data_5JF6 # _entry.id 5JF6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5JF6 pdb_00005jf6 10.2210/pdb5jf6/pdb WWPDB D_1000220479 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-11-30 2 'Structure model' 1 1 2017-09-06 3 'Structure model' 1 2 2024-01-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_audit_support 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_initial_refinement_model 6 3 'Structure model' pdbx_struct_conn_angle 7 3 'Structure model' struct_conn 8 3 'Structure model' struct_conn_type # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_audit_support.funding_organization' 2 3 'Structure model' '_database_2.pdbx_DOI' 3 3 'Structure model' '_database_2.pdbx_database_accession' 4 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 7 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 8 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 9 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 10 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_symmetry' 11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 12 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 13 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_symmetry' 14 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 15 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 16 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 17 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 18 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 19 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 20 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry' 21 3 'Structure model' '_pdbx_struct_conn_angle.value' 22 3 'Structure model' '_struct_conn.conn_type_id' 23 3 'Structure model' '_struct_conn.id' 24 3 'Structure model' '_struct_conn.pdbx_dist_value' 25 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 26 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 27 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 28 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 29 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 30 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 31 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 32 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 33 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 34 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 35 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 36 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 37 3 'Structure model' '_struct_conn.ptnr2_label_seq_id' 38 3 'Structure model' '_struct_conn.ptnr2_symmetry' 39 3 'Structure model' '_struct_conn_type.id' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5JF6 _pdbx_database_status.recvd_initial_deposition_date 2016-04-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Fieulaine, S.' 1 'Giglione, C.' 2 'Meinnel, T.' 3 'Hamiche, K.' 4 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Rep' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2045-2322 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 6 _citation.language ? _citation.page_first 35429 _citation.page_last 35429 _citation.title 'A unique peptide deformylase platform to rationally design and challenge novel active compounds.' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/srep35429 _citation.pdbx_database_id_PubMed 27762275 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Fieulaine, S.' 1 ? primary 'Alves de Sousa, R.' 2 ? primary 'Maigre, L.' 3 ? primary 'Hamiche, K.' 4 ? primary 'Alimi, M.' 5 ? primary 'Bolla, J.M.' 6 ? primary 'Taleb, A.' 7 ? primary 'Denis, A.' 8 ? primary 'Pages, J.M.' 9 ? primary 'Artaud, I.' 10 ? primary 'Meinnel, T.' 11 ? primary 'Giglione, C.' 12 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Peptide deformylase' 22894.297 1 3.5.1.88 S2A ? ? 2 non-polymer syn '2-(5-bromo-1H-indol-3-yl)-N-hydroxyacetamide' 269.095 1 ? ? ? ? 3 non-polymer syn 'ACETATE ION' 59.044 1 ? ? ? ? 4 non-polymer syn 'ZINC ION' 65.409 8 ? ? ? ? 5 water nat water 18.015 407 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PDF,Polypeptide deformylase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MAAIDKLVKASHLIDMNDIIREGNPTLRKVAEEVTFPLSEKEEILGEKMMQFLKHSQDPIMAEKLGLRGGVGLAAPQLDI SKRIIAVLVPNVEDAQGNPPKEAYSLQEVMYNPKVVSHSVQDAALSDGEG(OCS)LSVDREVPGYVVRHARVTIEYFDKT GEKHRLKLKGYNSIVVQHEIDHIDGIMFYDRINEKNPFAVKEGLLILE ; _entity_poly.pdbx_seq_one_letter_code_can ;MAAIDKLVKASHLIDMNDIIREGNPTLRKVAEEVTFPLSEKEEILGEKMMQFLKHSQDPIMAEKLGLRGGVGLAAPQLDI SKRIIAVLVPNVEDAQGNPPKEAYSLQEVMYNPKVVSHSVQDAALSDGEGCLSVDREVPGYVVRHARVTIEYFDKTGEKH RLKLKGYNSIVVQHEIDHIDGIMFYDRINEKNPFAVKEGLLILE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '2-(5-bromo-1H-indol-3-yl)-N-hydroxyacetamide' BB4 3 'ACETATE ION' ACT 4 'ZINC ION' ZN 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 ALA n 1 4 ILE n 1 5 ASP n 1 6 LYS n 1 7 LEU n 1 8 VAL n 1 9 LYS n 1 10 ALA n 1 11 SER n 1 12 HIS n 1 13 LEU n 1 14 ILE n 1 15 ASP n 1 16 MET n 1 17 ASN n 1 18 ASP n 1 19 ILE n 1 20 ILE n 1 21 ARG n 1 22 GLU n 1 23 GLY n 1 24 ASN n 1 25 PRO n 1 26 THR n 1 27 LEU n 1 28 ARG n 1 29 LYS n 1 30 VAL n 1 31 ALA n 1 32 GLU n 1 33 GLU n 1 34 VAL n 1 35 THR n 1 36 PHE n 1 37 PRO n 1 38 LEU n 1 39 SER n 1 40 GLU n 1 41 LYS n 1 42 GLU n 1 43 GLU n 1 44 ILE n 1 45 LEU n 1 46 GLY n 1 47 GLU n 1 48 LYS n 1 49 MET n 1 50 MET n 1 51 GLN n 1 52 PHE n 1 53 LEU n 1 54 LYS n 1 55 HIS n 1 56 SER n 1 57 GLN n 1 58 ASP n 1 59 PRO n 1 60 ILE n 1 61 MET n 1 62 ALA n 1 63 GLU n 1 64 LYS n 1 65 LEU n 1 66 GLY n 1 67 LEU n 1 68 ARG n 1 69 GLY n 1 70 GLY n 1 71 VAL n 1 72 GLY n 1 73 LEU n 1 74 ALA n 1 75 ALA n 1 76 PRO n 1 77 GLN n 1 78 LEU n 1 79 ASP n 1 80 ILE n 1 81 SER n 1 82 LYS n 1 83 ARG n 1 84 ILE n 1 85 ILE n 1 86 ALA n 1 87 VAL n 1 88 LEU n 1 89 VAL n 1 90 PRO n 1 91 ASN n 1 92 VAL n 1 93 GLU n 1 94 ASP n 1 95 ALA n 1 96 GLN n 1 97 GLY n 1 98 ASN n 1 99 PRO n 1 100 PRO n 1 101 LYS n 1 102 GLU n 1 103 ALA n 1 104 TYR n 1 105 SER n 1 106 LEU n 1 107 GLN n 1 108 GLU n 1 109 VAL n 1 110 MET n 1 111 TYR n 1 112 ASN n 1 113 PRO n 1 114 LYS n 1 115 VAL n 1 116 VAL n 1 117 SER n 1 118 HIS n 1 119 SER n 1 120 VAL n 1 121 GLN n 1 122 ASP n 1 123 ALA n 1 124 ALA n 1 125 LEU n 1 126 SER n 1 127 ASP n 1 128 GLY n 1 129 GLU n 1 130 GLY n 1 131 OCS n 1 132 LEU n 1 133 SER n 1 134 VAL n 1 135 ASP n 1 136 ARG n 1 137 GLU n 1 138 VAL n 1 139 PRO n 1 140 GLY n 1 141 TYR n 1 142 VAL n 1 143 VAL n 1 144 ARG n 1 145 HIS n 1 146 ALA n 1 147 ARG n 1 148 VAL n 1 149 THR n 1 150 ILE n 1 151 GLU n 1 152 TYR n 1 153 PHE n 1 154 ASP n 1 155 LYS n 1 156 THR n 1 157 GLY n 1 158 GLU n 1 159 LYS n 1 160 HIS n 1 161 ARG n 1 162 LEU n 1 163 LYS n 1 164 LEU n 1 165 LYS n 1 166 GLY n 1 167 TYR n 1 168 ASN n 1 169 SER n 1 170 ILE n 1 171 VAL n 1 172 VAL n 1 173 GLN n 1 174 HIS n 1 175 GLU n 1 176 ILE n 1 177 ASP n 1 178 HIS n 1 179 ILE n 1 180 ASP n 1 181 GLY n 1 182 ILE n 1 183 MET n 1 184 PHE n 1 185 TYR n 1 186 ASP n 1 187 ARG n 1 188 ILE n 1 189 ASN n 1 190 GLU n 1 191 LYS n 1 192 ASN n 1 193 PRO n 1 194 PHE n 1 195 ALA n 1 196 VAL n 1 197 LYS n 1 198 GLU n 1 199 GLY n 1 200 LEU n 1 201 LEU n 1 202 ILE n 1 203 LEU n 1 204 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 204 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'def, gbs1883' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptococcus agalactiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1311 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant Rosetta2,pLysS _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector pET16b _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACT non-polymer . 'ACETATE ION' ? 'C2 H3 O2 -1' 59.044 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BB4 non-polymer . '2-(5-bromo-1H-indol-3-yl)-N-hydroxyacetamide' ? 'C10 H9 Br N2 O2' 269.095 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 OCS 'L-peptide linking' n 'CYSTEINESULFONIC ACID' ? 'C3 H7 N O5 S' 169.156 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 HIS 12 12 12 HIS HIS A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 MET 16 16 16 MET MET A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 MET 49 49 49 MET MET A . n A 1 50 MET 50 50 50 MET MET A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 HIS 55 55 55 HIS HIS A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 PRO 59 59 59 PRO PRO A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 MET 61 61 61 MET MET A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 PRO 90 90 90 PRO PRO A . n A 1 91 ASN 91 91 91 ASN ASN A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 GLN 96 96 96 GLN GLN A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 ASN 98 98 98 ASN ASN A . n A 1 99 PRO 99 99 99 PRO PRO A . n A 1 100 PRO 100 100 100 PRO PRO A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 TYR 104 104 104 TYR TYR A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 GLN 107 107 107 GLN GLN A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 VAL 109 109 109 VAL VAL A . n A 1 110 MET 110 110 110 MET MET A . n A 1 111 TYR 111 111 111 TYR TYR A . n A 1 112 ASN 112 112 112 ASN ASN A . n A 1 113 PRO 113 113 113 PRO PRO A . n A 1 114 LYS 114 114 114 LYS LYS A . n A 1 115 VAL 115 115 115 VAL VAL A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 HIS 118 118 118 HIS HIS A . n A 1 119 SER 119 119 119 SER SER A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 GLN 121 121 121 GLN GLN A . n A 1 122 ASP 122 122 122 ASP ASP A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 SER 126 126 126 SER SER A . n A 1 127 ASP 127 127 127 ASP ASP A . n A 1 128 GLY 128 128 128 GLY GLY A . n A 1 129 GLU 129 129 129 GLU GLU A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 OCS 131 131 131 OCS OCS A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 SER 133 133 133 SER SER A . n A 1 134 VAL 134 134 134 VAL VAL A . n A 1 135 ASP 135 135 135 ASP ASP A . n A 1 136 ARG 136 136 136 ARG ARG A . n A 1 137 GLU 137 137 137 GLU GLU A . n A 1 138 VAL 138 138 138 VAL VAL A . n A 1 139 PRO 139 139 139 PRO PRO A . n A 1 140 GLY 140 140 140 GLY GLY A . n A 1 141 TYR 141 141 141 TYR TYR A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 VAL 143 143 143 VAL VAL A . n A 1 144 ARG 144 144 144 ARG ARG A . n A 1 145 HIS 145 145 145 HIS HIS A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 ARG 147 147 147 ARG ARG A . n A 1 148 VAL 148 148 148 VAL VAL A . n A 1 149 THR 149 149 149 THR THR A . n A 1 150 ILE 150 150 150 ILE ILE A . n A 1 151 GLU 151 151 151 GLU GLU A . n A 1 152 TYR 152 152 152 TYR TYR A . n A 1 153 PHE 153 153 153 PHE PHE A . n A 1 154 ASP 154 154 154 ASP ASP A . n A 1 155 LYS 155 155 155 LYS LYS A . n A 1 156 THR 156 156 156 THR THR A . n A 1 157 GLY 157 157 157 GLY GLY A . n A 1 158 GLU 158 158 158 GLU GLU A . n A 1 159 LYS 159 159 159 LYS LYS A . n A 1 160 HIS 160 160 160 HIS HIS A . n A 1 161 ARG 161 161 161 ARG ARG A . n A 1 162 LEU 162 162 162 LEU LEU A . n A 1 163 LYS 163 163 163 LYS LYS A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 LYS 165 165 165 LYS LYS A . n A 1 166 GLY 166 166 166 GLY GLY A . n A 1 167 TYR 167 167 167 TYR TYR A . n A 1 168 ASN 168 168 168 ASN ASN A . n A 1 169 SER 169 169 169 SER SER A . n A 1 170 ILE 170 170 170 ILE ILE A . n A 1 171 VAL 171 171 171 VAL VAL A . n A 1 172 VAL 172 172 172 VAL VAL A . n A 1 173 GLN 173 173 173 GLN GLN A . n A 1 174 HIS 174 174 174 HIS HIS A . n A 1 175 GLU 175 175 175 GLU GLU A . n A 1 176 ILE 176 176 176 ILE ILE A . n A 1 177 ASP 177 177 177 ASP ASP A . n A 1 178 HIS 178 178 178 HIS HIS A . n A 1 179 ILE 179 179 179 ILE ILE A . n A 1 180 ASP 180 180 180 ASP ASP A . n A 1 181 GLY 181 181 181 GLY GLY A . n A 1 182 ILE 182 182 182 ILE ILE A . n A 1 183 MET 183 183 183 MET MET A . n A 1 184 PHE 184 184 184 PHE PHE A . n A 1 185 TYR 185 185 185 TYR TYR A . n A 1 186 ASP 186 186 186 ASP ASP A . n A 1 187 ARG 187 187 187 ARG ARG A . n A 1 188 ILE 188 188 188 ILE ILE A . n A 1 189 ASN 189 189 189 ASN ASN A . n A 1 190 GLU 190 190 190 GLU GLU A . n A 1 191 LYS 191 191 191 LYS LYS A . n A 1 192 ASN 192 192 192 ASN ASN A . n A 1 193 PRO 193 193 193 PRO PRO A . n A 1 194 PHE 194 194 194 PHE PHE A . n A 1 195 ALA 195 195 195 ALA ALA A . n A 1 196 VAL 196 196 196 VAL VAL A . n A 1 197 LYS 197 197 197 LYS LYS A . n A 1 198 GLU 198 198 198 GLU GLU A . n A 1 199 GLY 199 199 199 GLY GLY A . n A 1 200 LEU 200 200 200 LEU LEU A . n A 1 201 LEU 201 201 201 LEU LEU A . n A 1 202 ILE 202 202 202 ILE ILE A . n A 1 203 LEU 203 203 203 LEU LEU A . n A 1 204 GLU 204 204 204 GLU GLU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 BB4 1 301 1 BB4 BB4 A . C 3 ACT 1 302 2 ACT ACT A . D 4 ZN 1 303 1 ZN ZN A . E 4 ZN 1 304 2 ZN ZN A . F 4 ZN 1 305 3 ZN ZN A . G 4 ZN 1 306 4 ZN ZN A . H 4 ZN 1 307 5 ZN ZN A . I 4 ZN 1 308 6 ZN ZN A . J 4 ZN 1 309 7 ZN ZN A . K 4 ZN 1 310 8 ZN ZN A . L 5 HOH 1 401 94 HOH HOH A . L 5 HOH 2 402 40 HOH HOH A . L 5 HOH 3 403 410 HOH HOH A . L 5 HOH 4 404 406 HOH HOH A . L 5 HOH 5 405 16 HOH HOH A . L 5 HOH 6 406 78 HOH HOH A . L 5 HOH 7 407 215 HOH HOH A . L 5 HOH 8 408 345 HOH HOH A . L 5 HOH 9 409 142 HOH HOH A . L 5 HOH 10 410 300 HOH HOH A . L 5 HOH 11 411 76 HOH HOH A . L 5 HOH 12 412 188 HOH HOH A . L 5 HOH 13 413 42 HOH HOH A . L 5 HOH 14 414 164 HOH HOH A . L 5 HOH 15 415 229 HOH HOH A . L 5 HOH 16 416 251 HOH HOH A . L 5 HOH 17 417 297 HOH HOH A . L 5 HOH 18 418 189 HOH HOH A . L 5 HOH 19 419 371 HOH HOH A . L 5 HOH 20 420 89 HOH HOH A . L 5 HOH 21 421 163 HOH HOH A . L 5 HOH 22 422 271 HOH HOH A . L 5 HOH 23 423 264 HOH HOH A . L 5 HOH 24 424 284 HOH HOH A . L 5 HOH 25 425 61 HOH HOH A . L 5 HOH 26 426 213 HOH HOH A . L 5 HOH 27 427 156 HOH HOH A . L 5 HOH 28 428 112 HOH HOH A . L 5 HOH 29 429 157 HOH HOH A . L 5 HOH 30 430 287 HOH HOH A . L 5 HOH 31 431 278 HOH HOH A . L 5 HOH 32 432 320 HOH HOH A . L 5 HOH 33 433 378 HOH HOH A . L 5 HOH 34 434 277 HOH HOH A . L 5 HOH 35 435 323 HOH HOH A . L 5 HOH 36 436 165 HOH HOH A . L 5 HOH 37 437 197 HOH HOH A . L 5 HOH 38 438 138 HOH HOH A . L 5 HOH 39 439 81 HOH HOH A . L 5 HOH 40 440 199 HOH HOH A . L 5 HOH 41 441 409 HOH HOH A . L 5 HOH 42 442 412 HOH HOH A . L 5 HOH 43 443 235 HOH HOH A . L 5 HOH 44 444 218 HOH HOH A . L 5 HOH 45 445 166 HOH HOH A . L 5 HOH 46 446 93 HOH HOH A . L 5 HOH 47 447 123 HOH HOH A . L 5 HOH 48 448 223 HOH HOH A . L 5 HOH 49 449 279 HOH HOH A . L 5 HOH 50 450 260 HOH HOH A . L 5 HOH 51 451 137 HOH HOH A . L 5 HOH 52 452 92 HOH HOH A . L 5 HOH 53 453 182 HOH HOH A . L 5 HOH 54 454 153 HOH HOH A . L 5 HOH 55 455 175 HOH HOH A . L 5 HOH 56 456 126 HOH HOH A . L 5 HOH 57 457 68 HOH HOH A . L 5 HOH 58 458 134 HOH HOH A . L 5 HOH 59 459 84 HOH HOH A . L 5 HOH 60 460 19 HOH HOH A . L 5 HOH 61 461 168 HOH HOH A . L 5 HOH 62 462 41 HOH HOH A . L 5 HOH 63 463 178 HOH HOH A . L 5 HOH 64 464 35 HOH HOH A . L 5 HOH 65 465 358 HOH HOH A . L 5 HOH 66 466 104 HOH HOH A . L 5 HOH 67 467 252 HOH HOH A . L 5 HOH 68 468 12 HOH HOH A . L 5 HOH 69 469 26 HOH HOH A . L 5 HOH 70 470 210 HOH HOH A . L 5 HOH 71 471 44 HOH HOH A . L 5 HOH 72 472 66 HOH HOH A . L 5 HOH 73 473 31 HOH HOH A . L 5 HOH 74 474 195 HOH HOH A . L 5 HOH 75 475 404 HOH HOH A . L 5 HOH 76 476 34 HOH HOH A . L 5 HOH 77 477 247 HOH HOH A . L 5 HOH 78 478 316 HOH HOH A . L 5 HOH 79 479 43 HOH HOH A . L 5 HOH 80 480 319 HOH HOH A . L 5 HOH 81 481 411 HOH HOH A . L 5 HOH 82 482 402 HOH HOH A . L 5 HOH 83 483 290 HOH HOH A . L 5 HOH 84 484 391 HOH HOH A . L 5 HOH 85 485 233 HOH HOH A . L 5 HOH 86 486 20 HOH HOH A . L 5 HOH 87 487 50 HOH HOH A . L 5 HOH 88 488 125 HOH HOH A . L 5 HOH 89 489 231 HOH HOH A . L 5 HOH 90 490 30 HOH HOH A . L 5 HOH 91 491 11 HOH HOH A . L 5 HOH 92 492 106 HOH HOH A . L 5 HOH 93 493 190 HOH HOH A . L 5 HOH 94 494 379 HOH HOH A . L 5 HOH 95 495 266 HOH HOH A . L 5 HOH 96 496 37 HOH HOH A . L 5 HOH 97 497 211 HOH HOH A . L 5 HOH 98 498 22 HOH HOH A . L 5 HOH 99 499 180 HOH HOH A . L 5 HOH 100 500 146 HOH HOH A . L 5 HOH 101 501 270 HOH HOH A . L 5 HOH 102 502 107 HOH HOH A . L 5 HOH 103 503 202 HOH HOH A . L 5 HOH 104 504 248 HOH HOH A . L 5 HOH 105 505 328 HOH HOH A . L 5 HOH 106 506 144 HOH HOH A . L 5 HOH 107 507 27 HOH HOH A . L 5 HOH 108 508 51 HOH HOH A . L 5 HOH 109 509 293 HOH HOH A . L 5 HOH 110 510 87 HOH HOH A . L 5 HOH 111 511 56 HOH HOH A . L 5 HOH 112 512 155 HOH HOH A . L 5 HOH 113 513 254 HOH HOH A . L 5 HOH 114 514 256 HOH HOH A . L 5 HOH 115 515 353 HOH HOH A . L 5 HOH 116 516 129 HOH HOH A . L 5 HOH 117 517 203 HOH HOH A . L 5 HOH 118 518 258 HOH HOH A . L 5 HOH 119 519 219 HOH HOH A . L 5 HOH 120 520 390 HOH HOH A . L 5 HOH 121 521 15 HOH HOH A . L 5 HOH 122 522 193 HOH HOH A . L 5 HOH 123 523 55 HOH HOH A . L 5 HOH 124 524 139 HOH HOH A . L 5 HOH 125 525 103 HOH HOH A . L 5 HOH 126 526 23 HOH HOH A . L 5 HOH 127 527 82 HOH HOH A . L 5 HOH 128 528 69 HOH HOH A . L 5 HOH 129 529 145 HOH HOH A . L 5 HOH 130 530 148 HOH HOH A . L 5 HOH 131 531 135 HOH HOH A . L 5 HOH 132 532 222 HOH HOH A . L 5 HOH 133 533 62 HOH HOH A . L 5 HOH 134 534 118 HOH HOH A . L 5 HOH 135 535 127 HOH HOH A . L 5 HOH 136 536 58 HOH HOH A . L 5 HOH 137 537 21 HOH HOH A . L 5 HOH 138 538 131 HOH HOH A . L 5 HOH 139 539 387 HOH HOH A . L 5 HOH 140 540 173 HOH HOH A . L 5 HOH 141 541 98 HOH HOH A . L 5 HOH 142 542 318 HOH HOH A . L 5 HOH 143 543 340 HOH HOH A . L 5 HOH 144 544 220 HOH HOH A . L 5 HOH 145 545 154 HOH HOH A . L 5 HOH 146 546 54 HOH HOH A . L 5 HOH 147 547 275 HOH HOH A . L 5 HOH 148 548 105 HOH HOH A . L 5 HOH 149 549 95 HOH HOH A . L 5 HOH 150 550 185 HOH HOH A . L 5 HOH 151 551 241 HOH HOH A . L 5 HOH 152 552 122 HOH HOH A . L 5 HOH 153 553 183 HOH HOH A . L 5 HOH 154 554 13 HOH HOH A . L 5 HOH 155 555 72 HOH HOH A . L 5 HOH 156 556 361 HOH HOH A . L 5 HOH 157 557 363 HOH HOH A . L 5 HOH 158 558 14 HOH HOH A . L 5 HOH 159 559 359 HOH HOH A . L 5 HOH 160 560 174 HOH HOH A . L 5 HOH 161 561 274 HOH HOH A . L 5 HOH 162 562 143 HOH HOH A . L 5 HOH 163 563 413 HOH HOH A . L 5 HOH 164 564 9 HOH HOH A . L 5 HOH 165 565 130 HOH HOH A . L 5 HOH 166 566 344 HOH HOH A . L 5 HOH 167 567 59 HOH HOH A . L 5 HOH 168 568 63 HOH HOH A . L 5 HOH 169 569 161 HOH HOH A . L 5 HOH 170 570 109 HOH HOH A . L 5 HOH 171 571 408 HOH HOH A . L 5 HOH 172 572 375 HOH HOH A . L 5 HOH 173 573 57 HOH HOH A . L 5 HOH 174 574 52 HOH HOH A . L 5 HOH 175 575 100 HOH HOH A . L 5 HOH 176 576 234 HOH HOH A . L 5 HOH 177 577 116 HOH HOH A . L 5 HOH 178 578 332 HOH HOH A . L 5 HOH 179 579 97 HOH HOH A . L 5 HOH 180 580 315 HOH HOH A . L 5 HOH 181 581 243 HOH HOH A . L 5 HOH 182 582 281 HOH HOH A . L 5 HOH 183 583 65 HOH HOH A . L 5 HOH 184 584 414 HOH HOH A . L 5 HOH 185 585 194 HOH HOH A . L 5 HOH 186 586 262 HOH HOH A . L 5 HOH 187 587 86 HOH HOH A . L 5 HOH 188 588 407 HOH HOH A . L 5 HOH 189 589 60 HOH HOH A . L 5 HOH 190 590 372 HOH HOH A . L 5 HOH 191 591 292 HOH HOH A . L 5 HOH 192 592 227 HOH HOH A . L 5 HOH 193 593 119 HOH HOH A . L 5 HOH 194 594 10 HOH HOH A . L 5 HOH 195 595 45 HOH HOH A . L 5 HOH 196 596 186 HOH HOH A . L 5 HOH 197 597 80 HOH HOH A . L 5 HOH 198 598 246 HOH HOH A . L 5 HOH 199 599 283 HOH HOH A . L 5 HOH 200 600 88 HOH HOH A . L 5 HOH 201 601 167 HOH HOH A . L 5 HOH 202 602 314 HOH HOH A . L 5 HOH 203 603 381 HOH HOH A . L 5 HOH 204 604 110 HOH HOH A . L 5 HOH 205 605 308 HOH HOH A . L 5 HOH 206 606 384 HOH HOH A . L 5 HOH 207 607 32 HOH HOH A . L 5 HOH 208 608 99 HOH HOH A . L 5 HOH 209 609 114 HOH HOH A . L 5 HOH 210 610 237 HOH HOH A . L 5 HOH 211 611 356 HOH HOH A . L 5 HOH 212 612 70 HOH HOH A . L 5 HOH 213 613 172 HOH HOH A . L 5 HOH 214 614 301 HOH HOH A . L 5 HOH 215 615 212 HOH HOH A . L 5 HOH 216 616 276 HOH HOH A . L 5 HOH 217 617 228 HOH HOH A . L 5 HOH 218 618 48 HOH HOH A . L 5 HOH 219 619 307 HOH HOH A . L 5 HOH 220 620 67 HOH HOH A . L 5 HOH 221 621 152 HOH HOH A . L 5 HOH 222 622 151 HOH HOH A . L 5 HOH 223 623 216 HOH HOH A . L 5 HOH 224 624 49 HOH HOH A . L 5 HOH 225 625 405 HOH HOH A . L 5 HOH 226 626 296 HOH HOH A . L 5 HOH 227 627 324 HOH HOH A . L 5 HOH 228 628 149 HOH HOH A . L 5 HOH 229 629 124 HOH HOH A . L 5 HOH 230 630 38 HOH HOH A . L 5 HOH 231 631 171 HOH HOH A . L 5 HOH 232 632 330 HOH HOH A . L 5 HOH 233 633 230 HOH HOH A . L 5 HOH 234 634 376 HOH HOH A . L 5 HOH 235 635 128 HOH HOH A . L 5 HOH 236 636 83 HOH HOH A . L 5 HOH 237 637 334 HOH HOH A . L 5 HOH 238 638 338 HOH HOH A . L 5 HOH 239 639 386 HOH HOH A . L 5 HOH 240 640 46 HOH HOH A . L 5 HOH 241 641 158 HOH HOH A . L 5 HOH 242 642 115 HOH HOH A . L 5 HOH 243 643 121 HOH HOH A . L 5 HOH 244 644 214 HOH HOH A . L 5 HOH 245 645 349 HOH HOH A . L 5 HOH 246 646 176 HOH HOH A . L 5 HOH 247 647 331 HOH HOH A . L 5 HOH 248 648 267 HOH HOH A . L 5 HOH 249 649 401 HOH HOH A . L 5 HOH 250 650 364 HOH HOH A . L 5 HOH 251 651 221 HOH HOH A . L 5 HOH 252 652 238 HOH HOH A . L 5 HOH 253 653 385 HOH HOH A . L 5 HOH 254 654 200 HOH HOH A . L 5 HOH 255 655 366 HOH HOH A . L 5 HOH 256 656 360 HOH HOH A . L 5 HOH 257 657 333 HOH HOH A . L 5 HOH 258 658 357 HOH HOH A . L 5 HOH 259 659 226 HOH HOH A . L 5 HOH 260 660 295 HOH HOH A . L 5 HOH 261 661 269 HOH HOH A . L 5 HOH 262 662 393 HOH HOH A . L 5 HOH 263 663 346 HOH HOH A . L 5 HOH 264 664 17 HOH HOH A . L 5 HOH 265 665 305 HOH HOH A . L 5 HOH 266 666 299 HOH HOH A . L 5 HOH 267 667 268 HOH HOH A . L 5 HOH 268 668 280 HOH HOH A . L 5 HOH 269 669 117 HOH HOH A . L 5 HOH 270 670 208 HOH HOH A . L 5 HOH 271 671 312 HOH HOH A . L 5 HOH 272 672 159 HOH HOH A . L 5 HOH 273 673 136 HOH HOH A . L 5 HOH 274 674 96 HOH HOH A . L 5 HOH 275 675 240 HOH HOH A . L 5 HOH 276 676 108 HOH HOH A . L 5 HOH 277 677 232 HOH HOH A . L 5 HOH 278 678 265 HOH HOH A . L 5 HOH 279 679 91 HOH HOH A . L 5 HOH 280 680 336 HOH HOH A . L 5 HOH 281 681 181 HOH HOH A . L 5 HOH 282 682 29 HOH HOH A . L 5 HOH 283 683 77 HOH HOH A . L 5 HOH 284 684 201 HOH HOH A . L 5 HOH 285 685 47 HOH HOH A . L 5 HOH 286 686 298 HOH HOH A . L 5 HOH 287 687 380 HOH HOH A . L 5 HOH 288 688 184 HOH HOH A . L 5 HOH 289 689 170 HOH HOH A . L 5 HOH 290 690 339 HOH HOH A . L 5 HOH 291 691 249 HOH HOH A . L 5 HOH 292 692 90 HOH HOH A . L 5 HOH 293 693 285 HOH HOH A . L 5 HOH 294 694 120 HOH HOH A . L 5 HOH 295 695 132 HOH HOH A . L 5 HOH 296 696 329 HOH HOH A . L 5 HOH 297 697 351 HOH HOH A . L 5 HOH 298 698 261 HOH HOH A . L 5 HOH 299 699 303 HOH HOH A . L 5 HOH 300 700 147 HOH HOH A . L 5 HOH 301 701 207 HOH HOH A . L 5 HOH 302 702 306 HOH HOH A . L 5 HOH 303 703 350 HOH HOH A . L 5 HOH 304 704 204 HOH HOH A . L 5 HOH 305 705 309 HOH HOH A . L 5 HOH 306 706 289 HOH HOH A . L 5 HOH 307 707 192 HOH HOH A . L 5 HOH 308 708 18 HOH HOH A . L 5 HOH 309 709 388 HOH HOH A . L 5 HOH 310 710 244 HOH HOH A . L 5 HOH 311 711 196 HOH HOH A . L 5 HOH 312 712 337 HOH HOH A . L 5 HOH 313 713 259 HOH HOH A . L 5 HOH 314 714 53 HOH HOH A . L 5 HOH 315 715 304 HOH HOH A . L 5 HOH 316 716 236 HOH HOH A . L 5 HOH 317 717 341 HOH HOH A . L 5 HOH 318 718 36 HOH HOH A . L 5 HOH 319 719 343 HOH HOH A . L 5 HOH 320 720 355 HOH HOH A . L 5 HOH 321 721 342 HOH HOH A . L 5 HOH 322 722 191 HOH HOH A . L 5 HOH 323 723 263 HOH HOH A . L 5 HOH 324 724 310 HOH HOH A . L 5 HOH 325 725 288 HOH HOH A . L 5 HOH 326 726 33 HOH HOH A . L 5 HOH 327 727 141 HOH HOH A . L 5 HOH 328 728 102 HOH HOH A . L 5 HOH 329 729 73 HOH HOH A . L 5 HOH 330 730 24 HOH HOH A . L 5 HOH 331 731 140 HOH HOH A . L 5 HOH 332 732 365 HOH HOH A . L 5 HOH 333 733 225 HOH HOH A . L 5 HOH 334 734 111 HOH HOH A . L 5 HOH 335 735 286 HOH HOH A . L 5 HOH 336 736 294 HOH HOH A . L 5 HOH 337 737 177 HOH HOH A . L 5 HOH 338 738 162 HOH HOH A . L 5 HOH 339 739 389 HOH HOH A . L 5 HOH 340 740 362 HOH HOH A . L 5 HOH 341 741 75 HOH HOH A . L 5 HOH 342 742 74 HOH HOH A . L 5 HOH 343 743 28 HOH HOH A . L 5 HOH 344 744 327 HOH HOH A . L 5 HOH 345 745 322 HOH HOH A . L 5 HOH 346 746 403 HOH HOH A . L 5 HOH 347 747 205 HOH HOH A . L 5 HOH 348 748 239 HOH HOH A . L 5 HOH 349 749 369 HOH HOH A . L 5 HOH 350 750 25 HOH HOH A . L 5 HOH 351 751 257 HOH HOH A . L 5 HOH 352 752 374 HOH HOH A . L 5 HOH 353 753 71 HOH HOH A . L 5 HOH 354 754 253 HOH HOH A . L 5 HOH 355 755 373 HOH HOH A . L 5 HOH 356 756 250 HOH HOH A . L 5 HOH 357 757 347 HOH HOH A . L 5 HOH 358 758 348 HOH HOH A . L 5 HOH 359 759 209 HOH HOH A . L 5 HOH 360 760 291 HOH HOH A . L 5 HOH 361 761 242 HOH HOH A . L 5 HOH 362 762 370 HOH HOH A . L 5 HOH 363 763 273 HOH HOH A . L 5 HOH 364 764 282 HOH HOH A . L 5 HOH 365 765 325 HOH HOH A . L 5 HOH 366 766 302 HOH HOH A . L 5 HOH 367 767 224 HOH HOH A . L 5 HOH 368 768 255 HOH HOH A . L 5 HOH 369 769 392 HOH HOH A . L 5 HOH 370 770 415 HOH HOH A . L 5 HOH 371 771 39 HOH HOH A . L 5 HOH 372 772 113 HOH HOH A . L 5 HOH 373 773 179 HOH HOH A . L 5 HOH 374 774 377 HOH HOH A . L 5 HOH 375 775 85 HOH HOH A . L 5 HOH 376 776 187 HOH HOH A . L 5 HOH 377 777 198 HOH HOH A . L 5 HOH 378 778 245 HOH HOH A . L 5 HOH 379 779 317 HOH HOH A . L 5 HOH 380 780 311 HOH HOH A . L 5 HOH 381 781 150 HOH HOH A . L 5 HOH 382 782 313 HOH HOH A . L 5 HOH 383 783 367 HOH HOH A . L 5 HOH 384 784 352 HOH HOH A . L 5 HOH 385 785 217 HOH HOH A . L 5 HOH 386 786 399 HOH HOH A . L 5 HOH 387 787 398 HOH HOH A . L 5 HOH 388 788 335 HOH HOH A . L 5 HOH 389 789 397 HOH HOH A . L 5 HOH 390 790 101 HOH HOH A . L 5 HOH 391 791 326 HOH HOH A . L 5 HOH 392 792 354 HOH HOH A . L 5 HOH 393 793 382 HOH HOH A . L 5 HOH 394 794 169 HOH HOH A . L 5 HOH 395 795 206 HOH HOH A . L 5 HOH 396 796 160 HOH HOH A . L 5 HOH 397 797 321 HOH HOH A . L 5 HOH 398 798 133 HOH HOH A . L 5 HOH 399 799 272 HOH HOH A . L 5 HOH 400 800 383 HOH HOH A . L 5 HOH 401 801 400 HOH HOH A . L 5 HOH 402 802 368 HOH HOH A . L 5 HOH 403 803 396 HOH HOH A . L 5 HOH 404 804 64 HOH HOH A . L 5 HOH 405 805 394 HOH HOH A . L 5 HOH 406 806 79 HOH HOH A . L 5 HOH 407 807 395 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 6 ? CG ? A LYS 6 CG 2 1 Y 1 A LYS 6 ? CD ? A LYS 6 CD 3 1 Y 1 A LYS 6 ? CE ? A LYS 6 CE 4 1 Y 1 A LYS 6 ? NZ ? A LYS 6 NZ 5 1 Y 1 A LYS 9 ? CG ? A LYS 9 CG 6 1 Y 1 A LYS 9 ? CD ? A LYS 9 CD 7 1 Y 1 A LYS 9 ? CE ? A LYS 9 CE 8 1 Y 1 A LYS 9 ? NZ ? A LYS 9 NZ 9 1 Y 1 A ARG 68 ? CG ? A ARG 68 CG 10 1 Y 1 A ARG 68 ? CD ? A ARG 68 CD 11 1 Y 1 A ARG 68 ? NE ? A ARG 68 NE 12 1 Y 1 A ARG 68 ? CZ ? A ARG 68 CZ 13 1 Y 1 A ARG 68 ? NH1 ? A ARG 68 NH1 14 1 Y 1 A ARG 68 ? NH2 ? A ARG 68 NH2 15 1 Y 1 A GLU 137 ? CG ? A GLU 137 CG 16 1 Y 1 A GLU 137 ? CD ? A GLU 137 CD 17 1 Y 1 A GLU 137 ? OE1 ? A GLU 137 OE1 18 1 Y 1 A GLU 137 ? OE2 ? A GLU 137 OE2 19 1 Y 1 A LYS 191 ? CG ? A LYS 191 CG 20 1 Y 1 A LYS 191 ? CD ? A LYS 191 CD 21 1 Y 1 A LYS 191 ? CE ? A LYS 191 CE 22 1 Y 1 A LYS 191 ? NZ ? A LYS 191 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0135 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? FRODO ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5JF6 _cell.details ? _cell.formula_units_Z ? _cell.length_a 40.920 _cell.length_a_esd ? _cell.length_b 66.280 _cell.length_b_esd ? _cell.length_c 88.290 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5JF6 _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5JF6 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.63 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 53.23 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '7% PEG-8000, 100mM imidazole pH7.0, 100mM Zn acetate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 4r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2008-02-23 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.934 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID14-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.934 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID14-1 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5JF6 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.70 _reflns.d_resolution_low 50.00 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 26790 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F 2.0 _reflns.observed_criterion_sigma_I 2.0 _reflns.percent_possible_obs 98.5 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.20 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.056 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 23.48 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.70 _reflns_shell.d_res_low 1.80 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 8.73 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 97.3 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.214 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 7.23 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 0.80 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] -0.12 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] -0.67 _refine.B_iso_max ? _refine.B_iso_mean 13.713 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.963 _refine.correlation_coeff_Fo_to_Fc_free 0.951 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5JF6 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.70 _refine.ls_d_res_low 44.15 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 25417 _refine.ls_number_reflns_R_free 1338 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.64 _refine.ls_percent_reflns_R_free 5.0 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.14531 _refine.ls_R_factor_R_free 0.17507 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.14372 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2aie _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.085 _refine.pdbx_overall_ESU_R_Free 0.085 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 2.371 _refine.overall_SU_ML 0.049 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1575 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 27 _refine_hist.number_atoms_solvent 407 _refine_hist.number_atoms_total 2009 _refine_hist.d_res_high 1.70 _refine_hist.d_res_low 44.15 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.034 0.019 1620 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.003 0.020 1574 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 2.613 1.992 2192 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.281 3.001 3617 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.372 5.000 202 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 32.364 25.278 72 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 11.822 15.000 286 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 20.885 15.000 8 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.389 0.200 248 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.017 0.021 1819 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 333 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 1.129 1.079 812 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 1.128 1.077 810 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 1.619 1.613 1012 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 1.620 1.616 1013 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 2.443 1.305 808 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 2.444 1.305 807 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 3.520 1.870 1180 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 7.213 12.154 2178 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 6.267 9.886 1893 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.700 _refine_ls_shell.d_res_low 1.744 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 96 _refine_ls_shell.number_reflns_R_work 1826 _refine_ls_shell.percent_reflns_obs 99.17 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.206 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.151 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5JF6 _struct.title 'Crystal structure of type 2 PDF from Streptococcus agalactiae in complex with inhibitor 6b (AB47)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5JF6 _struct_keywords.text 'PDF, type 2, NME, N-terminal methionine excision, Streptococcus agalactiae, inhibitor, 6b, AB47, Hydrolase' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 4 ? G N N 4 ? H N N 4 ? I N N 4 ? J N N 4 ? K N N 4 ? L N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DEF_STRA3 _struct_ref.pdbx_db_accession Q8E378 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSAIDKLVKASHLIDMNDIIREGNPTLRKVAEEVTFPLSEKEEILGEKMMQFLKHSQDPIMAEKLGLRGGVGLAAPQLDI SKRIIAVLVPNVEDAQGNPPKEAYSLQEVMYNPKVVSHSVQDAALSDGEGCLSVDREVPGYVVRHARVTIEYFDKTGEKH RLKLKGYNSIVVQHEIDHIDGIMFYDRINEKNPFAVKEGLLILE ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5JF6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 204 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8E378 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 204 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 204 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 5JF6 _struct_ref_seq_dif.mon_id ALA _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 2 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q8E378 _struct_ref_seq_dif.db_mon_id SER _struct_ref_seq_dif.pdbx_seq_db_seq_num 2 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 2 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 860 ? 1 MORE -167 ? 1 'SSA (A^2)' 10640 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K,L # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 2 ? LYS A 9 ? ALA A 2 LYS A 9 1 ? 8 HELX_P HELX_P2 AA2 ASP A 15 ? ILE A 19 ? ASP A 15 ILE A 19 5 ? 5 HELX_P HELX_P3 AA3 ASN A 24 ? LYS A 29 ? ASN A 24 LYS A 29 5 ? 6 HELX_P HELX_P4 AA4 SER A 39 ? GLN A 57 ? SER A 39 GLN A 57 1 ? 19 HELX_P HELX_P5 AA5 ASP A 58 ? GLY A 66 ? ASP A 58 GLY A 66 1 ? 9 HELX_P HELX_P6 AA6 PRO A 76 ? ASP A 79 ? PRO A 76 ASP A 79 5 ? 4 HELX_P HELX_P7 AA7 LYS A 165 ? ASP A 180 ? LYS A 165 ASP A 180 1 ? 16 HELX_P HELX_P8 AA8 MET A 183 ? ILE A 188 ? MET A 183 ILE A 188 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A GLY 130 C ? ? ? 1_555 A OCS 131 N ? ? A GLY 130 A OCS 131 1_555 ? ? ? ? ? ? ? 1.320 ? ? covale2 covale both ? A OCS 131 C ? ? ? 1_555 A LEU 132 N ? ? A OCS 131 A LEU 132 1_555 ? ? ? ? ? ? ? 1.373 ? ? metalc1 metalc ? ? A HIS 12 NE2 ? ? ? 1_555 I ZN . ZN ? ? A HIS 12 A ZN 308 1_555 ? ? ? ? ? ? ? 2.087 ? ? metalc2 metalc ? ? A ASP 18 OD1 ? ? ? 1_555 I ZN . ZN ? ? A ASP 18 A ZN 308 1_555 ? ? ? ? ? ? ? 2.228 ? ? metalc3 metalc ? ? A ASP 18 OD2 ? ? ? 1_555 I ZN . ZN ? ? A ASP 18 A ZN 308 1_555 ? ? ? ? ? ? ? 2.268 ? ? metalc4 metalc ? ? A GLU 43 OE2 ? ? ? 1_555 J ZN . ZN ? ? A GLU 43 A ZN 309 1_555 ? ? ? ? ? ? ? 2.154 ? ? metalc5 metalc ? ? A GLU 47 OE2 ? ? ? 1_555 J ZN . ZN ? ? A GLU 47 A ZN 309 1_555 ? ? ? ? ? ? ? 2.065 ? ? metalc6 metalc ? ? A HIS 55 NE2 ? ? ? 1_555 E ZN . ZN ? ? A HIS 55 A ZN 304 1_555 ? ? ? ? ? ? ? 2.108 ? ? metalc7 metalc ? ? A ASP 94 OD2 ? ? ? 1_555 G ZN . ZN ? ? A ASP 94 A ZN 306 1_455 ? ? ? ? ? ? ? 1.968 ? ? metalc8 metalc ? ? A GLU 102 OE1 ? ? ? 1_555 K ZN . ZN ? ? A GLU 102 A ZN 310 4_445 ? ? ? ? ? ? ? 1.984 ? ? metalc9 metalc ? ? A HIS 118 NE2 ? ? ? 1_555 F ZN . ZN ? ? A HIS 118 A ZN 305 1_555 ? ? ? ? ? ? ? 2.052 ? ? metalc10 metalc ? ? A OCS 131 OD3 ? ? ? 1_555 D ZN . ZN ? ? A OCS 131 A ZN 303 1_555 ? ? ? ? ? ? ? 1.979 ? ? metalc11 metalc ? ? A HIS 145 NE2 ? ? ? 1_555 H ZN . ZN ? ? A HIS 145 A ZN 307 1_555 ? ? ? ? ? ? ? 2.044 ? ? metalc12 metalc ? ? A GLU 151 OE2 ? ? ? 1_555 K ZN . ZN ? ? A GLU 151 A ZN 310 1_555 ? ? ? ? ? ? ? 2.081 ? ? metalc13 metalc ? ? A GLU 158 OE2 ? ? ? 1_555 H ZN . ZN ? ? A GLU 158 A ZN 307 4_445 ? ? ? ? ? ? ? 1.931 ? ? metalc14 metalc ? ? A HIS 174 NE2 ? ? ? 1_555 D ZN . ZN ? ? A HIS 174 A ZN 303 1_555 ? ? ? ? ? ? ? 2.084 ? ? metalc15 metalc ? ? A HIS 178 NE2 ? ? ? 1_555 D ZN . ZN ? ? A HIS 178 A ZN 303 1_555 ? ? ? ? ? ? ? 2.089 ? ? metalc16 metalc ? ? A GLU 190 OE2 ? ? ? 1_555 G ZN . ZN ? ? A GLU 190 A ZN 306 1_555 ? ? ? ? ? ? ? 1.891 ? ? metalc17 metalc ? ? A GLU 198 OE1 ? ? ? 1_555 E ZN . ZN ? ? A GLU 198 A ZN 304 2_454 ? ? ? ? ? ? ? 2.128 ? ? metalc18 metalc ? ? A GLU 198 OE2 ? ? ? 1_555 E ZN . ZN ? ? A GLU 198 A ZN 304 2_454 ? ? ? ? ? ? ? 2.458 ? ? metalc19 metalc ? ? B BB4 . N1 ? ? ? 1_555 D ZN . ZN ? ? A BB4 301 A ZN 303 1_555 ? ? ? ? ? ? ? 2.695 ? ? metalc20 metalc ? ? B BB4 . O2 ? ? ? 1_555 D ZN . ZN ? ? A BB4 301 A ZN 303 1_555 ? ? ? ? ? ? ? 2.166 ? ? metalc21 metalc ? ? B BB4 . O14 ? ? ? 1_555 D ZN . ZN ? ? A BB4 301 A ZN 303 1_555 ? ? ? ? ? ? ? 1.982 ? ? metalc22 metalc ? ? C ACT . O ? ? ? 1_555 H ZN . ZN ? ? A ACT 302 A ZN 307 1_555 ? ? ? ? ? ? ? 2.036 ? ? metalc23 metalc ? ? F ZN . ZN ? ? ? 1_555 L HOH . O ? ? A ZN 305 A HOH 414 4_545 ? ? ? ? ? ? ? 1.999 ? ? metalc24 metalc ? ? F ZN . ZN ? ? ? 1_555 L HOH . O ? ? A ZN 305 A HOH 632 1_555 ? ? ? ? ? ? ? 2.078 ? ? metalc25 metalc ? ? F ZN . ZN ? ? ? 1_555 L HOH . O ? ? A ZN 305 A HOH 648 1_555 ? ? ? ? ? ? ? 2.198 ? ? metalc26 metalc ? ? F ZN . ZN ? ? ? 1_555 L HOH . O ? ? A ZN 305 A HOH 661 4_545 ? ? ? ? ? ? ? 2.557 ? ? metalc27 metalc ? ? F ZN . ZN ? ? ? 1_555 L HOH . O ? ? A ZN 305 A HOH 667 1_555 ? ? ? ? ? ? ? 2.113 ? ? metalc28 metalc ? ? G ZN . ZN ? ? ? 1_555 L HOH . O ? ? A ZN 306 A HOH 439 1_555 ? ? ? ? ? ? ? 2.037 ? ? metalc29 metalc ? ? G ZN . ZN ? ? ? 1_555 L HOH . O ? ? A ZN 306 A HOH 527 1_555 ? ? ? ? ? ? ? 2.135 ? ? metalc30 metalc ? ? G ZN . ZN ? ? ? 1_555 L HOH . O ? ? A ZN 306 A HOH 597 1_655 ? ? ? ? ? ? ? 2.144 ? ? metalc31 metalc ? ? H ZN . ZN ? ? ? 1_555 L HOH . O ? ? A ZN 307 A HOH 647 1_555 ? ? ? ? ? ? ? 2.076 ? ? metalc32 metalc ? ? I ZN . ZN ? ? ? 1_555 L HOH . O ? ? A ZN 308 A HOH 412 1_555 ? ? ? ? ? ? ? 2.073 ? ? metalc33 metalc ? ? I ZN . ZN ? ? ? 1_555 L HOH . O ? ? A ZN 308 A HOH 493 1_555 ? ? ? ? ? ? ? 2.097 ? ? metalc34 metalc ? ? J ZN . ZN ? ? ? 1_555 L HOH . O ? ? A ZN 309 A HOH 441 1_555 ? ? ? ? ? ? ? 2.097 ? ? metalc35 metalc ? ? J ZN . ZN ? ? ? 1_555 L HOH . O ? ? A ZN 309 A HOH 578 1_555 ? ? ? ? ? ? ? 2.055 ? ? metalc36 metalc ? ? J ZN . ZN ? ? ? 1_555 L HOH . O ? ? A ZN 309 A HOH 606 1_555 ? ? ? ? ? ? ? 2.246 ? ? metalc37 metalc ? ? K ZN . ZN ? ? ? 1_555 L HOH . O ? ? A ZN 310 A HOH 653 4_545 ? ? ? ? ? ? ? 2.028 ? ? metalc38 metalc ? ? K ZN . ZN ? ? ? 1_555 L HOH . O ? ? A ZN 310 A HOH 657 4_545 ? ? ? ? ? ? ? 2.061 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 12 ? A HIS 12 ? 1_555 ZN ? I ZN . ? A ZN 308 ? 1_555 OD1 ? A ASP 18 ? A ASP 18 ? 1_555 97.9 ? 2 NE2 ? A HIS 12 ? A HIS 12 ? 1_555 ZN ? I ZN . ? A ZN 308 ? 1_555 OD2 ? A ASP 18 ? A ASP 18 ? 1_555 108.5 ? 3 OD1 ? A ASP 18 ? A ASP 18 ? 1_555 ZN ? I ZN . ? A ZN 308 ? 1_555 OD2 ? A ASP 18 ? A ASP 18 ? 1_555 57.4 ? 4 NE2 ? A HIS 12 ? A HIS 12 ? 1_555 ZN ? I ZN . ? A ZN 308 ? 1_555 O ? L HOH . ? A HOH 412 ? 1_555 158.5 ? 5 OD1 ? A ASP 18 ? A ASP 18 ? 1_555 ZN ? I ZN . ? A ZN 308 ? 1_555 O ? L HOH . ? A HOH 412 ? 1_555 93.1 ? 6 OD2 ? A ASP 18 ? A ASP 18 ? 1_555 ZN ? I ZN . ? A ZN 308 ? 1_555 O ? L HOH . ? A HOH 412 ? 1_555 93.1 ? 7 NE2 ? A HIS 12 ? A HIS 12 ? 1_555 ZN ? I ZN . ? A ZN 308 ? 1_555 O ? L HOH . ? A HOH 493 ? 1_555 81.7 ? 8 OD1 ? A ASP 18 ? A ASP 18 ? 1_555 ZN ? I ZN . ? A ZN 308 ? 1_555 O ? L HOH . ? A HOH 493 ? 1_555 165.1 ? 9 OD2 ? A ASP 18 ? A ASP 18 ? 1_555 ZN ? I ZN . ? A ZN 308 ? 1_555 O ? L HOH . ? A HOH 493 ? 1_555 136.9 ? 10 O ? L HOH . ? A HOH 412 ? 1_555 ZN ? I ZN . ? A ZN 308 ? 1_555 O ? L HOH . ? A HOH 493 ? 1_555 83.0 ? 11 OE2 ? A GLU 43 ? A GLU 43 ? 1_555 ZN ? J ZN . ? A ZN 309 ? 1_555 OE2 ? A GLU 47 ? A GLU 47 ? 1_555 97.3 ? 12 OE2 ? A GLU 43 ? A GLU 43 ? 1_555 ZN ? J ZN . ? A ZN 309 ? 1_555 O ? L HOH . ? A HOH 441 ? 1_555 95.1 ? 13 OE2 ? A GLU 47 ? A GLU 47 ? 1_555 ZN ? J ZN . ? A ZN 309 ? 1_555 O ? L HOH . ? A HOH 441 ? 1_555 94.7 ? 14 OE2 ? A GLU 43 ? A GLU 43 ? 1_555 ZN ? J ZN . ? A ZN 309 ? 1_555 O ? L HOH . ? A HOH 578 ? 1_555 161.3 ? 15 OE2 ? A GLU 47 ? A GLU 47 ? 1_555 ZN ? J ZN . ? A ZN 309 ? 1_555 O ? L HOH . ? A HOH 578 ? 1_555 89.9 ? 16 O ? L HOH . ? A HOH 441 ? 1_555 ZN ? J ZN . ? A ZN 309 ? 1_555 O ? L HOH . ? A HOH 578 ? 1_555 101.6 ? 17 OE2 ? A GLU 43 ? A GLU 43 ? 1_555 ZN ? J ZN . ? A ZN 309 ? 1_555 O ? L HOH . ? A HOH 606 ? 1_555 84.2 ? 18 OE2 ? A GLU 47 ? A GLU 47 ? 1_555 ZN ? J ZN . ? A ZN 309 ? 1_555 O ? L HOH . ? A HOH 606 ? 1_555 174.6 ? 19 O ? L HOH . ? A HOH 441 ? 1_555 ZN ? J ZN . ? A ZN 309 ? 1_555 O ? L HOH . ? A HOH 606 ? 1_555 90.4 ? 20 O ? L HOH . ? A HOH 578 ? 1_555 ZN ? J ZN . ? A ZN 309 ? 1_555 O ? L HOH . ? A HOH 606 ? 1_555 87.2 ? 21 NE2 ? A HIS 55 ? A HIS 55 ? 1_555 ZN ? E ZN . ? A ZN 304 ? 1_555 OE1 ? A GLU 198 ? A GLU 198 ? 1_555 48.8 ? 22 NE2 ? A HIS 55 ? A HIS 55 ? 1_555 ZN ? E ZN . ? A ZN 304 ? 1_555 OE2 ? A GLU 198 ? A GLU 198 ? 1_555 49.7 ? 23 OE1 ? A GLU 198 ? A GLU 198 ? 1_555 ZN ? E ZN . ? A ZN 304 ? 1_555 OE2 ? A GLU 198 ? A GLU 198 ? 1_555 2.7 ? 24 OD2 ? A ASP 94 ? A ASP 94 ? 1_555 ZN ? G ZN . ? A ZN 306 ? 1_455 OE2 ? A GLU 190 ? A GLU 190 ? 1_555 90.7 ? 25 OD2 ? A ASP 94 ? A ASP 94 ? 1_555 ZN ? G ZN . ? A ZN 306 ? 1_455 O ? L HOH . ? A HOH 439 ? 1_555 90.8 ? 26 OE2 ? A GLU 190 ? A GLU 190 ? 1_555 ZN ? G ZN . ? A ZN 306 ? 1_455 O ? L HOH . ? A HOH 439 ? 1_555 4.1 ? 27 OD2 ? A ASP 94 ? A ASP 94 ? 1_555 ZN ? G ZN . ? A ZN 306 ? 1_455 O ? L HOH . ? A HOH 527 ? 1_555 89.9 ? 28 OE2 ? A GLU 190 ? A GLU 190 ? 1_555 ZN ? G ZN . ? A ZN 306 ? 1_455 O ? L HOH . ? A HOH 527 ? 1_555 0.8 ? 29 O ? L HOH . ? A HOH 439 ? 1_555 ZN ? G ZN . ? A ZN 306 ? 1_455 O ? L HOH . ? A HOH 527 ? 1_555 3.9 ? 30 OD2 ? A ASP 94 ? A ASP 94 ? 1_555 ZN ? G ZN . ? A ZN 306 ? 1_455 O ? L HOH . ? A HOH 597 ? 1_655 90.0 ? 31 OE2 ? A GLU 190 ? A GLU 190 ? 1_555 ZN ? G ZN . ? A ZN 306 ? 1_455 O ? L HOH . ? A HOH 597 ? 1_655 4.1 ? 32 O ? L HOH . ? A HOH 439 ? 1_555 ZN ? G ZN . ? A ZN 306 ? 1_455 O ? L HOH . ? A HOH 597 ? 1_655 0.8 ? 33 O ? L HOH . ? A HOH 527 ? 1_555 ZN ? G ZN . ? A ZN 306 ? 1_455 O ? L HOH . ? A HOH 597 ? 1_655 3.8 ? 34 OE1 ? A GLU 102 ? A GLU 102 ? 1_555 ZN ? K ZN . ? A ZN 310 ? 4_445 OE2 ? A GLU 151 ? A GLU 151 ? 1_555 85.2 ? 35 OE1 ? A GLU 102 ? A GLU 102 ? 1_555 ZN ? K ZN . ? A ZN 310 ? 4_445 O ? L HOH . ? A HOH 653 ? 4_545 82.4 ? 36 OE2 ? A GLU 151 ? A GLU 151 ? 1_555 ZN ? K ZN . ? A ZN 310 ? 4_445 O ? L HOH . ? A HOH 653 ? 4_545 2.9 ? 37 OE1 ? A GLU 102 ? A GLU 102 ? 1_555 ZN ? K ZN . ? A ZN 310 ? 4_445 O ? L HOH . ? A HOH 657 ? 4_545 86.4 ? 38 OE2 ? A GLU 151 ? A GLU 151 ? 1_555 ZN ? K ZN . ? A ZN 310 ? 4_445 O ? L HOH . ? A HOH 657 ? 4_545 6.2 ? 39 O ? L HOH . ? A HOH 653 ? 4_545 ZN ? K ZN . ? A ZN 310 ? 4_445 O ? L HOH . ? A HOH 657 ? 4_545 6.8 ? 40 NE2 ? A HIS 118 ? A HIS 118 ? 1_555 ZN ? F ZN . ? A ZN 305 ? 1_555 O ? L HOH . ? A HOH 414 ? 4_545 103.0 ? 41 NE2 ? A HIS 118 ? A HIS 118 ? 1_555 ZN ? F ZN . ? A ZN 305 ? 1_555 O ? L HOH . ? A HOH 632 ? 1_555 95.6 ? 42 O ? L HOH . ? A HOH 414 ? 4_545 ZN ? F ZN . ? A ZN 305 ? 1_555 O ? L HOH . ? A HOH 632 ? 1_555 94.4 ? 43 NE2 ? A HIS 118 ? A HIS 118 ? 1_555 ZN ? F ZN . ? A ZN 305 ? 1_555 O ? L HOH . ? A HOH 648 ? 1_555 95.2 ? 44 O ? L HOH . ? A HOH 414 ? 4_545 ZN ? F ZN . ? A ZN 305 ? 1_555 O ? L HOH . ? A HOH 648 ? 1_555 148.6 ? 45 O ? L HOH . ? A HOH 632 ? 1_555 ZN ? F ZN . ? A ZN 305 ? 1_555 O ? L HOH . ? A HOH 648 ? 1_555 58.2 ? 46 NE2 ? A HIS 118 ? A HIS 118 ? 1_555 ZN ? F ZN . ? A ZN 305 ? 1_555 O ? L HOH . ? A HOH 661 ? 4_545 150.6 ? 47 O ? L HOH . ? A HOH 414 ? 4_545 ZN ? F ZN . ? A ZN 305 ? 1_555 O ? L HOH . ? A HOH 661 ? 4_545 92.0 ? 48 O ? L HOH . ? A HOH 632 ? 1_555 ZN ? F ZN . ? A ZN 305 ? 1_555 O ? L HOH . ? A HOH 661 ? 4_545 108.5 ? 49 O ? L HOH . ? A HOH 648 ? 1_555 ZN ? F ZN . ? A ZN 305 ? 1_555 O ? L HOH . ? A HOH 661 ? 4_545 83.9 ? 50 NE2 ? A HIS 118 ? A HIS 118 ? 1_555 ZN ? F ZN . ? A ZN 305 ? 1_555 O ? L HOH . ? A HOH 667 ? 1_555 106.3 ? 51 O ? L HOH . ? A HOH 414 ? 4_545 ZN ? F ZN . ? A ZN 305 ? 1_555 O ? L HOH . ? A HOH 667 ? 1_555 99.6 ? 52 O ? L HOH . ? A HOH 632 ? 1_555 ZN ? F ZN . ? A ZN 305 ? 1_555 O ? L HOH . ? A HOH 667 ? 1_555 150.5 ? 53 O ? L HOH . ? A HOH 648 ? 1_555 ZN ? F ZN . ? A ZN 305 ? 1_555 O ? L HOH . ? A HOH 667 ? 1_555 99.5 ? 54 O ? L HOH . ? A HOH 661 ? 4_545 ZN ? F ZN . ? A ZN 305 ? 1_555 O ? L HOH . ? A HOH 667 ? 1_555 45.6 ? 55 OD3 ? A OCS 131 ? A OCS 131 ? 1_555 ZN ? D ZN . ? A ZN 303 ? 1_555 NE2 ? A HIS 174 ? A HIS 174 ? 1_555 96.6 ? 56 OD3 ? A OCS 131 ? A OCS 131 ? 1_555 ZN ? D ZN . ? A ZN 303 ? 1_555 NE2 ? A HIS 178 ? A HIS 178 ? 1_555 93.9 ? 57 NE2 ? A HIS 174 ? A HIS 174 ? 1_555 ZN ? D ZN . ? A ZN 303 ? 1_555 NE2 ? A HIS 178 ? A HIS 178 ? 1_555 109.9 ? 58 OD3 ? A OCS 131 ? A OCS 131 ? 1_555 ZN ? D ZN . ? A ZN 303 ? 1_555 N1 ? B BB4 . ? A BB4 301 ? 1_555 139.4 ? 59 NE2 ? A HIS 174 ? A HIS 174 ? 1_555 ZN ? D ZN . ? A ZN 303 ? 1_555 N1 ? B BB4 . ? A BB4 301 ? 1_555 89.1 ? 60 NE2 ? A HIS 178 ? A HIS 178 ? 1_555 ZN ? D ZN . ? A ZN 303 ? 1_555 N1 ? B BB4 . ? A BB4 301 ? 1_555 121.8 ? 61 OD3 ? A OCS 131 ? A OCS 131 ? 1_555 ZN ? D ZN . ? A ZN 303 ? 1_555 O2 ? B BB4 . ? A BB4 301 ? 1_555 85.1 ? 62 NE2 ? A HIS 174 ? A HIS 174 ? 1_555 ZN ? D ZN . ? A ZN 303 ? 1_555 O2 ? B BB4 . ? A BB4 301 ? 1_555 108.5 ? 63 NE2 ? A HIS 178 ? A HIS 178 ? 1_555 ZN ? D ZN . ? A ZN 303 ? 1_555 O2 ? B BB4 . ? A BB4 301 ? 1_555 141.4 ? 64 N1 ? B BB4 . ? A BB4 301 ? 1_555 ZN ? D ZN . ? A ZN 303 ? 1_555 O2 ? B BB4 . ? A BB4 301 ? 1_555 55.3 ? 65 OD3 ? A OCS 131 ? A OCS 131 ? 1_555 ZN ? D ZN . ? A ZN 303 ? 1_555 O14 ? B BB4 . ? A BB4 301 ? 1_555 158.6 ? 66 NE2 ? A HIS 174 ? A HIS 174 ? 1_555 ZN ? D ZN . ? A ZN 303 ? 1_555 O14 ? B BB4 . ? A BB4 301 ? 1_555 99.4 ? 67 NE2 ? A HIS 178 ? A HIS 178 ? 1_555 ZN ? D ZN . ? A ZN 303 ? 1_555 O14 ? B BB4 . ? A BB4 301 ? 1_555 93.9 ? 68 N1 ? B BB4 . ? A BB4 301 ? 1_555 ZN ? D ZN . ? A ZN 303 ? 1_555 O14 ? B BB4 . ? A BB4 301 ? 1_555 27.9 ? 69 O2 ? B BB4 . ? A BB4 301 ? 1_555 ZN ? D ZN . ? A ZN 303 ? 1_555 O14 ? B BB4 . ? A BB4 301 ? 1_555 76.5 ? 70 NE2 ? A HIS 145 ? A HIS 145 ? 1_555 ZN ? H ZN . ? A ZN 307 ? 1_555 OE2 ? A GLU 158 ? A GLU 158 ? 1_555 91.9 ? 71 NE2 ? A HIS 145 ? A HIS 145 ? 1_555 ZN ? H ZN . ? A ZN 307 ? 1_555 O ? C ACT . ? A ACT 302 ? 1_555 109.7 ? 72 OE2 ? A GLU 158 ? A GLU 158 ? 1_555 ZN ? H ZN . ? A ZN 307 ? 1_555 O ? C ACT . ? A ACT 302 ? 1_555 58.4 ? 73 NE2 ? A HIS 145 ? A HIS 145 ? 1_555 ZN ? H ZN . ? A ZN 307 ? 1_555 O ? L HOH . ? A HOH 647 ? 1_555 108.4 ? 74 OE2 ? A GLU 158 ? A GLU 158 ? 1_555 ZN ? H ZN . ? A ZN 307 ? 1_555 O ? L HOH . ? A HOH 647 ? 1_555 52.1 ? 75 O ? C ACT . ? A ACT 302 ? 1_555 ZN ? H ZN . ? A ZN 307 ? 1_555 O ? L HOH . ? A HOH 647 ? 1_555 99.2 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id PHE _struct_mon_prot_cis.label_seq_id 36 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id PHE _struct_mon_prot_cis.auth_seq_id 36 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 37 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 37 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 2.83 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY A 72 ? ALA A 74 ? GLY A 72 ALA A 74 AA1 2 ILE A 84 ? PRO A 90 ? ILE A 84 PRO A 90 AA1 3 TYR A 104 ? HIS A 118 ? TYR A 104 HIS A 118 AA1 4 VAL A 148 ? PHE A 153 ? VAL A 148 PHE A 153 AA1 5 LYS A 159 ? LEU A 164 ? LYS A 159 LEU A 164 AA2 1 ARG A 144 ? HIS A 145 ? ARG A 144 HIS A 145 AA2 2 ASP A 122 ? LEU A 125 ? ASP A 122 LEU A 125 AA2 3 LEU A 201 ? LEU A 203 ? LEU A 201 LEU A 203 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 73 ? N LEU A 73 O ALA A 86 ? O ALA A 86 AA1 2 3 N VAL A 89 ? N VAL A 89 O LEU A 106 ? O LEU A 106 AA1 3 4 N TYR A 111 ? N TYR A 111 O PHE A 153 ? O PHE A 153 AA1 4 5 N TYR A 152 ? N TYR A 152 O HIS A 160 ? O HIS A 160 AA2 1 2 O ARG A 144 ? O ARG A 144 N ALA A 123 ? N ALA A 123 AA2 2 3 N ALA A 124 ? N ALA A 124 O LEU A 203 ? O LEU A 203 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A BB4 301 ? 11 'binding site for residue BB4 A 301' AC2 Software A ACT 302 ? 8 'binding site for residue ACT A 302' AC3 Software A ZN 303 ? 5 'binding site for residue ZN A 303' AC4 Software A ZN 304 ? 3 'binding site for residue ZN A 304' AC5 Software A ZN 305 ? 7 'binding site for residue ZN A 305' AC6 Software A ZN 306 ? 5 'binding site for residue ZN A 306' AC7 Software A ZN 307 ? 4 'binding site for residue ZN A 307' AC8 Software A ZN 308 ? 4 'binding site for residue ZN A 308' AC9 Software A ZN 309 ? 5 'binding site for residue ZN A 309' AD1 Software A ZN 310 ? 6 'binding site for residue ZN A 310' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 11 GLY A 72 ? GLY A 72 . ? 1_555 ? 2 AC1 11 GLN A 77 ? GLN A 77 . ? 1_555 ? 3 AC1 11 GLU A 129 ? GLU A 129 . ? 1_555 ? 4 AC1 11 GLY A 130 ? GLY A 130 . ? 1_555 ? 5 AC1 11 OCS A 131 ? OCS A 131 . ? 1_555 ? 6 AC1 11 LEU A 132 ? LEU A 132 . ? 1_555 ? 7 AC1 11 HIS A 174 ? HIS A 174 . ? 1_555 ? 8 AC1 11 GLU A 175 ? GLU A 175 . ? 1_555 ? 9 AC1 11 HIS A 178 ? HIS A 178 . ? 1_555 ? 10 AC1 11 ZN D . ? ZN A 303 . ? 1_555 ? 11 AC1 11 HOH L . ? HOH A 554 . ? 1_555 ? 12 AC2 8 HIS A 145 ? HIS A 145 . ? 1_555 ? 13 AC2 8 GLU A 158 ? GLU A 158 . ? 4_545 ? 14 AC2 8 ASP A 177 ? ASP A 177 . ? 1_555 ? 15 AC2 8 ARG A 187 ? ARG A 187 . ? 1_555 ? 16 AC2 8 ZN H . ? ZN A 307 . ? 1_555 ? 17 AC2 8 HOH L . ? HOH A 450 . ? 1_555 ? 18 AC2 8 HOH L . ? HOH A 512 . ? 1_555 ? 19 AC2 8 HOH L . ? HOH A 574 . ? 1_555 ? 20 AC3 5 GLN A 77 ? GLN A 77 . ? 1_555 ? 21 AC3 5 OCS A 131 ? OCS A 131 . ? 1_555 ? 22 AC3 5 HIS A 174 ? HIS A 174 . ? 1_555 ? 23 AC3 5 HIS A 178 ? HIS A 178 . ? 1_555 ? 24 AC3 5 BB4 B . ? BB4 A 301 . ? 1_555 ? 25 AC4 3 HIS A 55 ? HIS A 55 . ? 1_555 ? 26 AC4 3 GLU A 198 ? GLU A 198 . ? 2_455 ? 27 AC4 3 HOH L . ? HOH A 505 . ? 2_455 ? 28 AC5 7 HIS A 118 ? HIS A 118 . ? 1_555 ? 29 AC5 7 ASP A 154 ? ASP A 154 . ? 4_545 ? 30 AC5 7 HOH L . ? HOH A 414 . ? 4_545 ? 31 AC5 7 HOH L . ? HOH A 632 . ? 1_555 ? 32 AC5 7 HOH L . ? HOH A 648 . ? 1_555 ? 33 AC5 7 HOH L . ? HOH A 661 . ? 4_545 ? 34 AC5 7 HOH L . ? HOH A 667 . ? 1_555 ? 35 AC6 5 ASP A 94 ? ASP A 94 . ? 1_655 ? 36 AC6 5 GLU A 190 ? GLU A 190 . ? 1_555 ? 37 AC6 5 HOH L . ? HOH A 439 . ? 1_555 ? 38 AC6 5 HOH L . ? HOH A 527 . ? 1_555 ? 39 AC6 5 HOH L . ? HOH A 597 . ? 1_655 ? 40 AC7 4 HIS A 145 ? HIS A 145 . ? 1_555 ? 41 AC7 4 GLU A 158 ? GLU A 158 . ? 4_545 ? 42 AC7 4 ACT C . ? ACT A 302 . ? 1_555 ? 43 AC7 4 HOH L . ? HOH A 647 . ? 1_555 ? 44 AC8 4 HIS A 12 ? HIS A 12 . ? 1_555 ? 45 AC8 4 ASP A 18 ? ASP A 18 . ? 1_555 ? 46 AC8 4 HOH L . ? HOH A 412 . ? 1_555 ? 47 AC8 4 HOH L . ? HOH A 493 . ? 1_555 ? 48 AC9 5 GLU A 43 ? GLU A 43 . ? 1_555 ? 49 AC9 5 GLU A 47 ? GLU A 47 . ? 1_555 ? 50 AC9 5 HOH L . ? HOH A 441 . ? 1_555 ? 51 AC9 5 HOH L . ? HOH A 578 . ? 1_555 ? 52 AC9 5 HOH L . ? HOH A 606 . ? 1_555 ? 53 AD1 6 GLU A 102 ? GLU A 102 . ? 4_545 ? 54 AD1 6 GLU A 151 ? GLU A 151 . ? 1_555 ? 55 AD1 6 HOH L . ? HOH A 586 . ? 1_555 ? 56 AD1 6 HOH L . ? HOH A 637 . ? 4_545 ? 57 AD1 6 HOH L . ? HOH A 653 . ? 4_545 ? 58 AD1 6 HOH L . ? HOH A 657 . ? 4_545 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 520 ? ? O A HOH 714 ? ? 1.82 2 1 O A HOH 410 ? ? O A HOH 571 ? ? 1.83 3 1 O A HOH 637 ? ? O A HOH 657 ? ? 1.90 4 1 O A HOH 786 ? ? O A HOH 801 ? ? 2.04 5 1 O A HOH 714 ? ? O A HOH 739 ? ? 2.06 6 1 O A HOH 501 ? ? O A HOH 628 ? ? 2.06 7 1 O A HOH 791 ? ? O A HOH 805 ? ? 2.07 8 1 O A HOH 632 ? ? O A HOH 648 ? ? 2.08 9 1 O A HOH 493 ? ? O A HOH 743 ? ? 2.10 10 1 O A HOH 588 ? ? O A HOH 725 ? ? 2.12 11 1 OD2 A ASP 79 ? ? O A HOH 401 ? ? 2.13 12 1 O A HOH 493 ? ? O A HOH 707 ? ? 2.14 13 1 OE1 A GLU 43 ? ? O A HOH 402 ? ? 2.15 14 1 OE1 A GLU 93 ? ? O A HOH 403 ? ? 2.17 15 1 O A HOH 404 ? ? O A HOH 421 ? ? 2.17 16 1 O A HOH 404 ? ? O A HOH 649 ? ? 2.19 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 ZN A ZN 304 ? ? 1_555 O A HOH 505 ? ? 2_455 1.68 2 1 O A HOH 423 ? ? 1_555 O A HOH 482 ? ? 4_545 1.85 3 1 O A HOH 661 ? ? 1_555 O A HOH 667 ? ? 4_445 1.85 4 1 O A HOH 586 ? ? 1_555 O A HOH 653 ? ? 4_545 1.91 5 1 O A HOH 423 ? ? 1_555 O A HOH 678 ? ? 4_545 2.17 6 1 O A HOH 714 ? ? 1_555 O A HOH 736 ? ? 4_545 2.18 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CD A ARG 21 ? ? NE A ARG 21 ? ? 1.344 1.460 -0.116 0.017 N 2 1 CD A GLU 22 ? ? OE2 A GLU 22 ? ? 1.320 1.252 0.068 0.011 N 3 1 CG A GLU 32 ? ? CD A GLU 32 ? ? 1.638 1.515 0.123 0.015 N 4 1 CG A GLU 42 ? ? CD A GLU 42 ? ? 1.622 1.515 0.107 0.015 N 5 1 CD A GLU 42 ? ? OE1 A GLU 42 ? ? 1.387 1.252 0.135 0.011 N 6 1 CG A GLU 63 ? ? CD A GLU 63 ? ? 1.606 1.515 0.091 0.015 N 7 1 NE A ARG 83 ? ? CZ A ARG 83 ? ? 1.248 1.326 -0.078 0.013 N 8 1 CD A GLU 102 ? ? OE2 A GLU 102 ? ? 1.326 1.252 0.074 0.011 N 9 1 CG A GLU 108 ? ? CD A GLU 108 ? ? 1.613 1.515 0.098 0.015 N 10 1 CD A GLU 108 ? ? OE2 A GLU 108 ? ? 1.168 1.252 -0.084 0.011 N 11 1 CG A TYR 111 ? ? CD1 A TYR 111 ? ? 1.302 1.387 -0.085 0.013 N 12 1 C A ASN 112 ? ? O A ASN 112 ? ? 1.353 1.229 0.124 0.019 N 13 1 CB A SER 126 ? ? OG A SER 126 ? ? 1.337 1.418 -0.081 0.013 N 14 1 CD A GLU 129 ? ? OE1 A GLU 129 ? ? 1.178 1.252 -0.074 0.011 N 15 1 CB A TYR 167 ? ? CG A TYR 167 ? ? 1.390 1.512 -0.122 0.015 N 16 1 CB A GLU 198 ? ? CG A GLU 198 ? ? 1.395 1.517 -0.122 0.019 N 17 1 CD A GLU 198 ? ? OE1 A GLU 198 ? ? 1.366 1.252 0.114 0.011 N 18 1 CD A GLU 198 ? ? OE2 A GLU 198 ? ? 1.163 1.252 -0.089 0.011 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 15 ? ? CG A ASP 15 ? ? OD1 A ASP 15 ? ? 124.04 118.30 5.74 0.90 N 2 1 NE A ARG 21 ? ? CZ A ARG 21 ? ? NH1 A ARG 21 ? ? 126.37 120.30 6.07 0.50 N 3 1 NE A ARG 21 ? ? CZ A ARG 21 ? ? NH2 A ARG 21 ? ? 111.59 120.30 -8.71 0.50 N 4 1 CB A PHE 36 ? ? CG A PHE 36 ? ? CD2 A PHE 36 ? ? 116.37 120.80 -4.43 0.70 N 5 1 OE1 A GLU 47 ? ? CD A GLU 47 ? ? OE2 A GLU 47 ? ? 131.55 123.30 8.25 1.20 N 6 1 OE1 A GLU 63 ? ? CD A GLU 63 ? ? OE2 A GLU 63 ? ? 113.74 123.30 -9.56 1.20 N 7 1 CD A ARG 83 ? ? NE A ARG 83 ? ? CZ A ARG 83 ? ? 144.84 123.60 21.24 1.40 N 8 1 NH1 A ARG 83 ? ? CZ A ARG 83 ? ? NH2 A ARG 83 ? ? 127.60 119.40 8.20 1.10 N 9 1 NE A ARG 83 ? ? CZ A ARG 83 ? ? NH2 A ARG 83 ? ? 102.70 120.30 -17.60 0.50 N 10 1 OE1 A GLU 108 ? ? CD A GLU 108 ? ? OE2 A GLU 108 ? ? 112.26 123.30 -11.04 1.20 N 11 1 CB A ASP 127 ? ? CG A ASP 127 ? ? OD2 A ASP 127 ? ? 112.41 118.30 -5.89 0.90 N 12 1 CB A LEU 132 ? ? CG A LEU 132 ? ? CD2 A LEU 132 ? ? 98.76 111.00 -12.24 1.70 N 13 1 CB A ASP 135 ? ? CG A ASP 135 ? ? OD2 A ASP 135 ? ? 110.83 118.30 -7.47 0.90 N 14 1 NE A ARG 147 ? ? CZ A ARG 147 ? ? NH2 A ARG 147 ? ? 117.16 120.30 -3.14 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 22 ? ? -39.97 130.10 2 1 ASP A 79 ? ? 70.10 31.54 3 1 ASP A 135 ? ? -109.32 47.24 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 GLU A 33 ? ? 0.074 'SIDE CHAIN' 2 1 ARG A 83 ? ? 0.144 'SIDE CHAIN' # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id OCS _pdbx_struct_mod_residue.label_seq_id 131 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id OCS _pdbx_struct_mod_residue.auth_seq_id 131 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id CYS _pdbx_struct_mod_residue.details 'modified residue' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -7.1808 _pdbx_refine_tls.origin_y -7.1433 _pdbx_refine_tls.origin_z 9.4041 _pdbx_refine_tls.T[1][1] 0.0130 _pdbx_refine_tls.T[2][2] 0.0022 _pdbx_refine_tls.T[3][3] 0.0034 _pdbx_refine_tls.T[1][2] 0.0038 _pdbx_refine_tls.T[1][3] -0.0020 _pdbx_refine_tls.T[2][3] -0.0014 _pdbx_refine_tls.L[1][1] 0.2695 _pdbx_refine_tls.L[2][2] 0.1222 _pdbx_refine_tls.L[3][3] 0.1878 _pdbx_refine_tls.L[1][2] 0.0566 _pdbx_refine_tls.L[1][3] 0.0399 _pdbx_refine_tls.L[2][3] 0.0465 _pdbx_refine_tls.S[1][1] -0.0135 _pdbx_refine_tls.S[1][2] -0.0074 _pdbx_refine_tls.S[1][3] 0.0196 _pdbx_refine_tls.S[2][1] 0.0131 _pdbx_refine_tls.S[2][2] -0.0067 _pdbx_refine_tls.S[2][3] 0.0101 _pdbx_refine_tls.S[3][1] 0.0015 _pdbx_refine_tls.S[3][2] -0.0012 _pdbx_refine_tls.S[3][3] 0.0201 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 2 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 204 _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details ? # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 801 ? 6.09 . 2 1 O ? A HOH 802 ? 6.15 . 3 1 O ? A HOH 803 ? 6.36 . 4 1 O ? A HOH 804 ? 6.48 . 5 1 O ? A HOH 805 ? 6.74 . 6 1 O ? A HOH 806 ? 6.79 . 7 1 O ? A HOH 807 ? 8.77 . # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id MET _pdbx_unobs_or_zero_occ_residues.auth_seq_id 1 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id MET _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ACT C C N N 1 ACT O O N N 2 ACT OXT O N N 3 ACT CH3 C N N 4 ACT H1 H N N 5 ACT H2 H N N 6 ACT H3 H N N 7 ALA N N N N 8 ALA CA C N S 9 ALA C C N N 10 ALA O O N N 11 ALA CB C N N 12 ALA OXT O N N 13 ALA H H N N 14 ALA H2 H N N 15 ALA HA H N N 16 ALA HB1 H N N 17 ALA HB2 H N N 18 ALA HB3 H N N 19 ALA HXT H N N 20 ARG N N N N 21 ARG CA C N S 22 ARG C C N N 23 ARG O O N N 24 ARG CB C N N 25 ARG CG C N N 26 ARG CD C N N 27 ARG NE N N N 28 ARG CZ C N N 29 ARG NH1 N N N 30 ARG NH2 N N N 31 ARG OXT O N N 32 ARG H H N N 33 ARG H2 H N N 34 ARG HA H N N 35 ARG HB2 H N N 36 ARG HB3 H N N 37 ARG HG2 H N N 38 ARG HG3 H N N 39 ARG HD2 H N N 40 ARG HD3 H N N 41 ARG HE H N N 42 ARG HH11 H N N 43 ARG HH12 H N N 44 ARG HH21 H N N 45 ARG HH22 H N N 46 ARG HXT H N N 47 ASN N N N N 48 ASN CA C N S 49 ASN C C N N 50 ASN O O N N 51 ASN CB C N N 52 ASN CG C N N 53 ASN OD1 O N N 54 ASN ND2 N N N 55 ASN OXT O N N 56 ASN H H N N 57 ASN H2 H N N 58 ASN HA H N N 59 ASN HB2 H N N 60 ASN HB3 H N N 61 ASN HD21 H N N 62 ASN HD22 H N N 63 ASN HXT H N N 64 ASP N N N N 65 ASP CA C N S 66 ASP C C N N 67 ASP O O N N 68 ASP CB C N N 69 ASP CG C N N 70 ASP OD1 O N N 71 ASP OD2 O N N 72 ASP OXT O N N 73 ASP H H N N 74 ASP H2 H N N 75 ASP HA H N N 76 ASP HB2 H N N 77 ASP HB3 H N N 78 ASP HD2 H N N 79 ASP HXT H N N 80 BB4 BR BR N N 81 BB4 N1 N N N 82 BB4 O2 O N N 83 BB4 N3 N Y N 84 BB4 C4 C Y N 85 BB4 C5 C Y N 86 BB4 C6 C Y N 87 BB4 C7 C Y N 88 BB4 C8 C Y N 89 BB4 C9 C Y N 90 BB4 C10 C Y N 91 BB4 C11 C Y N 92 BB4 C12 C N N 93 BB4 C13 C N N 94 BB4 O14 O N N 95 BB4 HN1 H N N 96 BB4 HN3 H N N 97 BB4 H4 H N N 98 BB4 H7 H N N 99 BB4 H9 H N N 100 BB4 H10 H N N 101 BB4 H12 H N N 102 BB4 H12A H N N 103 BB4 HO14 H N N 104 GLN N N N N 105 GLN CA C N S 106 GLN C C N N 107 GLN O O N N 108 GLN CB C N N 109 GLN CG C N N 110 GLN CD C N N 111 GLN OE1 O N N 112 GLN NE2 N N N 113 GLN OXT O N N 114 GLN H H N N 115 GLN H2 H N N 116 GLN HA H N N 117 GLN HB2 H N N 118 GLN HB3 H N N 119 GLN HG2 H N N 120 GLN HG3 H N N 121 GLN HE21 H N N 122 GLN HE22 H N N 123 GLN HXT H N N 124 GLU N N N N 125 GLU CA C N S 126 GLU C C N N 127 GLU O O N N 128 GLU CB C N N 129 GLU CG C N N 130 GLU CD C N N 131 GLU OE1 O N N 132 GLU OE2 O N N 133 GLU OXT O N N 134 GLU H H N N 135 GLU H2 H N N 136 GLU HA H N N 137 GLU HB2 H N N 138 GLU HB3 H N N 139 GLU HG2 H N N 140 GLU HG3 H N N 141 GLU HE2 H N N 142 GLU HXT H N N 143 GLY N N N N 144 GLY CA C N N 145 GLY C C N N 146 GLY O O N N 147 GLY OXT O N N 148 GLY H H N N 149 GLY H2 H N N 150 GLY HA2 H N N 151 GLY HA3 H N N 152 GLY HXT H N N 153 HIS N N N N 154 HIS CA C N S 155 HIS C C N N 156 HIS O O N N 157 HIS CB C N N 158 HIS CG C Y N 159 HIS ND1 N Y N 160 HIS CD2 C Y N 161 HIS CE1 C Y N 162 HIS NE2 N Y N 163 HIS OXT O N N 164 HIS H H N N 165 HIS H2 H N N 166 HIS HA H N N 167 HIS HB2 H N N 168 HIS HB3 H N N 169 HIS HD1 H N N 170 HIS HD2 H N N 171 HIS HE1 H N N 172 HIS HE2 H N N 173 HIS HXT H N N 174 HOH O O N N 175 HOH H1 H N N 176 HOH H2 H N N 177 ILE N N N N 178 ILE CA C N S 179 ILE C C N N 180 ILE O O N N 181 ILE CB C N S 182 ILE CG1 C N N 183 ILE CG2 C N N 184 ILE CD1 C N N 185 ILE OXT O N N 186 ILE H H N N 187 ILE H2 H N N 188 ILE HA H N N 189 ILE HB H N N 190 ILE HG12 H N N 191 ILE HG13 H N N 192 ILE HG21 H N N 193 ILE HG22 H N N 194 ILE HG23 H N N 195 ILE HD11 H N N 196 ILE HD12 H N N 197 ILE HD13 H N N 198 ILE HXT H N N 199 LEU N N N N 200 LEU CA C N S 201 LEU C C N N 202 LEU O O N N 203 LEU CB C N N 204 LEU CG C N N 205 LEU CD1 C N N 206 LEU CD2 C N N 207 LEU OXT O N N 208 LEU H H N N 209 LEU H2 H N N 210 LEU HA H N N 211 LEU HB2 H N N 212 LEU HB3 H N N 213 LEU HG H N N 214 LEU HD11 H N N 215 LEU HD12 H N N 216 LEU HD13 H N N 217 LEU HD21 H N N 218 LEU HD22 H N N 219 LEU HD23 H N N 220 LEU HXT H N N 221 LYS N N N N 222 LYS CA C N S 223 LYS C C N N 224 LYS O O N N 225 LYS CB C N N 226 LYS CG C N N 227 LYS CD C N N 228 LYS CE C N N 229 LYS NZ N N N 230 LYS OXT O N N 231 LYS H H N N 232 LYS H2 H N N 233 LYS HA H N N 234 LYS HB2 H N N 235 LYS HB3 H N N 236 LYS HG2 H N N 237 LYS HG3 H N N 238 LYS HD2 H N N 239 LYS HD3 H N N 240 LYS HE2 H N N 241 LYS HE3 H N N 242 LYS HZ1 H N N 243 LYS HZ2 H N N 244 LYS HZ3 H N N 245 LYS HXT H N N 246 MET N N N N 247 MET CA C N S 248 MET C C N N 249 MET O O N N 250 MET CB C N N 251 MET CG C N N 252 MET SD S N N 253 MET CE C N N 254 MET OXT O N N 255 MET H H N N 256 MET H2 H N N 257 MET HA H N N 258 MET HB2 H N N 259 MET HB3 H N N 260 MET HG2 H N N 261 MET HG3 H N N 262 MET HE1 H N N 263 MET HE2 H N N 264 MET HE3 H N N 265 MET HXT H N N 266 OCS N N N N 267 OCS CA C N R 268 OCS CB C N N 269 OCS SG S N N 270 OCS C C N N 271 OCS O O N N 272 OCS OXT O N N 273 OCS OD1 O N N 274 OCS OD2 O N N 275 OCS OD3 O N N 276 OCS H H N N 277 OCS H2 H N N 278 OCS HA H N N 279 OCS HB2 H N N 280 OCS HB3 H N N 281 OCS HXT H N N 282 OCS HD2 H N N 283 PHE N N N N 284 PHE CA C N S 285 PHE C C N N 286 PHE O O N N 287 PHE CB C N N 288 PHE CG C Y N 289 PHE CD1 C Y N 290 PHE CD2 C Y N 291 PHE CE1 C Y N 292 PHE CE2 C Y N 293 PHE CZ C Y N 294 PHE OXT O N N 295 PHE H H N N 296 PHE H2 H N N 297 PHE HA H N N 298 PHE HB2 H N N 299 PHE HB3 H N N 300 PHE HD1 H N N 301 PHE HD2 H N N 302 PHE HE1 H N N 303 PHE HE2 H N N 304 PHE HZ H N N 305 PHE HXT H N N 306 PRO N N N N 307 PRO CA C N S 308 PRO C C N N 309 PRO O O N N 310 PRO CB C N N 311 PRO CG C N N 312 PRO CD C N N 313 PRO OXT O N N 314 PRO H H N N 315 PRO HA H N N 316 PRO HB2 H N N 317 PRO HB3 H N N 318 PRO HG2 H N N 319 PRO HG3 H N N 320 PRO HD2 H N N 321 PRO HD3 H N N 322 PRO HXT H N N 323 SER N N N N 324 SER CA C N S 325 SER C C N N 326 SER O O N N 327 SER CB C N N 328 SER OG O N N 329 SER OXT O N N 330 SER H H N N 331 SER H2 H N N 332 SER HA H N N 333 SER HB2 H N N 334 SER HB3 H N N 335 SER HG H N N 336 SER HXT H N N 337 THR N N N N 338 THR CA C N S 339 THR C C N N 340 THR O O N N 341 THR CB C N R 342 THR OG1 O N N 343 THR CG2 C N N 344 THR OXT O N N 345 THR H H N N 346 THR H2 H N N 347 THR HA H N N 348 THR HB H N N 349 THR HG1 H N N 350 THR HG21 H N N 351 THR HG22 H N N 352 THR HG23 H N N 353 THR HXT H N N 354 TYR N N N N 355 TYR CA C N S 356 TYR C C N N 357 TYR O O N N 358 TYR CB C N N 359 TYR CG C Y N 360 TYR CD1 C Y N 361 TYR CD2 C Y N 362 TYR CE1 C Y N 363 TYR CE2 C Y N 364 TYR CZ C Y N 365 TYR OH O N N 366 TYR OXT O N N 367 TYR H H N N 368 TYR H2 H N N 369 TYR HA H N N 370 TYR HB2 H N N 371 TYR HB3 H N N 372 TYR HD1 H N N 373 TYR HD2 H N N 374 TYR HE1 H N N 375 TYR HE2 H N N 376 TYR HH H N N 377 TYR HXT H N N 378 VAL N N N N 379 VAL CA C N S 380 VAL C C N N 381 VAL O O N N 382 VAL CB C N N 383 VAL CG1 C N N 384 VAL CG2 C N N 385 VAL OXT O N N 386 VAL H H N N 387 VAL H2 H N N 388 VAL HA H N N 389 VAL HB H N N 390 VAL HG11 H N N 391 VAL HG12 H N N 392 VAL HG13 H N N 393 VAL HG21 H N N 394 VAL HG22 H N N 395 VAL HG23 H N N 396 VAL HXT H N N 397 ZN ZN ZN N N 398 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ACT C O doub N N 1 ACT C OXT sing N N 2 ACT C CH3 sing N N 3 ACT CH3 H1 sing N N 4 ACT CH3 H2 sing N N 5 ACT CH3 H3 sing N N 6 ALA N CA sing N N 7 ALA N H sing N N 8 ALA N H2 sing N N 9 ALA CA C sing N N 10 ALA CA CB sing N N 11 ALA CA HA sing N N 12 ALA C O doub N N 13 ALA C OXT sing N N 14 ALA CB HB1 sing N N 15 ALA CB HB2 sing N N 16 ALA CB HB3 sing N N 17 ALA OXT HXT sing N N 18 ARG N CA sing N N 19 ARG N H sing N N 20 ARG N H2 sing N N 21 ARG CA C sing N N 22 ARG CA CB sing N N 23 ARG CA HA sing N N 24 ARG C O doub N N 25 ARG C OXT sing N N 26 ARG CB CG sing N N 27 ARG CB HB2 sing N N 28 ARG CB HB3 sing N N 29 ARG CG CD sing N N 30 ARG CG HG2 sing N N 31 ARG CG HG3 sing N N 32 ARG CD NE sing N N 33 ARG CD HD2 sing N N 34 ARG CD HD3 sing N N 35 ARG NE CZ sing N N 36 ARG NE HE sing N N 37 ARG CZ NH1 sing N N 38 ARG CZ NH2 doub N N 39 ARG NH1 HH11 sing N N 40 ARG NH1 HH12 sing N N 41 ARG NH2 HH21 sing N N 42 ARG NH2 HH22 sing N N 43 ARG OXT HXT sing N N 44 ASN N CA sing N N 45 ASN N H sing N N 46 ASN N H2 sing N N 47 ASN CA C sing N N 48 ASN CA CB sing N N 49 ASN CA HA sing N N 50 ASN C O doub N N 51 ASN C OXT sing N N 52 ASN CB CG sing N N 53 ASN CB HB2 sing N N 54 ASN CB HB3 sing N N 55 ASN CG OD1 doub N N 56 ASN CG ND2 sing N N 57 ASN ND2 HD21 sing N N 58 ASN ND2 HD22 sing N N 59 ASN OXT HXT sing N N 60 ASP N CA sing N N 61 ASP N H sing N N 62 ASP N H2 sing N N 63 ASP CA C sing N N 64 ASP CA CB sing N N 65 ASP CA HA sing N N 66 ASP C O doub N N 67 ASP C OXT sing N N 68 ASP CB CG sing N N 69 ASP CB HB2 sing N N 70 ASP CB HB3 sing N N 71 ASP CG OD1 doub N N 72 ASP CG OD2 sing N N 73 ASP OD2 HD2 sing N N 74 ASP OXT HXT sing N N 75 BB4 BR C8 sing N N 76 BB4 N1 C13 sing N N 77 BB4 N1 O14 sing N N 78 BB4 O2 C13 doub N N 79 BB4 N3 C4 sing Y N 80 BB4 N3 C11 sing Y N 81 BB4 C4 C5 doub Y N 82 BB4 C5 C6 sing Y N 83 BB4 C5 C12 sing N N 84 BB4 C6 C7 doub Y N 85 BB4 C6 C11 sing Y N 86 BB4 C7 C8 sing Y N 87 BB4 C8 C9 doub Y N 88 BB4 C9 C10 sing Y N 89 BB4 C10 C11 doub Y N 90 BB4 C12 C13 sing N N 91 BB4 N1 HN1 sing N N 92 BB4 N3 HN3 sing N N 93 BB4 C4 H4 sing N N 94 BB4 C7 H7 sing N N 95 BB4 C9 H9 sing N N 96 BB4 C10 H10 sing N N 97 BB4 C12 H12 sing N N 98 BB4 C12 H12A sing N N 99 BB4 O14 HO14 sing N N 100 GLN N CA sing N N 101 GLN N H sing N N 102 GLN N H2 sing N N 103 GLN CA C sing N N 104 GLN CA CB sing N N 105 GLN CA HA sing N N 106 GLN C O doub N N 107 GLN C OXT sing N N 108 GLN CB CG sing N N 109 GLN CB HB2 sing N N 110 GLN CB HB3 sing N N 111 GLN CG CD sing N N 112 GLN CG HG2 sing N N 113 GLN CG HG3 sing N N 114 GLN CD OE1 doub N N 115 GLN CD NE2 sing N N 116 GLN NE2 HE21 sing N N 117 GLN NE2 HE22 sing N N 118 GLN OXT HXT sing N N 119 GLU N CA sing N N 120 GLU N H sing N N 121 GLU N H2 sing N N 122 GLU CA C sing N N 123 GLU CA CB sing N N 124 GLU CA HA sing N N 125 GLU C O doub N N 126 GLU C OXT sing N N 127 GLU CB CG sing N N 128 GLU CB HB2 sing N N 129 GLU CB HB3 sing N N 130 GLU CG CD sing N N 131 GLU CG HG2 sing N N 132 GLU CG HG3 sing N N 133 GLU CD OE1 doub N N 134 GLU CD OE2 sing N N 135 GLU OE2 HE2 sing N N 136 GLU OXT HXT sing N N 137 GLY N CA sing N N 138 GLY N H sing N N 139 GLY N H2 sing N N 140 GLY CA C sing N N 141 GLY CA HA2 sing N N 142 GLY CA HA3 sing N N 143 GLY C O doub N N 144 GLY C OXT sing N N 145 GLY OXT HXT sing N N 146 HIS N CA sing N N 147 HIS N H sing N N 148 HIS N H2 sing N N 149 HIS CA C sing N N 150 HIS CA CB sing N N 151 HIS CA HA sing N N 152 HIS C O doub N N 153 HIS C OXT sing N N 154 HIS CB CG sing N N 155 HIS CB HB2 sing N N 156 HIS CB HB3 sing N N 157 HIS CG ND1 sing Y N 158 HIS CG CD2 doub Y N 159 HIS ND1 CE1 doub Y N 160 HIS ND1 HD1 sing N N 161 HIS CD2 NE2 sing Y N 162 HIS CD2 HD2 sing N N 163 HIS CE1 NE2 sing Y N 164 HIS CE1 HE1 sing N N 165 HIS NE2 HE2 sing N N 166 HIS OXT HXT sing N N 167 HOH O H1 sing N N 168 HOH O H2 sing N N 169 ILE N CA sing N N 170 ILE N H sing N N 171 ILE N H2 sing N N 172 ILE CA C sing N N 173 ILE CA CB sing N N 174 ILE CA HA sing N N 175 ILE C O doub N N 176 ILE C OXT sing N N 177 ILE CB CG1 sing N N 178 ILE CB CG2 sing N N 179 ILE CB HB sing N N 180 ILE CG1 CD1 sing N N 181 ILE CG1 HG12 sing N N 182 ILE CG1 HG13 sing N N 183 ILE CG2 HG21 sing N N 184 ILE CG2 HG22 sing N N 185 ILE CG2 HG23 sing N N 186 ILE CD1 HD11 sing N N 187 ILE CD1 HD12 sing N N 188 ILE CD1 HD13 sing N N 189 ILE OXT HXT sing N N 190 LEU N CA sing N N 191 LEU N H sing N N 192 LEU N H2 sing N N 193 LEU CA C sing N N 194 LEU CA CB sing N N 195 LEU CA HA sing N N 196 LEU C O doub N N 197 LEU C OXT sing N N 198 LEU CB CG sing N N 199 LEU CB HB2 sing N N 200 LEU CB HB3 sing N N 201 LEU CG CD1 sing N N 202 LEU CG CD2 sing N N 203 LEU CG HG sing N N 204 LEU CD1 HD11 sing N N 205 LEU CD1 HD12 sing N N 206 LEU CD1 HD13 sing N N 207 LEU CD2 HD21 sing N N 208 LEU CD2 HD22 sing N N 209 LEU CD2 HD23 sing N N 210 LEU OXT HXT sing N N 211 LYS N CA sing N N 212 LYS N H sing N N 213 LYS N H2 sing N N 214 LYS CA C sing N N 215 LYS CA CB sing N N 216 LYS CA HA sing N N 217 LYS C O doub N N 218 LYS C OXT sing N N 219 LYS CB CG sing N N 220 LYS CB HB2 sing N N 221 LYS CB HB3 sing N N 222 LYS CG CD sing N N 223 LYS CG HG2 sing N N 224 LYS CG HG3 sing N N 225 LYS CD CE sing N N 226 LYS CD HD2 sing N N 227 LYS CD HD3 sing N N 228 LYS CE NZ sing N N 229 LYS CE HE2 sing N N 230 LYS CE HE3 sing N N 231 LYS NZ HZ1 sing N N 232 LYS NZ HZ2 sing N N 233 LYS NZ HZ3 sing N N 234 LYS OXT HXT sing N N 235 MET N CA sing N N 236 MET N H sing N N 237 MET N H2 sing N N 238 MET CA C sing N N 239 MET CA CB sing N N 240 MET CA HA sing N N 241 MET C O doub N N 242 MET C OXT sing N N 243 MET CB CG sing N N 244 MET CB HB2 sing N N 245 MET CB HB3 sing N N 246 MET CG SD sing N N 247 MET CG HG2 sing N N 248 MET CG HG3 sing N N 249 MET SD CE sing N N 250 MET CE HE1 sing N N 251 MET CE HE2 sing N N 252 MET CE HE3 sing N N 253 MET OXT HXT sing N N 254 OCS N CA sing N N 255 OCS N H sing N N 256 OCS N H2 sing N N 257 OCS CA CB sing N N 258 OCS CA C sing N N 259 OCS CA HA sing N N 260 OCS CB SG sing N N 261 OCS CB HB2 sing N N 262 OCS CB HB3 sing N N 263 OCS SG OD1 doub N N 264 OCS SG OD2 sing N N 265 OCS SG OD3 doub N N 266 OCS C O doub N N 267 OCS C OXT sing N N 268 OCS OXT HXT sing N N 269 OCS OD2 HD2 sing N N 270 PHE N CA sing N N 271 PHE N H sing N N 272 PHE N H2 sing N N 273 PHE CA C sing N N 274 PHE CA CB sing N N 275 PHE CA HA sing N N 276 PHE C O doub N N 277 PHE C OXT sing N N 278 PHE CB CG sing N N 279 PHE CB HB2 sing N N 280 PHE CB HB3 sing N N 281 PHE CG CD1 doub Y N 282 PHE CG CD2 sing Y N 283 PHE CD1 CE1 sing Y N 284 PHE CD1 HD1 sing N N 285 PHE CD2 CE2 doub Y N 286 PHE CD2 HD2 sing N N 287 PHE CE1 CZ doub Y N 288 PHE CE1 HE1 sing N N 289 PHE CE2 CZ sing Y N 290 PHE CE2 HE2 sing N N 291 PHE CZ HZ sing N N 292 PHE OXT HXT sing N N 293 PRO N CA sing N N 294 PRO N CD sing N N 295 PRO N H sing N N 296 PRO CA C sing N N 297 PRO CA CB sing N N 298 PRO CA HA sing N N 299 PRO C O doub N N 300 PRO C OXT sing N N 301 PRO CB CG sing N N 302 PRO CB HB2 sing N N 303 PRO CB HB3 sing N N 304 PRO CG CD sing N N 305 PRO CG HG2 sing N N 306 PRO CG HG3 sing N N 307 PRO CD HD2 sing N N 308 PRO CD HD3 sing N N 309 PRO OXT HXT sing N N 310 SER N CA sing N N 311 SER N H sing N N 312 SER N H2 sing N N 313 SER CA C sing N N 314 SER CA CB sing N N 315 SER CA HA sing N N 316 SER C O doub N N 317 SER C OXT sing N N 318 SER CB OG sing N N 319 SER CB HB2 sing N N 320 SER CB HB3 sing N N 321 SER OG HG sing N N 322 SER OXT HXT sing N N 323 THR N CA sing N N 324 THR N H sing N N 325 THR N H2 sing N N 326 THR CA C sing N N 327 THR CA CB sing N N 328 THR CA HA sing N N 329 THR C O doub N N 330 THR C OXT sing N N 331 THR CB OG1 sing N N 332 THR CB CG2 sing N N 333 THR CB HB sing N N 334 THR OG1 HG1 sing N N 335 THR CG2 HG21 sing N N 336 THR CG2 HG22 sing N N 337 THR CG2 HG23 sing N N 338 THR OXT HXT sing N N 339 TYR N CA sing N N 340 TYR N H sing N N 341 TYR N H2 sing N N 342 TYR CA C sing N N 343 TYR CA CB sing N N 344 TYR CA HA sing N N 345 TYR C O doub N N 346 TYR C OXT sing N N 347 TYR CB CG sing N N 348 TYR CB HB2 sing N N 349 TYR CB HB3 sing N N 350 TYR CG CD1 doub Y N 351 TYR CG CD2 sing Y N 352 TYR CD1 CE1 sing Y N 353 TYR CD1 HD1 sing N N 354 TYR CD2 CE2 doub Y N 355 TYR CD2 HD2 sing N N 356 TYR CE1 CZ doub Y N 357 TYR CE1 HE1 sing N N 358 TYR CE2 CZ sing Y N 359 TYR CE2 HE2 sing N N 360 TYR CZ OH sing N N 361 TYR OH HH sing N N 362 TYR OXT HXT sing N N 363 VAL N CA sing N N 364 VAL N H sing N N 365 VAL N H2 sing N N 366 VAL CA C sing N N 367 VAL CA CB sing N N 368 VAL CA HA sing N N 369 VAL C O doub N N 370 VAL C OXT sing N N 371 VAL CB CG1 sing N N 372 VAL CB CG2 sing N N 373 VAL CB HB sing N N 374 VAL CG1 HG11 sing N N 375 VAL CG1 HG12 sing N N 376 VAL CG1 HG13 sing N N 377 VAL CG2 HG21 sing N N 378 VAL CG2 HG22 sing N N 379 VAL CG2 HG23 sing N N 380 VAL OXT HXT sing N N 381 # _pdbx_audit_support.funding_organization 'French National Research Agency' _pdbx_audit_support.country France _pdbx_audit_support.grant_number 'ANR-MIME 2006' _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2AIE _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 5JF6 _atom_sites.fract_transf_matrix[1][1] 0.024438 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015088 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011326 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol BR C N O S ZN # loop_