data_5JSF # _entry.id 5JSF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5JSF pdb_00005jsf 10.2210/pdb5jsf/pdb WWPDB D_1000221151 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-07-13 2 'Structure model' 1 1 2016-08-10 3 'Structure model' 1 2 2017-09-06 4 'Structure model' 1 3 2024-01-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Author supporting evidence' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' pdbx_audit_support 2 4 'Structure model' chem_comp_atom 3 4 'Structure model' chem_comp_bond 4 4 'Structure model' database_2 5 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_audit_support.funding_organization' 2 4 'Structure model' '_database_2.pdbx_DOI' 3 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5JSF _pdbx_database_status.recvd_initial_deposition_date 2016-05-08 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name PDB _pdbx_database_related.details . _pdbx_database_related.db_id 5EN4 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bertoletti, N.' 1 'Marchais-Oberwinkler, S.' 2 'Heine, A.' 3 'Klebe, G.' 4 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 59 _citation.language ? _citation.page_first 6961 _citation.page_last 6967 _citation.title ;New Insights into Human 17 beta-Hydroxysteroid Dehydrogenase Type 14: First Crystal Structures in Complex with a Steroidal Ligand and with a Potent Nonsteroidal Inhibitor. ; _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.6b00293 _citation.pdbx_database_id_PubMed 27362750 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bertoletti, N.' 1 ? primary 'Braun, F.' 2 ? primary 'Lepage, M.' 3 ? primary 'Moller, G.' 4 ? primary 'Adamski, J.' 5 ? primary 'Heine, A.' 6 ? primary 'Klebe, G.' 7 ? primary 'Marchais-Oberwinkler, S.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man '17-beta-hydroxysteroid dehydrogenase 14' 28668.717 1 1.1.1.- ? ? ? 2 non-polymer syn NICOTINAMIDE-ADENINE-DINUCLEOTIDE 663.425 1 ? ? ? ? 3 non-polymer syn 'SODIUM ION' 22.990 1 ? ? ? ? 4 non-polymer syn 'TRIETHYLENE GLYCOL' 150.173 1 ? ? ? ? 5 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 6 water nat water 18.015 86 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;17-beta-HSD 14,17-beta-hydroxysteroid dehydrogenase DHRS10,Dehydrogenase/reductase SDR family member 10,Retinal short-chain dehydrogenase/reductase retSDR3,Short chain dehydrogenase/reductase family 47C member 1 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GHMATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIR RFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATK GAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRASIREGMLAQPLGRMGQPAEVGAAAVFLASEANFC TGIELLVTGGAELGYGCKASRSTPVDAPDIPSGS ; _entity_poly.pdbx_seq_one_letter_code_can ;GHMATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIR RFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATK GAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRASIREGMLAQPLGRMGQPAEVGAAAVFLASEANFC TGIELLVTGGAELGYGCKASRSTPVDAPDIPSGS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 NICOTINAMIDE-ADENINE-DINUCLEOTIDE NAD 3 'SODIUM ION' NA 4 'TRIETHYLENE GLYCOL' PGE 5 'CHLORIDE ION' CL 6 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 HIS n 1 3 MET n 1 4 ALA n 1 5 THR n 1 6 GLY n 1 7 THR n 1 8 ARG n 1 9 TYR n 1 10 ALA n 1 11 GLY n 1 12 LYS n 1 13 VAL n 1 14 VAL n 1 15 VAL n 1 16 VAL n 1 17 THR n 1 18 GLY n 1 19 GLY n 1 20 GLY n 1 21 ARG n 1 22 GLY n 1 23 ILE n 1 24 GLY n 1 25 ALA n 1 26 GLY n 1 27 ILE n 1 28 VAL n 1 29 ARG n 1 30 ALA n 1 31 PHE n 1 32 VAL n 1 33 ASN n 1 34 SER n 1 35 GLY n 1 36 ALA n 1 37 ARG n 1 38 VAL n 1 39 VAL n 1 40 ILE n 1 41 CYS n 1 42 ASP n 1 43 LYS n 1 44 ASP n 1 45 GLU n 1 46 SER n 1 47 GLY n 1 48 GLY n 1 49 ARG n 1 50 ALA n 1 51 LEU n 1 52 GLU n 1 53 GLN n 1 54 GLU n 1 55 LEU n 1 56 PRO n 1 57 GLY n 1 58 ALA n 1 59 VAL n 1 60 PHE n 1 61 ILE n 1 62 LEU n 1 63 CYS n 1 64 ASP n 1 65 VAL n 1 66 THR n 1 67 GLN n 1 68 GLU n 1 69 ASP n 1 70 ASP n 1 71 VAL n 1 72 LYS n 1 73 THR n 1 74 LEU n 1 75 VAL n 1 76 SER n 1 77 GLU n 1 78 THR n 1 79 ILE n 1 80 ARG n 1 81 ARG n 1 82 PHE n 1 83 GLY n 1 84 ARG n 1 85 LEU n 1 86 ASP n 1 87 CYS n 1 88 VAL n 1 89 VAL n 1 90 ASN n 1 91 ASN n 1 92 ALA n 1 93 GLY n 1 94 HIS n 1 95 HIS n 1 96 PRO n 1 97 PRO n 1 98 PRO n 1 99 GLN n 1 100 ARG n 1 101 PRO n 1 102 GLU n 1 103 GLU n 1 104 THR n 1 105 SER n 1 106 ALA n 1 107 GLN n 1 108 GLY n 1 109 PHE n 1 110 ARG n 1 111 GLN n 1 112 LEU n 1 113 LEU n 1 114 GLU n 1 115 LEU n 1 116 ASN n 1 117 LEU n 1 118 LEU n 1 119 GLY n 1 120 THR n 1 121 TYR n 1 122 THR n 1 123 LEU n 1 124 THR n 1 125 LYS n 1 126 LEU n 1 127 ALA n 1 128 LEU n 1 129 PRO n 1 130 TYR n 1 131 LEU n 1 132 ARG n 1 133 LYS n 1 134 SER n 1 135 GLN n 1 136 GLY n 1 137 ASN n 1 138 VAL n 1 139 ILE n 1 140 ASN n 1 141 ILE n 1 142 SER n 1 143 SER n 1 144 LEU n 1 145 VAL n 1 146 GLY n 1 147 ALA n 1 148 ILE n 1 149 GLY n 1 150 GLN n 1 151 ALA n 1 152 GLN n 1 153 ALA n 1 154 VAL n 1 155 PRO n 1 156 TYR n 1 157 VAL n 1 158 ALA n 1 159 THR n 1 160 LYS n 1 161 GLY n 1 162 ALA n 1 163 VAL n 1 164 THR n 1 165 ALA n 1 166 MET n 1 167 THR n 1 168 LYS n 1 169 ALA n 1 170 LEU n 1 171 ALA n 1 172 LEU n 1 173 ASP n 1 174 GLU n 1 175 SER n 1 176 PRO n 1 177 TYR n 1 178 GLY n 1 179 VAL n 1 180 ARG n 1 181 VAL n 1 182 ASN n 1 183 CYS n 1 184 ILE n 1 185 SER n 1 186 PRO n 1 187 GLY n 1 188 ASN n 1 189 ILE n 1 190 TRP n 1 191 THR n 1 192 PRO n 1 193 LEU n 1 194 TRP n 1 195 GLU n 1 196 GLU n 1 197 LEU n 1 198 ALA n 1 199 ALA n 1 200 LEU n 1 201 MET n 1 202 PRO n 1 203 ASP n 1 204 PRO n 1 205 ARG n 1 206 ALA n 1 207 SER n 1 208 ILE n 1 209 ARG n 1 210 GLU n 1 211 GLY n 1 212 MET n 1 213 LEU n 1 214 ALA n 1 215 GLN n 1 216 PRO n 1 217 LEU n 1 218 GLY n 1 219 ARG n 1 220 MET n 1 221 GLY n 1 222 GLN n 1 223 PRO n 1 224 ALA n 1 225 GLU n 1 226 VAL n 1 227 GLY n 1 228 ALA n 1 229 ALA n 1 230 ALA n 1 231 VAL n 1 232 PHE n 1 233 LEU n 1 234 ALA n 1 235 SER n 1 236 GLU n 1 237 ALA n 1 238 ASN n 1 239 PHE n 1 240 CYS n 1 241 THR n 1 242 GLY n 1 243 ILE n 1 244 GLU n 1 245 LEU n 1 246 LEU n 1 247 VAL n 1 248 THR n 1 249 GLY n 1 250 GLY n 1 251 ALA n 1 252 GLU n 1 253 LEU n 1 254 GLY n 1 255 TYR n 1 256 GLY n 1 257 CYS n 1 258 LYS n 1 259 ALA n 1 260 SER n 1 261 ARG n 1 262 SER n 1 263 THR n 1 264 PRO n 1 265 VAL n 1 266 ASP n 1 267 ALA n 1 268 PRO n 1 269 ASP n 1 270 ILE n 1 271 PRO n 1 272 SER n 1 273 GLY n 1 274 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 274 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'HSD17B14, DHRS10, SDR3, SDR47C1, UNQ502/PRO474' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant pLysS _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 NAD non-polymer . NICOTINAMIDE-ADENINE-DINUCLEOTIDE ? 'C21 H27 N7 O14 P2' 663.425 PGE non-polymer . 'TRIETHYLENE GLYCOL' ? 'C6 H14 O4' 150.173 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 ? ? ? A . n A 1 2 HIS 2 0 ? ? ? A . n A 1 3 MET 3 1 ? ? ? A . n A 1 4 ALA 4 2 ? ? ? A . n A 1 5 THR 5 3 ? ? ? A . n A 1 6 GLY 6 4 4 GLY GLY A . n A 1 7 THR 7 5 5 THR THR A . n A 1 8 ARG 8 6 6 ARG ARG A . n A 1 9 TYR 9 7 7 TYR TYR A . n A 1 10 ALA 10 8 8 ALA ALA A . n A 1 11 GLY 11 9 9 GLY GLY A . n A 1 12 LYS 12 10 10 LYS LYS A . n A 1 13 VAL 13 11 11 VAL VAL A . n A 1 14 VAL 14 12 12 VAL VAL A . n A 1 15 VAL 15 13 13 VAL VAL A . n A 1 16 VAL 16 14 14 VAL VAL A . n A 1 17 THR 17 15 15 THR THR A . n A 1 18 GLY 18 16 16 GLY GLY A . n A 1 19 GLY 19 17 17 GLY GLY A . n A 1 20 GLY 20 18 18 GLY GLY A . n A 1 21 ARG 21 19 19 ARG ARG A . n A 1 22 GLY 22 20 20 GLY GLY A . n A 1 23 ILE 23 21 21 ILE ILE A . n A 1 24 GLY 24 22 22 GLY GLY A . n A 1 25 ALA 25 23 23 ALA ALA A . n A 1 26 GLY 26 24 24 GLY GLY A . n A 1 27 ILE 27 25 25 ILE ILE A . n A 1 28 VAL 28 26 26 VAL VAL A . n A 1 29 ARG 29 27 27 ARG ARG A . n A 1 30 ALA 30 28 28 ALA ALA A . n A 1 31 PHE 31 29 29 PHE PHE A . n A 1 32 VAL 32 30 30 VAL VAL A . n A 1 33 ASN 33 31 31 ASN ASN A . n A 1 34 SER 34 32 32 SER SER A . n A 1 35 GLY 35 33 33 GLY GLY A . n A 1 36 ALA 36 34 34 ALA ALA A . n A 1 37 ARG 37 35 35 ARG ARG A . n A 1 38 VAL 38 36 36 VAL VAL A . n A 1 39 VAL 39 37 37 VAL VAL A . n A 1 40 ILE 40 38 38 ILE ILE A . n A 1 41 CYS 41 39 39 CYS CYS A . n A 1 42 ASP 42 40 40 ASP ASP A . n A 1 43 LYS 43 41 41 LYS LYS A . n A 1 44 ASP 44 42 42 ASP ASP A . n A 1 45 GLU 45 43 43 GLU GLU A . n A 1 46 SER 46 44 44 SER SER A . n A 1 47 GLY 47 45 45 GLY GLY A . n A 1 48 GLY 48 46 46 GLY GLY A . n A 1 49 ARG 49 47 47 ARG ARG A . n A 1 50 ALA 50 48 48 ALA ALA A . n A 1 51 LEU 51 49 49 LEU LEU A . n A 1 52 GLU 52 50 50 GLU GLU A . n A 1 53 GLN 53 51 51 GLN GLN A . n A 1 54 GLU 54 52 52 GLU GLU A . n A 1 55 LEU 55 53 53 LEU LEU A . n A 1 56 PRO 56 54 54 PRO PRO A . n A 1 57 GLY 57 55 55 GLY GLY A . n A 1 58 ALA 58 56 56 ALA ALA A . n A 1 59 VAL 59 57 57 VAL VAL A . n A 1 60 PHE 60 58 58 PHE PHE A . n A 1 61 ILE 61 59 59 ILE ILE A . n A 1 62 LEU 62 60 60 LEU LEU A . n A 1 63 CYS 63 61 61 CYS CYS A . n A 1 64 ASP 64 62 62 ASP ASP A . n A 1 65 VAL 65 63 63 VAL VAL A . n A 1 66 THR 66 64 64 THR THR A . n A 1 67 GLN 67 65 65 GLN GLN A . n A 1 68 GLU 68 66 66 GLU GLU A . n A 1 69 ASP 69 67 67 ASP ASP A . n A 1 70 ASP 70 68 68 ASP ASP A . n A 1 71 VAL 71 69 69 VAL VAL A . n A 1 72 LYS 72 70 70 LYS LYS A . n A 1 73 THR 73 71 71 THR THR A . n A 1 74 LEU 74 72 72 LEU LEU A . n A 1 75 VAL 75 73 73 VAL VAL A . n A 1 76 SER 76 74 74 SER SER A . n A 1 77 GLU 77 75 75 GLU GLU A . n A 1 78 THR 78 76 76 THR THR A . n A 1 79 ILE 79 77 77 ILE ILE A . n A 1 80 ARG 80 78 78 ARG ARG A . n A 1 81 ARG 81 79 79 ARG ARG A . n A 1 82 PHE 82 80 80 PHE PHE A . n A 1 83 GLY 83 81 81 GLY GLY A . n A 1 84 ARG 84 82 82 ARG ARG A . n A 1 85 LEU 85 83 83 LEU LEU A . n A 1 86 ASP 86 84 84 ASP ASP A . n A 1 87 CYS 87 85 85 CYS CYS A . n A 1 88 VAL 88 86 86 VAL VAL A . n A 1 89 VAL 89 87 87 VAL VAL A . n A 1 90 ASN 90 88 88 ASN ASN A . n A 1 91 ASN 91 89 89 ASN ASN A . n A 1 92 ALA 92 90 90 ALA ALA A . n A 1 93 GLY 93 91 91 GLY GLY A . n A 1 94 HIS 94 92 92 HIS HIS A . n A 1 95 HIS 95 93 93 HIS HIS A . n A 1 96 PRO 96 94 94 PRO PRO A . n A 1 97 PRO 97 95 95 PRO PRO A . n A 1 98 PRO 98 96 96 PRO PRO A . n A 1 99 GLN 99 97 97 GLN GLN A . n A 1 100 ARG 100 98 98 ARG ARG A . n A 1 101 PRO 101 99 99 PRO PRO A . n A 1 102 GLU 102 100 100 GLU GLU A . n A 1 103 GLU 103 101 101 GLU GLU A . n A 1 104 THR 104 102 102 THR THR A . n A 1 105 SER 105 103 103 SER SER A . n A 1 106 ALA 106 104 104 ALA ALA A . n A 1 107 GLN 107 105 105 GLN GLN A . n A 1 108 GLY 108 106 106 GLY GLY A . n A 1 109 PHE 109 107 107 PHE PHE A . n A 1 110 ARG 110 108 108 ARG ARG A . n A 1 111 GLN 111 109 109 GLN GLN A . n A 1 112 LEU 112 110 110 LEU LEU A . n A 1 113 LEU 113 111 111 LEU LEU A . n A 1 114 GLU 114 112 112 GLU GLU A . n A 1 115 LEU 115 113 113 LEU LEU A . n A 1 116 ASN 116 114 114 ASN ASN A . n A 1 117 LEU 117 115 115 LEU LEU A . n A 1 118 LEU 118 116 116 LEU LEU A . n A 1 119 GLY 119 117 117 GLY GLY A . n A 1 120 THR 120 118 118 THR THR A . n A 1 121 TYR 121 119 119 TYR TYR A . n A 1 122 THR 122 120 120 THR THR A . n A 1 123 LEU 123 121 121 LEU LEU A . n A 1 124 THR 124 122 122 THR THR A . n A 1 125 LYS 125 123 123 LYS LYS A . n A 1 126 LEU 126 124 124 LEU LEU A . n A 1 127 ALA 127 125 125 ALA ALA A . n A 1 128 LEU 128 126 126 LEU LEU A . n A 1 129 PRO 129 127 127 PRO PRO A . n A 1 130 TYR 130 128 128 TYR TYR A . n A 1 131 LEU 131 129 129 LEU LEU A . n A 1 132 ARG 132 130 130 ARG ARG A . n A 1 133 LYS 133 131 131 LYS LYS A . n A 1 134 SER 134 132 132 SER SER A . n A 1 135 GLN 135 133 133 GLN GLN A . n A 1 136 GLY 136 134 134 GLY GLY A . n A 1 137 ASN 137 135 135 ASN ASN A . n A 1 138 VAL 138 136 136 VAL VAL A . n A 1 139 ILE 139 137 137 ILE ILE A . n A 1 140 ASN 140 138 138 ASN ASN A . n A 1 141 ILE 141 139 139 ILE ILE A . n A 1 142 SER 142 140 140 SER SER A . n A 1 143 SER 143 141 141 SER SER A . n A 1 144 LEU 144 142 142 LEU LEU A . n A 1 145 VAL 145 143 143 VAL VAL A . n A 1 146 GLY 146 144 144 GLY GLY A . n A 1 147 ALA 147 145 145 ALA ALA A . n A 1 148 ILE 148 146 146 ILE ILE A . n A 1 149 GLY 149 147 147 GLY GLY A . n A 1 150 GLN 150 148 148 GLN GLN A . n A 1 151 ALA 151 149 149 ALA ALA A . n A 1 152 GLN 152 150 150 GLN GLN A . n A 1 153 ALA 153 151 151 ALA ALA A . n A 1 154 VAL 154 152 152 VAL VAL A . n A 1 155 PRO 155 153 153 PRO PRO A . n A 1 156 TYR 156 154 154 TYR TYR A . n A 1 157 VAL 157 155 155 VAL VAL A . n A 1 158 ALA 158 156 156 ALA ALA A . n A 1 159 THR 159 157 157 THR THR A . n A 1 160 LYS 160 158 158 LYS LYS A . n A 1 161 GLY 161 159 159 GLY GLY A . n A 1 162 ALA 162 160 160 ALA ALA A . n A 1 163 VAL 163 161 161 VAL VAL A . n A 1 164 THR 164 162 162 THR THR A . n A 1 165 ALA 165 163 163 ALA ALA A . n A 1 166 MET 166 164 164 MET MET A . n A 1 167 THR 167 165 165 THR THR A . n A 1 168 LYS 168 166 166 LYS LYS A . n A 1 169 ALA 169 167 167 ALA ALA A . n A 1 170 LEU 170 168 168 LEU LEU A . n A 1 171 ALA 171 169 169 ALA ALA A . n A 1 172 LEU 172 170 170 LEU LEU A . n A 1 173 ASP 173 171 171 ASP ASP A . n A 1 174 GLU 174 172 172 GLU GLU A . n A 1 175 SER 175 173 173 SER SER A . n A 1 176 PRO 176 174 174 PRO PRO A . n A 1 177 TYR 177 175 175 TYR TYR A . n A 1 178 GLY 178 176 176 GLY GLY A . n A 1 179 VAL 179 177 177 VAL VAL A . n A 1 180 ARG 180 178 178 ARG ARG A . n A 1 181 VAL 181 179 179 VAL VAL A . n A 1 182 ASN 182 180 180 ASN ASN A . n A 1 183 CYS 183 181 181 CYS CYS A . n A 1 184 ILE 184 182 182 ILE ILE A . n A 1 185 SER 185 183 183 SER SER A . n A 1 186 PRO 186 184 184 PRO PRO A . n A 1 187 GLY 187 185 185 GLY GLY A . n A 1 188 ASN 188 186 186 ASN ASN A . n A 1 189 ILE 189 187 187 ILE ILE A . n A 1 190 TRP 190 188 188 TRP TRP A . n A 1 191 THR 191 189 189 THR THR A . n A 1 192 PRO 192 190 190 PRO PRO A . n A 1 193 LEU 193 191 191 LEU LEU A . n A 1 194 TRP 194 192 192 TRP TRP A . n A 1 195 GLU 195 193 193 GLU GLU A . n A 1 196 GLU 196 194 194 GLU GLU A . n A 1 197 LEU 197 195 195 LEU LEU A . n A 1 198 ALA 198 196 196 ALA ALA A . n A 1 199 ALA 199 197 197 ALA ALA A . n A 1 200 LEU 200 198 198 LEU LEU A . n A 1 201 MET 201 199 199 MET MET A . n A 1 202 PRO 202 200 200 PRO PRO A . n A 1 203 ASP 203 201 201 ASP ASP A . n A 1 204 PRO 204 202 202 PRO PRO A . n A 1 205 ARG 205 203 203 ARG ARG A . n A 1 206 ALA 206 204 204 ALA ALA A . n A 1 207 SER 207 205 205 SER SER A . n A 1 208 ILE 208 206 206 ILE ILE A . n A 1 209 ARG 209 207 207 ARG ARG A . n A 1 210 GLU 210 208 208 GLU GLU A . n A 1 211 GLY 211 209 209 GLY GLY A . n A 1 212 MET 212 210 210 MET MET A . n A 1 213 LEU 213 211 211 LEU LEU A . n A 1 214 ALA 214 212 212 ALA ALA A . n A 1 215 GLN 215 213 213 GLN GLN A . n A 1 216 PRO 216 214 214 PRO PRO A . n A 1 217 LEU 217 215 215 LEU LEU A . n A 1 218 GLY 218 216 216 GLY GLY A . n A 1 219 ARG 219 217 217 ARG ARG A . n A 1 220 MET 220 218 218 MET MET A . n A 1 221 GLY 221 219 219 GLY GLY A . n A 1 222 GLN 222 220 220 GLN GLN A . n A 1 223 PRO 223 221 221 PRO PRO A . n A 1 224 ALA 224 222 222 ALA ALA A . n A 1 225 GLU 225 223 223 GLU GLU A . n A 1 226 VAL 226 224 224 VAL VAL A . n A 1 227 GLY 227 225 225 GLY GLY A . n A 1 228 ALA 228 226 226 ALA ALA A . n A 1 229 ALA 229 227 227 ALA ALA A . n A 1 230 ALA 230 228 228 ALA ALA A . n A 1 231 VAL 231 229 229 VAL VAL A . n A 1 232 PHE 232 230 230 PHE PHE A . n A 1 233 LEU 233 231 231 LEU LEU A . n A 1 234 ALA 234 232 232 ALA ALA A . n A 1 235 SER 235 233 233 SER SER A . n A 1 236 GLU 236 234 234 GLU GLU A . n A 1 237 ALA 237 235 235 ALA ALA A . n A 1 238 ASN 238 236 236 ASN ASN A . n A 1 239 PHE 239 237 237 PHE PHE A . n A 1 240 CYS 240 238 238 CYS CYS A . n A 1 241 THR 241 239 239 THR THR A . n A 1 242 GLY 242 240 240 GLY GLY A . n A 1 243 ILE 243 241 241 ILE ILE A . n A 1 244 GLU 244 242 242 GLU GLU A . n A 1 245 LEU 245 243 243 LEU LEU A . n A 1 246 LEU 246 244 244 LEU LEU A . n A 1 247 VAL 247 245 245 VAL VAL A . n A 1 248 THR 248 246 246 THR THR A . n A 1 249 GLY 249 247 247 GLY GLY A . n A 1 250 GLY 250 248 248 GLY GLY A . n A 1 251 ALA 251 249 249 ALA ALA A . n A 1 252 GLU 252 250 250 GLU GLU A . n A 1 253 LEU 253 251 251 LEU LEU A . n A 1 254 GLY 254 252 252 GLY GLY A . n A 1 255 TYR 255 253 253 TYR TYR A . n A 1 256 GLY 256 254 254 GLY GLY A . n A 1 257 CYS 257 255 255 CYS CYS A . n A 1 258 LYS 258 256 256 LYS LYS A . n A 1 259 ALA 259 257 257 ALA ALA A . n A 1 260 SER 260 258 258 SER SER A . n A 1 261 ARG 261 259 259 ARG ARG A . n A 1 262 SER 262 260 260 SER SER A . n A 1 263 THR 263 261 261 THR THR A . n A 1 264 PRO 264 262 262 PRO PRO A . n A 1 265 VAL 265 263 263 VAL VAL A . n A 1 266 ASP 266 264 264 ASP ASP A . n A 1 267 ALA 267 265 265 ALA ALA A . n A 1 268 PRO 268 266 266 PRO PRO A . n A 1 269 ASP 269 267 267 ASP ASP A . n A 1 270 ILE 270 268 268 ILE ILE A . n A 1 271 PRO 271 269 269 PRO PRO A . n A 1 272 SER 272 270 270 SER SER A . n A 1 273 GLY 273 271 271 GLY GLY A . n A 1 274 SER 274 272 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NAD 1 301 1 NAD NAD A . C 3 NA 1 302 1 NA NA A . D 4 PGE 1 303 1 PGE PGE A . E 5 CL 1 304 1 CL CL A . F 6 HOH 1 401 89 HOH HOH A . F 6 HOH 2 402 32 HOH HOH A . F 6 HOH 3 403 107 HOH HOH A . F 6 HOH 4 404 108 HOH HOH A . F 6 HOH 5 405 60 HOH HOH A . F 6 HOH 6 406 72 HOH HOH A . F 6 HOH 7 407 23 HOH HOH A . F 6 HOH 8 408 11 HOH HOH A . F 6 HOH 9 409 113 HOH HOH A . F 6 HOH 10 410 19 HOH HOH A . F 6 HOH 11 411 43 HOH HOH A . F 6 HOH 12 412 51 HOH HOH A . F 6 HOH 13 413 4 HOH HOH A . F 6 HOH 14 414 55 HOH HOH A . F 6 HOH 15 415 22 HOH HOH A . F 6 HOH 16 416 44 HOH HOH A . F 6 HOH 17 417 109 HOH HOH A . F 6 HOH 18 418 5 HOH HOH A . F 6 HOH 19 419 3 HOH HOH A . F 6 HOH 20 420 16 HOH HOH A . F 6 HOH 21 421 47 HOH HOH A . F 6 HOH 22 422 66 HOH HOH A . F 6 HOH 23 423 40 HOH HOH A . F 6 HOH 24 424 24 HOH HOH A . F 6 HOH 25 425 14 HOH HOH A . F 6 HOH 26 426 77 HOH HOH A . F 6 HOH 27 427 34 HOH HOH A . F 6 HOH 28 428 37 HOH HOH A . F 6 HOH 29 429 30 HOH HOH A . F 6 HOH 30 430 33 HOH HOH A . F 6 HOH 31 431 15 HOH HOH A . F 6 HOH 32 432 27 HOH HOH A . F 6 HOH 33 433 49 HOH HOH A . F 6 HOH 34 434 106 HOH HOH A . F 6 HOH 35 435 21 HOH HOH A . F 6 HOH 36 436 9 HOH HOH A . F 6 HOH 37 437 67 HOH HOH A . F 6 HOH 38 438 26 HOH HOH A . F 6 HOH 39 439 6 HOH HOH A . F 6 HOH 40 440 18 HOH HOH A . F 6 HOH 41 441 88 HOH HOH A . F 6 HOH 42 442 10 HOH HOH A . F 6 HOH 43 443 121 HOH HOH A . F 6 HOH 44 444 79 HOH HOH A . F 6 HOH 45 445 36 HOH HOH A . F 6 HOH 46 446 52 HOH HOH A . F 6 HOH 47 447 31 HOH HOH A . F 6 HOH 48 448 117 HOH HOH A . F 6 HOH 49 449 42 HOH HOH A . F 6 HOH 50 450 118 HOH HOH A . F 6 HOH 51 451 112 HOH HOH A . F 6 HOH 52 452 8 HOH HOH A . F 6 HOH 53 453 57 HOH HOH A . F 6 HOH 54 454 17 HOH HOH A . F 6 HOH 55 455 105 HOH HOH A . F 6 HOH 56 456 2 HOH HOH A . F 6 HOH 57 457 65 HOH HOH A . F 6 HOH 58 458 45 HOH HOH A . F 6 HOH 59 459 12 HOH HOH A . F 6 HOH 60 460 111 HOH HOH A . F 6 HOH 61 461 69 HOH HOH A . F 6 HOH 62 462 1 HOH HOH A . F 6 HOH 63 463 68 HOH HOH A . F 6 HOH 64 464 62 HOH HOH A . F 6 HOH 65 465 123 HOH HOH A . F 6 HOH 66 466 41 HOH HOH A . F 6 HOH 67 467 102 HOH HOH A . F 6 HOH 68 468 81 HOH HOH A . F 6 HOH 69 469 85 HOH HOH A . F 6 HOH 70 470 46 HOH HOH A . F 6 HOH 71 471 110 HOH HOH A . F 6 HOH 72 472 99 HOH HOH A . F 6 HOH 73 473 124 HOH HOH A . F 6 HOH 74 474 133 HOH HOH A . F 6 HOH 75 475 48 HOH HOH A . F 6 HOH 76 476 7 HOH HOH A . F 6 HOH 77 477 50 HOH HOH A . F 6 HOH 78 478 116 HOH HOH A . F 6 HOH 79 479 91 HOH HOH A . F 6 HOH 80 480 134 HOH HOH A . F 6 HOH 81 481 128 HOH HOH A . F 6 HOH 82 482 126 HOH HOH A . F 6 HOH 83 483 136 HOH HOH A . F 6 HOH 84 484 120 HOH HOH A . F 6 HOH 85 485 135 HOH HOH A . F 6 HOH 86 486 119 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 41 ? CE ? A LYS 43 CE 2 1 Y 1 A LYS 41 ? NZ ? A LYS 43 NZ 3 1 Y 1 A GLN 51 ? CD ? A GLN 53 CD 4 1 Y 1 A GLN 51 ? OE1 ? A GLN 53 OE1 5 1 Y 1 A GLN 51 ? NE2 ? A GLN 53 NE2 6 1 Y 1 A GLU 66 ? CG ? A GLU 68 CG 7 1 Y 1 A GLU 66 ? CD ? A GLU 68 CD 8 1 Y 1 A GLU 66 ? OE1 ? A GLU 68 OE1 9 1 Y 1 A GLU 66 ? OE2 ? A GLU 68 OE2 10 1 Y 1 A LYS 70 ? CD ? A LYS 72 CD 11 1 Y 1 A LYS 70 ? CE ? A LYS 72 CE 12 1 Y 1 A LYS 70 ? NZ ? A LYS 72 NZ 13 1 Y 1 A ARG 98 ? CD ? A ARG 100 CD 14 1 Y 1 A ARG 98 ? NE ? A ARG 100 NE 15 1 Y 1 A ARG 98 ? CZ ? A ARG 100 CZ 16 1 Y 1 A ARG 98 ? NH1 ? A ARG 100 NH1 17 1 Y 1 A ARG 98 ? NH2 ? A ARG 100 NH2 18 1 Y 1 A LYS 131 ? CD ? A LYS 133 CD 19 1 Y 1 A LYS 131 ? CE ? A LYS 133 CE 20 1 Y 1 A LYS 131 ? NZ ? A LYS 133 NZ 21 1 Y 1 A ARG 259 ? CG ? A ARG 261 CG 22 1 Y 1 A ARG 259 ? CD ? A ARG 261 CD 23 1 Y 1 A ARG 259 ? NE ? A ARG 261 NE 24 1 Y 1 A ARG 259 ? CZ ? A ARG 261 CZ 25 1 Y 1 A ARG 259 ? NH1 ? A ARG 261 NH1 26 1 Y 1 A ARG 259 ? NH2 ? A ARG 261 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.10.1_2155: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5JSF _cell.details ? _cell.formula_units_Z ? _cell.length_a 130.256 _cell.length_a_esd ? _cell.length_b 130.256 _cell.length_b_esd ? _cell.length_c 130.256 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5JSF _symmetry.cell_setting ? _symmetry.Int_Tables_number 197 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 2 3' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5JSF _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.22 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 61.77 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'HEPES 0.1 M pH 7.00, sodium formate 3.3 M' _exptl_crystal_grow.pdbx_pH_range 7-8 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-04-15 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.972420 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID23-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.972420 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID23-1 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5JSF _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.84 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 31827 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.66 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.047 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 21.35 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.84 _reflns_shell.d_res_low 1.95 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 4.2 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 99.6 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.491 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 6.82 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5JSF _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.842 _refine.ls_d_res_low 46.052 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 31827 _refine.ls_number_reflns_R_free 1592 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.89 _refine.ls_percent_reflns_R_free 5.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1658 _refine.ls_R_factor_R_free 0.1866 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1647 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.37 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5EN4 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 19.56 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.16 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1942 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 56 _refine_hist.number_atoms_solvent 86 _refine_hist.number_atoms_total 2084 _refine_hist.d_res_high 1.842 _refine_hist.d_res_low 46.052 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 ? 2040 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.817 ? 2785 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 17.734 ? 1234 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.056 ? 325 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 384 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.8421 1.9016 . . 143 2707 99.00 . . . 0.2660 . 0.2370 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9016 1.9695 . . 144 2746 100.00 . . . 0.2335 . 0.2070 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9695 2.0484 . . 144 2722 100.00 . . . 0.2516 . 0.1938 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0484 2.1416 . . 143 2728 100.00 . . . 0.2014 . 0.1815 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1416 2.2545 . . 143 2714 100.00 . . . 0.2086 . 0.1734 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2545 2.3958 . . 144 2734 100.00 . . . 0.2060 . 0.1690 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3958 2.5807 . . 144 2746 100.00 . . . 0.1985 . 0.1651 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5807 2.8404 . . 145 2754 100.00 . . . 0.1961 . 0.1654 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8404 3.2513 . . 145 2751 100.00 . . . 0.1797 . 0.1660 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2513 4.0959 . . 146 2779 100.00 . . . 0.1582 . 0.1567 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.0959 46.0668 . . 151 2854 100.00 . . . 0.1810 . 0.1547 . . . . . . . . . . # _struct.entry_id 5JSF _struct.title 'Crystal structure of 17beta-hydroxysteroid dehydrogenase 14 S205 variant in complex with NAD.' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5JSF _struct_keywords.text 'cofactor complex, hydroxysteroid dehydrogenase, oxidoreductase' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 6 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DHB14_HUMAN _struct_ref.pdbx_db_accession Q9BPX1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRF GRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGA VTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTG IELLVTGGAELGYGCKASRSTPVDAPDIPS ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5JSF _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 272 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9BPX1 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 270 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 270 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5JSF GLY A 1 ? UNP Q9BPX1 ? ? 'expression tag' -1 1 1 5JSF HIS A 2 ? UNP Q9BPX1 ? ? 'expression tag' 0 2 1 5JSF SER A 207 ? UNP Q9BPX1 THR 205 conflict 205 3 1 5JSF GLY A 273 ? UNP Q9BPX1 ? ? 'expression tag' 271 4 1 5JSF SER A 274 ? UNP Q9BPX1 ? ? 'expression tag' 272 5 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 25200 ? 1 MORE -264 ? 1 'SSA (A^2)' 34080 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_556 -x,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 130.2560000000 4 'crystal symmetry operation' 4_556 x,-y,-z+1 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 130.2560000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ARG A 21 ? SER A 34 ? ARG A 19 SER A 32 1 ? 14 HELX_P HELX_P2 AA2 ASP A 44 ? LEU A 55 ? ASP A 42 LEU A 53 1 ? 12 HELX_P HELX_P3 AA3 GLN A 67 ? GLY A 83 ? GLN A 65 GLY A 81 1 ? 17 HELX_P HELX_P4 AA4 ARG A 100 ? THR A 104 ? ARG A 98 THR A 102 5 ? 5 HELX_P HELX_P5 AA5 SER A 105 ? LEU A 117 ? SER A 103 LEU A 115 1 ? 13 HELX_P HELX_P6 AA6 LEU A 117 ? GLN A 135 ? LEU A 115 GLN A 133 1 ? 19 HELX_P HELX_P7 AA7 LEU A 144 ? GLY A 149 ? LEU A 142 GLY A 147 1 ? 6 HELX_P HELX_P8 AA8 ALA A 153 ? SER A 175 ? ALA A 151 SER A 173 1 ? 23 HELX_P HELX_P9 AA9 PRO A 176 ? GLY A 178 ? PRO A 174 GLY A 176 5 ? 3 HELX_P HELX_P10 AB1 THR A 191 ? ALA A 199 ? THR A 189 ALA A 197 1 ? 9 HELX_P HELX_P11 AB2 ASP A 203 ? ALA A 214 ? ASP A 201 ALA A 212 1 ? 12 HELX_P HELX_P12 AB3 GLN A 222 ? GLU A 236 ? GLN A 220 GLU A 234 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLU 52 O ? ? ? 1_555 C NA . NA ? ? A GLU 50 A NA 302 1_555 ? ? ? ? ? ? ? 2.499 ? ? metalc2 metalc ? ? A LEU 55 O ? ? ? 1_555 C NA . NA ? ? A LEU 53 A NA 302 1_555 ? ? ? ? ? ? ? 2.772 ? ? metalc3 metalc ? ? A ALA 58 O ? ? ? 1_555 C NA . NA ? ? A ALA 56 A NA 302 1_555 ? ? ? ? ? ? ? 2.299 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A GLU 52 ? A GLU 50 ? 1_555 NA ? C NA . ? A NA 302 ? 1_555 O ? A LEU 55 ? A LEU 53 ? 1_555 75.1 ? 2 O ? A GLU 52 ? A GLU 50 ? 1_555 NA ? C NA . ? A NA 302 ? 1_555 O ? A ALA 58 ? A ALA 56 ? 1_555 101.0 ? 3 O ? A LEU 55 ? A LEU 53 ? 1_555 NA ? C NA . ? A NA 302 ? 1_555 O ? A ALA 58 ? A ALA 56 ? 1_555 82.9 ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ALA A 58 ? LEU A 62 ? ALA A 56 LEU A 60 AA1 2 ARG A 37 ? ASP A 42 ? ARG A 35 ASP A 40 AA1 3 VAL A 13 ? THR A 17 ? VAL A 11 THR A 15 AA1 4 CYS A 87 ? ASN A 90 ? CYS A 85 ASN A 88 AA1 5 ASN A 137 ? ILE A 141 ? ASN A 135 ILE A 139 AA1 6 ARG A 180 ? PRO A 186 ? ARG A 178 PRO A 184 AA1 7 GLU A 244 ? VAL A 247 ? GLU A 242 VAL A 245 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O VAL A 59 ? O VAL A 57 N ILE A 40 ? N ILE A 38 AA1 2 3 O VAL A 39 ? O VAL A 37 N VAL A 14 ? N VAL A 12 AA1 3 4 N VAL A 15 ? N VAL A 13 O VAL A 89 ? O VAL A 87 AA1 4 5 N VAL A 88 ? N VAL A 86 O ILE A 139 ? O ILE A 137 AA1 5 6 N VAL A 138 ? N VAL A 136 O ASN A 182 ? O ASN A 180 AA1 6 7 N CYS A 183 ? N CYS A 181 O LEU A 245 ? O LEU A 243 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A NAD 301 ? 25 'binding site for residue NAD A 301' AC2 Software A NA 302 ? 3 'binding site for residue NA A 302' AC3 Software A PGE 303 ? 6 'binding site for residue PGE A 303' AC4 Software A CL 304 ? 2 'binding site for residue CL A 304' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 25 GLY A 18 ? GLY A 16 . ? 1_555 ? 2 AC1 25 ARG A 21 ? ARG A 19 . ? 1_555 ? 3 AC1 25 GLY A 22 ? GLY A 20 . ? 1_555 ? 4 AC1 25 ILE A 23 ? ILE A 21 . ? 1_555 ? 5 AC1 25 ASP A 42 ? ASP A 40 . ? 1_555 ? 6 AC1 25 LYS A 43 ? LYS A 41 . ? 1_555 ? 7 AC1 25 CYS A 63 ? CYS A 61 . ? 1_555 ? 8 AC1 25 ASP A 64 ? ASP A 62 . ? 1_555 ? 9 AC1 25 VAL A 65 ? VAL A 63 . ? 1_555 ? 10 AC1 25 ASN A 91 ? ASN A 89 . ? 1_555 ? 11 AC1 25 GLY A 93 ? GLY A 91 . ? 1_555 ? 12 AC1 25 LEU A 115 ? LEU A 113 . ? 1_555 ? 13 AC1 25 ILE A 141 ? ILE A 139 . ? 1_555 ? 14 AC1 25 SER A 142 ? SER A 140 . ? 1_555 ? 15 AC1 25 SER A 143 ? SER A 141 . ? 1_555 ? 16 AC1 25 TYR A 156 ? TYR A 154 . ? 1_555 ? 17 AC1 25 LYS A 160 ? LYS A 158 . ? 1_555 ? 18 AC1 25 PRO A 186 ? PRO A 184 . ? 1_555 ? 19 AC1 25 GLY A 187 ? GLY A 185 . ? 1_555 ? 20 AC1 25 ILE A 189 ? ILE A 187 . ? 1_555 ? 21 AC1 25 THR A 191 ? THR A 189 . ? 1_555 ? 22 AC1 25 LEU A 193 ? LEU A 191 . ? 1_555 ? 23 AC1 25 TRP A 194 ? TRP A 192 . ? 1_555 ? 24 AC1 25 HOH F . ? HOH A 428 . ? 1_555 ? 25 AC1 25 HOH F . ? HOH A 445 . ? 1_555 ? 26 AC2 3 GLU A 52 ? GLU A 50 . ? 1_555 ? 27 AC2 3 LEU A 55 ? LEU A 53 . ? 1_555 ? 28 AC2 3 ALA A 58 ? ALA A 56 . ? 1_555 ? 29 AC3 6 ARG A 84 ? ARG A 82 . ? 18_445 ? 30 AC3 6 ARG A 205 ? ARG A 203 . ? 1_555 ? 31 AC3 6 ILE A 208 ? ILE A 206 . ? 1_555 ? 32 AC3 6 PRO A 268 ? PRO A 266 . ? 3_556 ? 33 AC3 6 ASP A 269 ? ASP A 267 . ? 3_556 ? 34 AC3 6 HOH F . ? HOH A 451 . ? 1_555 ? 35 AC4 2 ALA A 151 ? ALA A 149 . ? 1_555 ? 36 AC4 2 TYR A 255 ? TYR A 253 . ? 3_556 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 140 ? ? -97.55 -134.52 2 1 ALA A 151 ? ? -155.93 39.35 3 1 ALA A 235 ? ? -105.42 54.82 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 437 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id F _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined -26.4623 -1.4828 50.9989 0.2460 0.3981 0.7351 -0.0019 -0.1035 -0.1716 0.0786 0.0284 1.1981 0.0630 -0.2312 -0.0882 -0.1983 0.2571 0.0781 0.0512 -0.1456 0.3223 0.1876 -0.4874 -0.2268 'X-RAY DIFFRACTION' 2 ? refined -26.6501 -6.4544 40.3665 0.3614 0.5359 0.8118 -0.0960 -0.0922 -0.3262 0.5172 0.4679 0.4240 -0.2917 0.2961 -0.4151 0.1393 0.2817 0.1369 -0.1626 -0.4300 0.8135 0.3214 -0.7126 -0.2330 'X-RAY DIFFRACTION' 3 ? refined -20.6238 3.5226 41.0381 0.3577 0.4058 0.7277 0.0273 -0.1725 -0.0869 0.1660 0.4667 0.8302 0.0531 -0.1082 -0.5474 -0.1880 0.2379 0.1151 -0.2853 -0.0973 0.2187 0.0579 -0.3265 -0.2989 'X-RAY DIFFRACTION' 4 ? refined -7.4033 0.4387 48.5097 0.2611 0.2403 0.5704 0.0045 -0.0447 -0.0441 0.5201 0.2838 0.3770 0.4705 0.0588 -0.1200 -0.1941 0.1336 0.0034 -0.1801 -0.0487 0.1772 0.0357 -0.0596 -0.0577 'X-RAY DIFFRACTION' 5 ? refined -11.3417 -21.3773 55.5410 0.3626 0.2301 0.6080 -0.0342 0.1109 -0.0784 0.0237 0.0039 0.3268 -0.0124 0.1755 -0.0350 -0.0144 -0.0479 -0.0083 -0.0481 -0.1776 0.1945 0.4794 -0.0738 -0.0051 'X-RAY DIFFRACTION' 6 ? refined -14.1250 -2.4214 62.6127 0.1925 0.2773 0.6505 -0.0078 -0.0045 -0.1039 0.5412 0.1808 0.5333 0.0980 -0.1586 0.0644 -0.1057 0.0198 0.0077 0.0254 -0.1612 0.2061 0.0132 -0.1603 -0.3419 'X-RAY DIFFRACTION' 7 ? refined 12.8044 -23.9632 64.5969 0.5415 0.4379 0.7203 0.0837 0.0748 -0.0000 0.0242 0.0323 -0.0323 -0.0390 -0.0110 0.0178 0.3006 0.6099 -0.4520 0.2508 -0.2338 -0.4877 0.6917 0.5427 0.0011 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 4 through 39 ) ; 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 40 through 63 ) ; 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 64 through 93 ) ; 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 94 through 185 ) ; 'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 186 through 220 ) ; 'X-RAY DIFFRACTION' 6 6 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 221 through 254 ) ; 'X-RAY DIFFRACTION' 7 7 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 255 through 271 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -1 ? A GLY 1 2 1 Y 1 A HIS 0 ? A HIS 2 3 1 Y 1 A MET 1 ? A MET 3 4 1 Y 1 A ALA 2 ? A ALA 4 5 1 Y 1 A THR 3 ? A THR 5 6 1 Y 1 A SER 272 ? A SER 274 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 NA NA NA N N 251 NAD PA P N S 252 NAD O1A O N N 253 NAD O2A O N N 254 NAD O5B O N N 255 NAD C5B C N N 256 NAD C4B C N R 257 NAD O4B O N N 258 NAD C3B C N S 259 NAD O3B O N N 260 NAD C2B C N R 261 NAD O2B O N N 262 NAD C1B C N R 263 NAD N9A N Y N 264 NAD C8A C Y N 265 NAD N7A N Y N 266 NAD C5A C Y N 267 NAD C6A C Y N 268 NAD N6A N N N 269 NAD N1A N Y N 270 NAD C2A C Y N 271 NAD N3A N Y N 272 NAD C4A C Y N 273 NAD O3 O N N 274 NAD PN P N N 275 NAD O1N O N N 276 NAD O2N O N N 277 NAD O5D O N N 278 NAD C5D C N N 279 NAD C4D C N R 280 NAD O4D O N N 281 NAD C3D C N S 282 NAD O3D O N N 283 NAD C2D C N R 284 NAD O2D O N N 285 NAD C1D C N R 286 NAD N1N N Y N 287 NAD C2N C Y N 288 NAD C3N C Y N 289 NAD C7N C N N 290 NAD O7N O N N 291 NAD N7N N N N 292 NAD C4N C Y N 293 NAD C5N C Y N 294 NAD C6N C Y N 295 NAD HOA2 H N N 296 NAD H51A H N N 297 NAD H52A H N N 298 NAD H4B H N N 299 NAD H3B H N N 300 NAD HO3A H N N 301 NAD H2B H N N 302 NAD HO2A H N N 303 NAD H1B H N N 304 NAD H8A H N N 305 NAD H61A H N N 306 NAD H62A H N N 307 NAD H2A H N N 308 NAD H51N H N N 309 NAD H52N H N N 310 NAD H4D H N N 311 NAD H3D H N N 312 NAD HO3N H N N 313 NAD H2D H N N 314 NAD HO2N H N N 315 NAD H1D H N N 316 NAD H2N H N N 317 NAD H71N H N N 318 NAD H72N H N N 319 NAD H4N H N N 320 NAD H5N H N N 321 NAD H6N H N N 322 PGE C1 C N N 323 PGE O1 O N N 324 PGE C2 C N N 325 PGE O2 O N N 326 PGE C3 C N N 327 PGE C4 C N N 328 PGE O4 O N N 329 PGE C6 C N N 330 PGE C5 C N N 331 PGE O3 O N N 332 PGE H1 H N N 333 PGE H12 H N N 334 PGE HO1 H N N 335 PGE H2 H N N 336 PGE H22 H N N 337 PGE H3 H N N 338 PGE H32 H N N 339 PGE H4 H N N 340 PGE H42 H N N 341 PGE HO4 H N N 342 PGE H6 H N N 343 PGE H62 H N N 344 PGE H5 H N N 345 PGE H52 H N N 346 PHE N N N N 347 PHE CA C N S 348 PHE C C N N 349 PHE O O N N 350 PHE CB C N N 351 PHE CG C Y N 352 PHE CD1 C Y N 353 PHE CD2 C Y N 354 PHE CE1 C Y N 355 PHE CE2 C Y N 356 PHE CZ C Y N 357 PHE OXT O N N 358 PHE H H N N 359 PHE H2 H N N 360 PHE HA H N N 361 PHE HB2 H N N 362 PHE HB3 H N N 363 PHE HD1 H N N 364 PHE HD2 H N N 365 PHE HE1 H N N 366 PHE HE2 H N N 367 PHE HZ H N N 368 PHE HXT H N N 369 PRO N N N N 370 PRO CA C N S 371 PRO C C N N 372 PRO O O N N 373 PRO CB C N N 374 PRO CG C N N 375 PRO CD C N N 376 PRO OXT O N N 377 PRO H H N N 378 PRO HA H N N 379 PRO HB2 H N N 380 PRO HB3 H N N 381 PRO HG2 H N N 382 PRO HG3 H N N 383 PRO HD2 H N N 384 PRO HD3 H N N 385 PRO HXT H N N 386 SER N N N N 387 SER CA C N S 388 SER C C N N 389 SER O O N N 390 SER CB C N N 391 SER OG O N N 392 SER OXT O N N 393 SER H H N N 394 SER H2 H N N 395 SER HA H N N 396 SER HB2 H N N 397 SER HB3 H N N 398 SER HG H N N 399 SER HXT H N N 400 THR N N N N 401 THR CA C N S 402 THR C C N N 403 THR O O N N 404 THR CB C N R 405 THR OG1 O N N 406 THR CG2 C N N 407 THR OXT O N N 408 THR H H N N 409 THR H2 H N N 410 THR HA H N N 411 THR HB H N N 412 THR HG1 H N N 413 THR HG21 H N N 414 THR HG22 H N N 415 THR HG23 H N N 416 THR HXT H N N 417 TRP N N N N 418 TRP CA C N S 419 TRP C C N N 420 TRP O O N N 421 TRP CB C N N 422 TRP CG C Y N 423 TRP CD1 C Y N 424 TRP CD2 C Y N 425 TRP NE1 N Y N 426 TRP CE2 C Y N 427 TRP CE3 C Y N 428 TRP CZ2 C Y N 429 TRP CZ3 C Y N 430 TRP CH2 C Y N 431 TRP OXT O N N 432 TRP H H N N 433 TRP H2 H N N 434 TRP HA H N N 435 TRP HB2 H N N 436 TRP HB3 H N N 437 TRP HD1 H N N 438 TRP HE1 H N N 439 TRP HE3 H N N 440 TRP HZ2 H N N 441 TRP HZ3 H N N 442 TRP HH2 H N N 443 TRP HXT H N N 444 TYR N N N N 445 TYR CA C N S 446 TYR C C N N 447 TYR O O N N 448 TYR CB C N N 449 TYR CG C Y N 450 TYR CD1 C Y N 451 TYR CD2 C Y N 452 TYR CE1 C Y N 453 TYR CE2 C Y N 454 TYR CZ C Y N 455 TYR OH O N N 456 TYR OXT O N N 457 TYR H H N N 458 TYR H2 H N N 459 TYR HA H N N 460 TYR HB2 H N N 461 TYR HB3 H N N 462 TYR HD1 H N N 463 TYR HD2 H N N 464 TYR HE1 H N N 465 TYR HE2 H N N 466 TYR HH H N N 467 TYR HXT H N N 468 VAL N N N N 469 VAL CA C N S 470 VAL C C N N 471 VAL O O N N 472 VAL CB C N N 473 VAL CG1 C N N 474 VAL CG2 C N N 475 VAL OXT O N N 476 VAL H H N N 477 VAL H2 H N N 478 VAL HA H N N 479 VAL HB H N N 480 VAL HG11 H N N 481 VAL HG12 H N N 482 VAL HG13 H N N 483 VAL HG21 H N N 484 VAL HG22 H N N 485 VAL HG23 H N N 486 VAL HXT H N N 487 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 NAD PA O1A doub N N 237 NAD PA O2A sing N N 238 NAD PA O5B sing N N 239 NAD PA O3 sing N N 240 NAD O2A HOA2 sing N N 241 NAD O5B C5B sing N N 242 NAD C5B C4B sing N N 243 NAD C5B H51A sing N N 244 NAD C5B H52A sing N N 245 NAD C4B O4B sing N N 246 NAD C4B C3B sing N N 247 NAD C4B H4B sing N N 248 NAD O4B C1B sing N N 249 NAD C3B O3B sing N N 250 NAD C3B C2B sing N N 251 NAD C3B H3B sing N N 252 NAD O3B HO3A sing N N 253 NAD C2B O2B sing N N 254 NAD C2B C1B sing N N 255 NAD C2B H2B sing N N 256 NAD O2B HO2A sing N N 257 NAD C1B N9A sing N N 258 NAD C1B H1B sing N N 259 NAD N9A C8A sing Y N 260 NAD N9A C4A sing Y N 261 NAD C8A N7A doub Y N 262 NAD C8A H8A sing N N 263 NAD N7A C5A sing Y N 264 NAD C5A C6A sing Y N 265 NAD C5A C4A doub Y N 266 NAD C6A N6A sing N N 267 NAD C6A N1A doub Y N 268 NAD N6A H61A sing N N 269 NAD N6A H62A sing N N 270 NAD N1A C2A sing Y N 271 NAD C2A N3A doub Y N 272 NAD C2A H2A sing N N 273 NAD N3A C4A sing Y N 274 NAD O3 PN sing N N 275 NAD PN O1N doub N N 276 NAD PN O2N sing N N 277 NAD PN O5D sing N N 278 NAD O5D C5D sing N N 279 NAD C5D C4D sing N N 280 NAD C5D H51N sing N N 281 NAD C5D H52N sing N N 282 NAD C4D O4D sing N N 283 NAD C4D C3D sing N N 284 NAD C4D H4D sing N N 285 NAD O4D C1D sing N N 286 NAD C3D O3D sing N N 287 NAD C3D C2D sing N N 288 NAD C3D H3D sing N N 289 NAD O3D HO3N sing N N 290 NAD C2D O2D sing N N 291 NAD C2D C1D sing N N 292 NAD C2D H2D sing N N 293 NAD O2D HO2N sing N N 294 NAD C1D N1N sing N N 295 NAD C1D H1D sing N N 296 NAD N1N C2N sing Y N 297 NAD N1N C6N doub Y N 298 NAD C2N C3N doub Y N 299 NAD C2N H2N sing N N 300 NAD C3N C7N sing N N 301 NAD C3N C4N sing Y N 302 NAD C7N O7N doub N N 303 NAD C7N N7N sing N N 304 NAD N7N H71N sing N N 305 NAD N7N H72N sing N N 306 NAD C4N C5N doub Y N 307 NAD C4N H4N sing N N 308 NAD C5N C6N sing Y N 309 NAD C5N H5N sing N N 310 NAD C6N H6N sing N N 311 PGE C1 O1 sing N N 312 PGE C1 C2 sing N N 313 PGE C1 H1 sing N N 314 PGE C1 H12 sing N N 315 PGE O1 HO1 sing N N 316 PGE C2 O2 sing N N 317 PGE C2 H2 sing N N 318 PGE C2 H22 sing N N 319 PGE O2 C3 sing N N 320 PGE C3 C4 sing N N 321 PGE C3 H3 sing N N 322 PGE C3 H32 sing N N 323 PGE C4 O3 sing N N 324 PGE C4 H4 sing N N 325 PGE C4 H42 sing N N 326 PGE O4 C6 sing N N 327 PGE O4 HO4 sing N N 328 PGE C6 C5 sing N N 329 PGE C6 H6 sing N N 330 PGE C6 H62 sing N N 331 PGE C5 O3 sing N N 332 PGE C5 H5 sing N N 333 PGE C5 H52 sing N N 334 PHE N CA sing N N 335 PHE N H sing N N 336 PHE N H2 sing N N 337 PHE CA C sing N N 338 PHE CA CB sing N N 339 PHE CA HA sing N N 340 PHE C O doub N N 341 PHE C OXT sing N N 342 PHE CB CG sing N N 343 PHE CB HB2 sing N N 344 PHE CB HB3 sing N N 345 PHE CG CD1 doub Y N 346 PHE CG CD2 sing Y N 347 PHE CD1 CE1 sing Y N 348 PHE CD1 HD1 sing N N 349 PHE CD2 CE2 doub Y N 350 PHE CD2 HD2 sing N N 351 PHE CE1 CZ doub Y N 352 PHE CE1 HE1 sing N N 353 PHE CE2 CZ sing Y N 354 PHE CE2 HE2 sing N N 355 PHE CZ HZ sing N N 356 PHE OXT HXT sing N N 357 PRO N CA sing N N 358 PRO N CD sing N N 359 PRO N H sing N N 360 PRO CA C sing N N 361 PRO CA CB sing N N 362 PRO CA HA sing N N 363 PRO C O doub N N 364 PRO C OXT sing N N 365 PRO CB CG sing N N 366 PRO CB HB2 sing N N 367 PRO CB HB3 sing N N 368 PRO CG CD sing N N 369 PRO CG HG2 sing N N 370 PRO CG HG3 sing N N 371 PRO CD HD2 sing N N 372 PRO CD HD3 sing N N 373 PRO OXT HXT sing N N 374 SER N CA sing N N 375 SER N H sing N N 376 SER N H2 sing N N 377 SER CA C sing N N 378 SER CA CB sing N N 379 SER CA HA sing N N 380 SER C O doub N N 381 SER C OXT sing N N 382 SER CB OG sing N N 383 SER CB HB2 sing N N 384 SER CB HB3 sing N N 385 SER OG HG sing N N 386 SER OXT HXT sing N N 387 THR N CA sing N N 388 THR N H sing N N 389 THR N H2 sing N N 390 THR CA C sing N N 391 THR CA CB sing N N 392 THR CA HA sing N N 393 THR C O doub N N 394 THR C OXT sing N N 395 THR CB OG1 sing N N 396 THR CB CG2 sing N N 397 THR CB HB sing N N 398 THR OG1 HG1 sing N N 399 THR CG2 HG21 sing N N 400 THR CG2 HG22 sing N N 401 THR CG2 HG23 sing N N 402 THR OXT HXT sing N N 403 TRP N CA sing N N 404 TRP N H sing N N 405 TRP N H2 sing N N 406 TRP CA C sing N N 407 TRP CA CB sing N N 408 TRP CA HA sing N N 409 TRP C O doub N N 410 TRP C OXT sing N N 411 TRP CB CG sing N N 412 TRP CB HB2 sing N N 413 TRP CB HB3 sing N N 414 TRP CG CD1 doub Y N 415 TRP CG CD2 sing Y N 416 TRP CD1 NE1 sing Y N 417 TRP CD1 HD1 sing N N 418 TRP CD2 CE2 doub Y N 419 TRP CD2 CE3 sing Y N 420 TRP NE1 CE2 sing Y N 421 TRP NE1 HE1 sing N N 422 TRP CE2 CZ2 sing Y N 423 TRP CE3 CZ3 doub Y N 424 TRP CE3 HE3 sing N N 425 TRP CZ2 CH2 doub Y N 426 TRP CZ2 HZ2 sing N N 427 TRP CZ3 CH2 sing Y N 428 TRP CZ3 HZ3 sing N N 429 TRP CH2 HH2 sing N N 430 TRP OXT HXT sing N N 431 TYR N CA sing N N 432 TYR N H sing N N 433 TYR N H2 sing N N 434 TYR CA C sing N N 435 TYR CA CB sing N N 436 TYR CA HA sing N N 437 TYR C O doub N N 438 TYR C OXT sing N N 439 TYR CB CG sing N N 440 TYR CB HB2 sing N N 441 TYR CB HB3 sing N N 442 TYR CG CD1 doub Y N 443 TYR CG CD2 sing Y N 444 TYR CD1 CE1 sing Y N 445 TYR CD1 HD1 sing N N 446 TYR CD2 CE2 doub Y N 447 TYR CD2 HD2 sing N N 448 TYR CE1 CZ doub Y N 449 TYR CE1 HE1 sing N N 450 TYR CE2 CZ sing Y N 451 TYR CE2 HE2 sing N N 452 TYR CZ OH sing N N 453 TYR OH HH sing N N 454 TYR OXT HXT sing N N 455 VAL N CA sing N N 456 VAL N H sing N N 457 VAL N H2 sing N N 458 VAL CA C sing N N 459 VAL CA CB sing N N 460 VAL CA HA sing N N 461 VAL C O doub N N 462 VAL C OXT sing N N 463 VAL CB CG1 sing N N 464 VAL CB CG2 sing N N 465 VAL CB HB sing N N 466 VAL CG1 HG11 sing N N 467 VAL CG1 HG12 sing N N 468 VAL CG1 HG13 sing N N 469 VAL CG2 HG21 sing N N 470 VAL CG2 HG22 sing N N 471 VAL CG2 HG23 sing N N 472 VAL OXT HXT sing N N 473 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'German Research Foundation' Germany MA-5287/1-1 1 'German Research Foundation' Germany KL-1204/15-1 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5EN4 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 5JSF _atom_sites.fract_transf_matrix[1][1] 0.007677 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.007677 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007677 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL N NA O P S # loop_