n 1 210 ASN n 1 211 GLU n 1 212 LYS n 1 213 ARG n 1 214 ASP n 1 215 HIS n 1 216 MET n 1 217 VAL n 1 218 LEU n 1 219 LEU n 1 220 GLU n 1 221 PHE n 1 222 VAL n 1 223 THR n 1 224 ALA n 1 225 ALA n 1 226 GLY n 1 227 ILE n 1 228 THR n 1 229 HIS n 1 230 GLY n 1 231 MET n 1 232 ASP n 1 233 GLU n 1 234 LEU n 1 235 TYR n 1 236 LYS n 1 237 ALA n 1 238 MET n 1 239 ALA n 1 240 LYS n 1 241 GLU n 1 242 THR n 1 243 ALA n 1 244 ALA n 1 245 ALA n 1 246 LYS n 1 247 PHE n 1 248 ASP n 1 249 HIS n 1 250 HIS n 1 251 HIS n 1 252 HIS n 1 253 HIS n 1 254 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 254 _entity_src_gen.gene_src_common_name Jellyfish _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene GFP _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Aequorea victoria' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6100 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GFP_AEQVI _struct_ref.pdbx_db_accession P42212 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQ HDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNG IKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5HW9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 236 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P42212 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 238 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 238 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5HW9 PIA A 65 ? UNP P42212 SER 65 chromophore 66 1 1 5HW9 PIA A 65 ? UNP P42212 TYR 66 chromophore 66 2 1 5HW9 PIA A 65 ? UNP P42212 GLY 67 chromophore 66 3 1 5HW9 LEU A 66 ? UNP P42212 VAL 68 'engineered mutation' 68 4 1 5HW9 ALA A 70 ? UNP P42212 SER 72 'engineered mutation' 72 5 1 5HW9 ALA A 237 ? UNP P42212 ? ? 'expression tag' 239 6 1 5HW9 MET A 238 ? UNP P42212 ? ? 'expression tag' 240 7 1 5HW9 ALA A 239 ? UNP P42212 ? ? 'expression tag' 241 8 1 5HW9 LYS A 240 ? UNP P42212 ? ? 'expression tag' 242 9 1 5HW9 GLU A 241 ? UNP P42212 ? ? 'expression tag' 243 10 1 5HW9 THR A 242 ? UNP P42212 ? ? 'expression tag' 244 11 1 5HW9 ALA A 243 ? UNP P42212 ? ? 'expression tag' 245 12 1 5HW9 ALA A 244 ? UNP P42212 ? ? 'expression tag' 246 13 1 5HW9 ALA A 245 ? UNP P42212 ? ? 'expression tag' 247 14 1 5HW9 LYS A 246 ? UNP P42212 ? ? 'expression tag' 248 15 1 5HW9 PHE A 247 ? UNP P42212 ? ? 'expression tag' 249 16 1 5HW9 ASP A 248 ? UNP P42212 ? ? 'expression tag' 250 17 1 5HW9 HIS A 249 ? UNP P42212 ? ? 'expression tag' 251 18 1 5HW9 HIS A 250 ? UNP P42212 ? ? 'expression tag' 252 19 1 5HW9 HIS A 251 ? UNP P42212 ? ? 'expression tag' 253 20 1 5HW9 HIS A 252 ? UNP P42212 ? ? 'expression tag' 254 21 1 5HW9 HIS A 253 ? UNP P42212 ? ? 'expression tag' 255 22 1 5HW9 HIS A 254 ? UNP P42212 ? ? 'expression tag' 256 23 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PIA 'L-peptide linking' n '[(4Z)-2-[(1S)-1-aminoethyl]-4-(4-hydroxybenzylidene)-5-oxo-4,5-dihydro-1H-imidazol-1-yl]acetic acid' ? 'C14 H15 N3 O4' 289.287 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5HW9 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.23 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 44.83 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '10% 1,6-hexanediol, sodium cacodylate pH 6.5, 5 mM magnesium chloride, 200 mM KCl' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-12-07 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.4760 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-C' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.4760 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-C _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5HW9 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.00 _reflns.d_resolution_low 45.48 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all 4965 _reflns.number_obs 4965 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I -3 _reflns.percent_possible_obs 95.1 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.2 _reflns.pdbx_Rmerge_I_obs 0.189 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 5.81 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 3.00 _reflns_shell.d_res_low 3.08 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.24 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 84.4 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.750 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 2.1 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -2.0812 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] -3.3864 _refine.aniso_B[2][2] -0.3722 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 2.4534 _refine.B_iso_max 125.350 _refine.B_iso_mean 49.9800 _refine.B_iso_min 24.620 _refine.correlation_coeff_Fo_to_Fc 0.9251 _refine.correlation_coeff_Fo_to_Fc_free 0.8763 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5HW9 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.0000 _refine.ls_d_res_low 45.48 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 4963 _refine.ls_number_reflns_R_free 502 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 95.1100 _refine.ls_percent_reflns_R_free 10.1100 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1911 _refine.ls_R_factor_R_free 0.2322 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1864 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5HBD _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI 0.4300 _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 5HW9 _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.425 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 3.0000 _refine_hist.d_res_low 45.48 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 6 _refine_hist.number_atoms_total 1958 _refine_hist.pdbx_number_residues_total 245 _refine_hist.pdbx_B_iso_mean_solvent 37.88 _refine_hist.pdbx_number_atoms_protein 1952 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? ? ? 713 ? t_dihedral_angle_d 2.000 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? 56 ? t_trig_c_planes 2.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 284 ? t_gen_planes 5.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 1998 ? t_it 20.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_nbd ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_improper_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_pseud_angle ? ? 'X-RAY DIFFRACTION' ? ? ? 252 ? t_chiral_improper_torsion 5.000 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_sum_occupancies ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_distance ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 2145 ? t_ideal_dist_contact 4.000 SEMIHARMONIC 'X-RAY DIFFRACTION' ? 0.010 ? 1998 ? t_bond_d 2.000 HARMONIC 'X-RAY DIFFRACTION' ? 1.220 ? 2694 ? t_angle_deg 2.000 HARMONIC 'X-RAY DIFFRACTION' ? 3.990 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 17.870 ? ? ? t_other_torsion ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 3.0000 _refine_ls_shell.d_res_low 3.3500 _refine_ls_shell.number_reflns_all 1323 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 134 _refine_ls_shell.number_reflns_R_work 1189 _refine_ls_shell.percent_reflns_obs 95.1100 _refine_ls_shell.percent_reflns_R_free 10.1300 _refine_ls_shell.R_factor_all 0.2342 _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2838 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.2286 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 5 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5HW9 _struct.title 'Filamentous Assembly of Green Fluorescent Protein Supported by a C-terminal fusion of 18-residues, viewed in space group P21' _struct.pdbx_model_details ;An 18-residue C-terminal fusion forms an alpha helix which binds to surface of neighboring protomer, supporting a filamentous assembly with 2 sub 1 screw symmetry ; _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5HW9 _struct_keywords.text 'filament, 2 sub 1 screw symmetry, FLUORESCENT PROTEIN' _struct_keywords.pdbx_keywords 'FLUORESCENT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.details 'The biological unit is a filament with 2 sub 1 screw symmetry. The contents of REMARK 350 represent a portion of that filament' _struct_biol.id 1 _struct_biol.pdbx_aggregation_state ? _struct_biol.pdbx_assembly_method ? _struct_biol.pdbx_formula_weight ? _struct_biol.pdbx_formula_weight_method ? _struct_biol.pdbx_parent_biol_id ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 3 ? THR A 9 ? LYS A 3 THR A 9 5 ? 7 HELX_P HELX_P2 AA2 ALA A 37 ? TYR A 39 ? ALA A 37 TYR A 39 5 ? 3 HELX_P HELX_P3 AA3 PRO A 56 ? VAL A 61 ? PRO A 56 VAL A 61 5 ? 6 HELX_P HELX_P4 AA4 LEU A 66 ? ALA A 70 ? LEU A 68 ALA A 72 5 ? 5 HELX_P HELX_P5 AA5 PRO A 73 ? HIS A 79 ? PRO A 75 HIS A 81 5 ? 7 HELX_P HELX_P6 AA6 ASP A 80 ? ALA A 85 ? ASP A 82 ALA A 87 1 ? 6 HELX_P HELX_P7 AA7 LYS A 154 ? ASN A 157 ? LYS A 156 ASN A 159 5 ? 4 HELX_P HELX_P8 AA8 MET A 231 ? ALA A 245 ? MET A 233 ALA A 247 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A PHE 64 C ? ? ? 1_555 A PIA 65 N1 ? ? A PHE 64 A PIA 66 1_555 ? ? ? ? ? ? ? 1.340 ? ? covale2 covale both ? A PIA 65 C3 ? ? ? 1_555 A LEU 66 N ? ? A PIA 66 A LEU 68 1_555 ? ? ? ? ? ? ? 1.291 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id MET _struct_mon_prot_cis.label_seq_id 86 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id MET _struct_mon_prot_cis.auth_seq_id 88 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 87 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 89 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 5.73 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 12 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA1 9 10 ? anti-parallel AA1 10 11 ? anti-parallel AA1 11 12 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 12 ? VAL A 22 ? VAL A 12 VAL A 22 AA1 2 HIS A 25 ? ASP A 36 ? HIS A 25 ASP A 36 AA1 3 LYS A 41 ? CYS A 48 ? LYS A 41 CYS A 48 AA1 4 HIS A 215 ? ALA A 225 ? HIS A 217 ALA A 227 AA1 5 HIS A 197 ? SER A 206 ? HIS A 199 SER A 208 AA1 6 HIS A 146 ? ASP A 153 ? HIS A 148 ASP A 155 AA1 7 GLY A 158 ? ASN A 168 ? GLY A 160 ASN A 170 AA1 8 VAL A 174 ? PRO A 185 ? VAL A 176 PRO A 187 AA1 9 TYR A 90 ? PHE A 98 ? TYR A 92 PHE A 100 AA1 10 ASN A 103 ? GLU A 113 ? ASN A 105 GLU A 115 AA1 11 THR A 116 ? ILE A 126 ? THR A 118 ILE A 128 AA1 12 VAL A 12 ? VAL A 22 ? VAL A 12 VAL A 22 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 20 ? N GLY A 20 O PHE A 27 ? O PHE A 27 AA1 2 3 N ASP A 36 ? N ASP A 36 O LYS A 41 ? O LYS A 41 AA1 3 4 N LEU A 44 ? N LEU A 44 O LEU A 218 ? O LEU A 220 AA1 4 5 O LEU A 219 ? O LEU A 221 N ALA A 204 ? N ALA A 206 AA1 5 6 O HIS A 197 ? O HIS A 199 N ILE A 150 ? N ILE A 152 AA1 6 7 N ASP A 153 ? N ASP A 155 O GLY A 158 ? O GLY A 160 AA1 7 8 N PHE A 163 ? N PHE A 165 O HIS A 179 ? O HIS A 181 AA1 8 9 O THR A 184 ? O THR A 186 N VAL A 91 ? N VAL A 93 AA1 9 10 N ILE A 96 ? N ILE A 98 O TYR A 104 ? O TYR A 106 AA1 10 11 N LYS A 111 ? N LYS A 113 O VAL A 118 ? O VAL A 120 AA1 11 12 O GLY A 125 ? O GLY A 127 N ASP A 21 ? N ASP A 21 # _atom_sites.entry_id 5HW9 _atom_sites.fract_transf_matrix[1][1] 0.021867 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.002283 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019305 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.018351 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 HIS 25 25 25 HIS HIS A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 TRP 57 57 57 TRP TRP A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 PIA 65 66 66 PIA PIA A . n A 1 66 LEU 66 68 68 LEU LEU A . n A 1 67 GLN 67 69 69 GLN GLN A . n A 1 68 CYS 68 70 70 CYS CYS A . n A 1 69 PHE 69 71 71 PHE PHE A . n A 1 70 ALA 70 72 72 ALA ALA A . n A 1 71 ARG 71 73 73 ARG ARG A . n A 1 72 TYR 72 74 74 TYR TYR A . n A 1 73 PRO 73 75 75 PRO PRO A . n A 1 74 ASP 74 76 76 ASP ASP A . n A 1 75 HIS 75 77 77 HIS HIS A . n A 1 76 MET 76 78 78 MET MET A . n A 1 77 LYS 77 79 79 LYS LYS A . n A 1 78 GLN 78 80 80 GLN GLN A . n A 1 79 HIS 79 81 81 HIS HIS A . n A 1 80 ASP 80 82 82 ASP ASP A . n A 1 81 PHE 81 83 83 PHE PHE A . n A 1 82 PHE 82 84 84 PHE PHE A . n A 1 83 LYS 83 85 85 LYS LYS A . n A 1 84 SER 84 86 86 SER SER A . n A 1 85 ALA 85 87 87 ALA ALA A . n A 1 86 MET 86 88 88 MET MET A . n A 1 87 PRO 87 89 89 PRO PRO A . n A 1 88 GLU 88 90 90 GLU GLU A . n A 1 89 GLY 89 91 91 GLY GLY A . n A 1 90 TYR 90 92 92 TYR TYR A . n A 1 91 VAL 91 93 93 VAL VAL A . n A 1 92 GLN 92 94 94 GLN GLN A . n A 1 93 GLU 93 95 95 GLU GLU A . n A 1 94 ARG 94 96 96 ARG ARG A . n A 1 95 THR 95 97 97 THR THR A . n A 1 96 ILE 96 98 98 ILE ILE A . n A 1 97 PHE 97 99 99 PHE PHE A . n A 1 98 PHE 98 100 100 PHE PHE A . n A 1 99 LYS 99 101 101 LYS LYS A . n A 1 100 ASP 100 102 102 ASP ASP A . n A 1 101 ASP 101 103 103 ASP ASP A . n A 1 102 GLY 102 104 104 GLY GLY A . n A 1 103 ASN 103 105 105 ASN ASN A . n A 1 104 TYR 104 106 106 TYR TYR A . n A 1 105 LYS 105 107 107 LYS LYS A . n A 1 106 THR 106 108 108 THR THR A . n A 1 107 ARG 107 109 109 ARG ARG A . n A 1 108 ALA 108 110 110 ALA ALA A . n A 1 109 GLU 109 111 111 GLU GLU A . n A 1 110 VAL 110 112 112 VAL VAL A . n A 1 111 LYS 111 113 113 LYS LYS A . n A 1 112 PHE 112 114 114 PHE PHE A . n A 1 113 GLU 113 115 115 GLU GLU A . n A 1 114 GLY 114 116 116 GLY GLY A . n A 1 115 ASP 115 117 117 ASP ASP A . n A 1 116 THR 116 118 118 THR THR A . n A 1 117 LEU 117 119 119 LEU LEU A . n A 1 118 VAL 118 120 120 VAL VAL A . n A 1 119 ASN 119 121 121 ASN ASN A . n A 1 120 ARG 120 122 122 ARG ARG A . n A 1 121 ILE 121 123 123 ILE ILE A . n A 1 122 GLU 122 124 124 GLU GLU A . n A 1 123 LEU 123 125 125 LEU LEU A . n A 1 124 LYS 124 126 126 LYS LYS A . n A 1 125 GLY 125 127 127 GLY GLY A . n A 1 126 ILE 126 128 128 ILE ILE A . n A 1 127 ASP 127 129 129 ASP ASP A . n A 1 128 PHE 128 130 130 PHE PHE A . n A 1 129 LYS 129 131 131 LYS LYS A . n A 1 130 GLU 130 132 132 GLU GLU A . n A 1 131 ASP 131 133 133 ASP ASP A . n A 1 132 GLY 132 134 134 GLY GLY A . n A 1 133 ASN 133 135 135 ASN ASN A . n A 1 134 ILE 134 136 136 ILE ILE A . n A 1 135 LEU 135 137 137 LEU LEU A . n A 1 136 GLY 136 138 138 GLY GLY A . n A 1 137 HIS 137 139 139 HIS HIS A . n A 1 138 LYS 138 140 140 LYS LYS A . n A 1 139 LEU 139 141 141 LEU LEU A . n A 1 140 GLU 140 142 142 GLU GLU A . n A 1 141 TYR 141 143 143 TYR TYR A . n A 1 142 ASN 142 144 144 ASN ASN A . n A 1 143 TYR 143 145 145 TYR TYR A . n A 1 144 ASN 144 146 146 ASN ASN A . n A 1 145 SER 145 147 147 SER SER A . n A 1 146 HIS 146 148 148 HIS HIS A . n A 1 147 ASN 147 149 149 ASN ASN A . n A 1 148 VAL 148 150 150 VAL VAL A . n A 1 149 TYR 149 151 151 TYR TYR A . n A 1 150 ILE 150 152 152 ILE ILE A . n A 1 151 MET 151 153 153 MET MET A . n A 1 152 ALA 152 154 154 ALA ALA A . n A 1 153 ASP 153 155 155 ASP ASP A . n A 1 154 LYS 154 156 156 LYS LYS A . n A 1 155 GLN 155 157 157 GLN GLN A . n A 1 156 LYS 156 158 158 LYS LYS A . n A 1 157 ASN 157 159 159 ASN ASN A . n A 1 158 GLY 158 160 160 GLY GLY A . n A 1 159 ILE 159 161 161 ILE ILE A . n A 1 160 LYS 160 162 162 LYS LYS A . n A 1 161 VAL 161 163 163 VAL VAL A . n A 1 162 ASN 162 164 164 ASN ASN A . n A 1 163 PHE 163 165 165 PHE PHE A . n A 1 164 LYS 164 166 166 LYS LYS A . n A 1 165 ILE 165 167 167 ILE ILE A . n A 1 166 ARG 166 168 168 ARG ARG A . n A 1 167 HIS 167 169 169 HIS HIS A . n A 1 168 ASN 168 170 170 ASN ASN A . n A 1 169 ILE 169 171 171 ILE ILE A . n A 1 170 GLU 170 172 172 GLU GLU A . n A 1 171 ASP 171 173 173 ASP ASP A . n A 1 172 GLY 172 174 174 GLY GLY A . n A 1 173 SER 173 175 175 SER SER A . n A 1 174 VAL 174 176 176 VAL VAL A . n A 1 175 GLN 175 177 177 GLN GLN A . n A 1 176 LEU 176 178 178 LEU LEU A . n A 1 177 ALA 177 179 179 ALA ALA A . n A 1 178 ASP 178 180 180 ASP ASP A . n A 1 179 HIS 179 181 181 HIS HIS A . n A 1 180 TYR 180 182 182 TYR TYR A . n A 1 181 GLN 181 183 183 GLN GLN A . n A 1 182 GLN 182 184 184 GLN GLN A . n A 1 183 ASN 183 185 185 ASN ASN A . n A 1 184 THR 184 186 186 THR THR A . n A 1 185 PRO 185 187 187 PRO PRO A . n A 1 186 ILE 186 188 188 ILE ILE A . n A 1 187 GLY 187 189 189 GLY GLY A . n A 1 188 ASP 188 190 190 ASP ASP A . n A 1 189 GLY 189 191 191 GLY GLY A . n A 1 190 PRO 190 192 192 PRO PRO A . n A 1 191 VAL 191 193 193 VAL VAL A . n A 1 192 LEU 192 194 194 LEU LEU A . n A 1 193 LEU 193 195 195 LEU LEU A . n A 1 194 PRO 194 196 196 PRO PRO A . n A 1 195 ASP 195 197 197 ASP ASP A . n A 1 196 ASN 196 198 198 ASN ASN A . n A 1 197 HIS 197 199 199 HIS HIS A . n A 1 198 TYR 198 200 200 TYR TYR A . n A 1 199 LEU 199 201 201 LEU LEU A . n A 1 200 SER 200 202 202 SER SER A . n A 1 201 THR 201 203 203 THR THR A . n A 1 202 GLN 202 204 204 GLN GLN A . n A 1 203 SER 203 205 205 SER SER A . n A 1 204 ALA 204 206 206 ALA ALA A . n A 1 205 LEU 205 207 207 LEU LEU A . n A 1 206 SER 206 208 208 SER SER A . n A 1 207 LYS 207 209 209 LYS LYS A . n A 1 208 ASP 208 210 210 ASP ASP A . n A 1 209 PRO 209 211 211 PRO PRO A . n A 1 210 ASN 210 212 212 ASN ASN A . n A 1 211 GLU 211 213 213 GLU GLU A . n A 1 212 LYS 212 214 214 LYS LYS A . n A 1 213 ARG 213 215 215 ARG ARG A . n A 1 214 ASP 214 216 216 ASP ASP A . n A 1 215 HIS 215 217 217 HIS HIS A . n A 1 216 MET 216 218 218 MET MET A . n A 1 217 VAL 217 219 219 VAL VAL A . n A 1 218 LEU 218 220 220 LEU LEU A . n A 1 219 LEU 219 221 221 LEU LEU A . n A 1 220 GLU 220 222 222 GLU GLU A . n A 1 221 PHE 221 223 223 PHE PHE A . n A 1 222 VAL 222 224 224 VAL VAL A . n A 1 223 THR 223 225 225 THR THR A . n A 1 224 ALA 224 226 226 ALA ALA A . n A 1 225 ALA 225 227 227 ALA ALA A . n A 1 226 GLY 226 228 228 GLY GLY A . n A 1 227 ILE 227 229 229 ILE ILE A . n A 1 228 THR 228 230 230 THR THR A . n A 1 229 HIS 229 231 231 HIS HIS A . n A 1 230 GLY 230 232 232 GLY GLY A . n A 1 231 MET 231 233 233 MET MET A . n A 1 232 ASP 232 234 234 ASP ASP A . n A 1 233 GLU 233 235 235 GLU GLU A . n A 1 234 LEU 234 236 236 LEU LEU A . n A 1 235 TYR 235 237 237 TYR TYR A . n A 1 236 LYS 236 238 238 LYS LYS A . n A 1 237 ALA 237 239 239 ALA ALA A . n A 1 238 MET 238 240 240 MET MET A . n A 1 239 ALA 239 241 241 ALA ALA A . n A 1 240 LYS 240 242 242 LYS LYS A . n A 1 241 GLU 241 243 243 GLU GLU A . n A 1 242 THR 242 244 244 THR THR A . n A 1 243 ALA 243 245 245 ALA ALA A . n A 1 244 ALA 244 246 246 ALA ALA A . n A 1 245 ALA 245 247 247 ALA ALA A . n A 1 246 LYS 246 248 248 LYS LYS A . n A 1 247 PHE 247 249 ? ? ? A . n A 1 248 ASP 248 250 ? ? ? A . n A 1 249 HIS 249 251 ? ? ? A . n A 1 250 HIS 250 252 ? ? ? A . n A 1 251 HIS 251 253 ? ? ? A . n A 1 252 HIS 252 254 ? ? ? A . n A 1 253 HIS 253 255 ? ? ? A . n A 1 254 HIS 254 256 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 301 4 HOH HOH A . B 2 HOH 2 302 5 HOH HOH A . B 2 HOH 3 303 6 HOH HOH A . B 2 HOH 4 304 3 HOH HOH A . B 2 HOH 5 305 2 HOH HOH A . B 2 HOH 6 306 1 HOH HOH A . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id PIA _pdbx_struct_mod_residue.label_seq_id 65 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id PIA _pdbx_struct_mod_residue.auth_seq_id 66 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id GLY _pdbx_struct_mod_residue.details chromophore # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details pentameric _pdbx_struct_assembly.oligomeric_count 5 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B 1 2 A,B 1 3 A,B 1 4 A,B 1 5 A,B # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 1_545 x,y-1,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -51.8000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 1_565 x,y+1,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 51.8000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 2_655 -x+1,y+1/2,-z -1.0000000000 0.0000000000 0.0000000000 45.7300000000 0.0000000000 1.0000000000 0.0000000000 25.9000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 5 'crystal symmetry operation' 2_645 -x+1,y-1/2,-z -1.0000000000 0.0000000000 0.0000000000 45.7300000000 0.0000000000 1.0000000000 0.0000000000 -25.9000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-02-01 2 'Structure model' 1 1 2023-09-27 3 'Structure model' 1 2 2023-11-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' 'Refinement description' 5 3 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model 5 2 'Structure model' struct_conn 6 3 'Structure model' chem_comp_atom 7 3 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 4 3 'Structure model' '_chem_comp_atom.atom_id' 5 3 'Structure model' '_chem_comp_bond.atom_id_1' 6 3 'Structure model' '_chem_comp_bond.atom_id_2' # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 12.4192 _pdbx_refine_tls.origin_y -1.3441 _pdbx_refine_tls.origin_z 6.7312 _pdbx_refine_tls.T[1][1] -0.0420 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.0014 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.1032 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] -0.0506 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.0062 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] -0.0140 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 0.3481 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] 0.1756 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 0.2237 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 1.0099 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 0.5307 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 0.6204 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] -0.0224 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] 0.0116 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] 0.0353 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] 0.0151 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.0605 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] -0.0031 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.1205 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.0397 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.0829 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 2 _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 248 _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details '{ A|* }' # _pdbx_phasing_MR.entry_id 5HW9 _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details 'Phaser MODE: MR_AUTO' _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation ? _pdbx_phasing_MR.d_res_low_rotation ? _pdbx_phasing_MR.d_res_high_translation ? _pdbx_phasing_MR.d_res_low_translation ? _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.5.6 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER-TNT ? ? ? . 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.20 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 5 # _pdbx_entry_details.compound_details ? _pdbx_entry_details.entry_id 5HW9 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details 'SER 65 WAS MUTATED TO ALA AND IS PART OF THE CHROMOPHORE PIA' _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A PHE 249 ? A PHE 247 3 1 Y 1 A ASP 250 ? A ASP 248 4 1 Y 1 A HIS 251 ? A HIS 249 5 1 Y 1 A HIS 252 ? A HIS 250 6 1 Y 1 A HIS 253 ? A HIS 251 7 1 Y 1 A HIS 254 ? A HIS 252 8 1 Y 1 A HIS 255 ? A HIS 253 9 1 Y 1 A HIS 256 ? A HIS 254 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PIA N1 N N N 273 PIA CA1 C N S 274 PIA CB1 C N N 275 PIA C1 C N N 276 PIA N2 N N N 277 PIA N3 N N N 278 PIA C2 C N N 279 PIA O2 O N N 280 PIA CA2 C N N 281 PIA CA3 C N N 282 PIA C3 C N N 283 PIA O3 O N N 284 PIA CB2 C N N 285 PIA CG2 C Y N 286 PIA CD1 C Y N 287 PIA CD2 C Y N 288 PIA CE1 C Y N 289 PIA CE2 C Y N 290 PIA CZ C Y N 291 PIA OH O N N 292 PIA OXT O N N 293 PIA H H N N 294 PIA H2 H N N 295 PIA HA1 H N N 296 PIA HB11 H N N 297 PIA HB12 H N N 298 PIA HB13 H N N 299 PIA HA31 H N N 300 PIA HA32 H N N 301 PIA HB2 H N N 302 PIA HD1 H N N 303 PIA HD2 H N N 304 PIA HE1 H N N 305 PIA HE2 H N N 306 PIA HH H N N 307 PIA HXT H N N 308 PRO N N N N 309 PRO CA C N S 310 PRO C C N N 311 PRO O O N N 312 PRO CB C N N 313 PRO CG C N N 314 PRO CD C N N 315 PRO OXT O N N 316 PRO H H N N 317 PRO HA H N N 318 PRO HB2 H N N 319 PRO HB3 H N N 320 PRO HG2 H N N 321 PRO HG3 H N N 322 PRO HD2 H N N 323 PRO HD3 H N N 324 PRO HXT H N N 325 SER N N N N 326 SER CA C N S 327 SER C C N N 328 SER O O N N 329 SER CB C N N 330 SER OG O N N 331 SER OXT O N N 332 SER H H N N 333 SER H2 H N N 334 SER HA H N N 335 SER HB2 H N N 336 SER HB3 H N N 337 SER HG H N N 338 SER HXT H N N 339 THR N N N N 340 THR CA C N S 341 THR C C N N 342 THR O O N N 343 THR CB C N R 344 THR OG1 O N N 345 THR CG2 C N N 346 THR OXT O N N 347 THR H H N N 348 THR H2 H N N 349 THR HA H N N 350 THR HB H N N 351 THR HG1 H N N 352 THR HG21 H N N 353 THR HG22 H N N 354 THR HG23 H N N 355 THR HXT H N N 356 TRP N N N N 357 TRP CA C N S 358 TRP C C N N 359 TRP O O N N 360 TRP CB C N N 361 TRP CG C Y N 362 TRP CD1 C Y N 363 TRP CD2 C Y N 364 TRP NE1 N Y N 365 TRP CE2 C Y N 366 TRP CE3 C Y N 367 TRP CZ2 C Y N 368 TRP CZ3 C Y N 369 TRP CH2 C Y N 370 TRP OXT O N N 371 TRP H H N N 372 TRP H2 H N N 373 TRP HA H N N 374 TRP HB2 H N N 375 TRP HB3 H N N 376 TRP HD1 H N N 377 TRP HE1 H N N 378 TRP HE3 H N N 379 TRP HZ2 H N N 380 TRP HZ3 H N N 381 TRP HH2 H N N 382 TRP HXT H N N 383 TYR N N N N 384 TYR CA C N S 385 TYR C C N N 386 TYR O O N N 387 TYR CB C N N 388 TYR CG C Y N 389 TYR CD1 C Y N 390 TYR CD2 C Y N 391 TYR CE1 C Y N 392 TYR CE2 C Y N 393 TYR CZ C Y N 394 TYR OH O N N 395 TYR OXT O N N 396 TYR H H N N 397 TYR H2 H N N 398 TYR HA H N N 399 TYR HB2 H N N 400 TYR HB3 H N N 401 TYR HD1 H N N 402 TYR HD2 H N N 403 TYR HE1 H N N 404 TYR HE2 H N N 405 TYR HH H N N 406 TYR HXT H N N 407 VAL N N N N 408 VAL CA C N S 409 VAL C C N N 410 VAL O O N N 411 VAL CB C N N 412 VAL CG1 C N N 413 VAL CG2 C N N 414 VAL OXT O N N 415 VAL H H N N 416 VAL H2 H N N 417 VAL HA H N N 418 VAL HB H N N 419 VAL HG11 H N N 420 VAL HG12 H N N 421 VAL HG13 H N N 422 VAL HG21 H N N 423 VAL HG22 H N N 424 VAL HG23 H N N 425 VAL HXT H N N 426 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PIA N1 CA1 sing N N 260 PIA N1 H sing N N 261 PIA N1 H2 sing N N 262 PIA CA1 CB1 sing N N 263 PIA CA1 C1 sing N N 264 PIA CA1 HA1 sing N N 265 PIA CB1 HB11 sing N N 266 PIA CB1 HB12 sing N N 267 PIA CB1 HB13 sing N N 268 PIA C1 N2 doub N N 269 PIA C1 N3 sing N N 270 PIA N2 CA2 sing N N 271 PIA N3 C2 sing N N 272 PIA N3 CA3 sing N N 273 PIA C2 O2 doub N N 274 PIA C2 CA2 sing N N 275 PIA CA2 CB2 doub N Z 276 PIA CA3 C3 sing N N 277 PIA CA3 HA31 sing N N 278 PIA CA3 HA32 sing N N 279 PIA C3 O3 doub N N 280 PIA C3 OXT sing N N 281 PIA CB2 CG2 sing N N 282 PIA CB2 HB2 sing N N 283 PIA CG2 CD1 doub Y N 284 PIA CG2 CD2 sing Y N 285 PIA CD1 CE1 sing Y N 286 PIA CD1 HD1 sing N N 287 PIA CD2 CE2 doub Y N 288 PIA CD2 HD2 sing N N 289 PIA CE1 CZ doub Y N 290 PIA CE1 HE1 sing N N 291 PIA CE2 CZ sing Y N 292 PIA CE2 HE2 sing N N 293 PIA CZ OH sing N N 294 PIA OH HH sing N N 295 PIA OXT HXT sing N N 296 PRO N CA sing N N 297 PRO N CD sing N N 298 PRO N H sing N N 299 PRO CA C sing N N 300 PRO CA CB sing N N 301 PRO CA HA sing N N 302 PRO C O doub N N 303 PRO C OXT sing N N 304 PRO CB CG sing N N 305 PRO CB HB2 sing N N 306 PRO CB HB3 sing N N 307 PRO CG CD sing N N 308 PRO CG HG2 sing N N 309 PRO CG HG3 sing N N 310 PRO CD HD2 sing N N 311 PRO CD HD3 sing N N 312 PRO OXT HXT sing N N 313 SER N CA sing N N 314 SER N H sing N N 315 SER N H2 sing N N 316 SER CA C sing N N 317 SER CA CB sing N N 318 SER CA HA sing N N 319 SER C O doub N N 320 SER C OXT sing N N 321 SER CB OG sing N N 322 SER CB HB2 sing N N 323 SER CB HB3 sing N N 324 SER OG HG sing N N 325 SER OXT HXT sing N N 326 THR N CA sing N N 327 THR N H sing N N 328 THR N H2 sing N N 329 THR CA C sing N N 330 THR CA CB sing N N 331 THR CA HA sing N N 332 THR C O doub N N 333 THR C OXT sing N N 334 THR CB OG1 sing N N 335 THR CB CG2 sing N N 336 THR CB HB sing N N 337 THR OG1 HG1 sing N N 338 THR CG2 HG21 sing N N 339 THR CG2 HG22 sing N N 340 THR CG2 HG23 sing N N 341 THR OXT HXT sing N N 342 TRP N CA sing N N 343 TRP N H sing N N 344 TRP N H2 sing N N 345 TRP CA C sing N N 346 TRP CA CB sing N N 347 TRP CA HA sing N N 348 TRP C O doub N N 349 TRP C OXT sing N N 350 TRP CB CG sing N N 351 TRP CB HB2 sing N N 352 TRP CB HB3 sing N N 353 TRP CG CD1 doub Y N 354 TRP CG CD2 sing Y N 355 TRP CD1 NE1 sing Y N 356 TRP CD1 HD1 sing N N 357 TRP CD2 CE2 doub Y N 358 TRP CD2 CE3 sing Y N 359 TRP NE1 CE2 sing Y N 360 TRP NE1 HE1 sing N N 361 TRP CE2 CZ2 sing Y N 362 TRP CE3 CZ3 doub Y N 363 TRP CE3 HE3 sing N N 364 TRP CZ2 CH2 doub Y N 365 TRP CZ2 HZ2 sing N N 366 TRP CZ3 CH2 sing Y N 367 TRP CZ3 HZ3 sing N N 368 TRP CH2 HH2 sing N N 369 TRP OXT HXT sing N N 370 TYR N CA sing N N 371 TYR N H sing N N 372 TYR N H2 sing N N 373 TYR CA C sing N N 374 TYR CA CB sing N N 375 TYR CA HA sing N N 376 TYR C O doub N N 377 TYR C OXT sing N N 378 TYR CB CG sing N N 379 TYR CB HB2 sing N N 380 TYR CB HB3 sing N N 381 TYR CG CD1 doub Y N 382 TYR CG CD2 sing Y N 383 TYR CD1 CE1 sing Y N 384 TYR CD1 HD1 sing N N 385 TYR CD2 CE2 doub Y N 386 TYR CD2 HD2 sing N N 387 TYR CE1 CZ doub Y N 388 TYR CE1 HE1 sing N N 389 TYR CE2 CZ sing Y N 390 TYR CE2 HE2 sing N N 391 TYR CZ OH sing N N 392 TYR OH HH sing N N 393 TYR OXT HXT sing N N 394 VAL N CA sing N N 395 VAL N H sing N N 396 VAL N H2 sing N N 397 VAL CA C sing N N 398 VAL CA CB sing N N 399 VAL CA HA sing N N 400 VAL C O doub N N 401 VAL C OXT sing N N 402 VAL CB CG1 sing N N 403 VAL CB CG2 sing N N 404 VAL CB HB sing N N 405 VAL CG1 HG11 sing N N 406 VAL CG1 HG12 sing N N 407 VAL CG1 HG13 sing N N 408 VAL CG2 HG21 sing N N 409 VAL CG2 HG22 sing N N 410 VAL CG2 HG23 sing N N 411 VAL OXT HXT sing N N 412 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5HBD _pdbx_initial_refinement_model.details ? #