data_5K2L # _entry.id 5K2L # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5K2L pdb_00005k2l 10.2210/pdb5k2l/pdb WWPDB D_1000221452 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5K2L _pdbx_database_status.recvd_initial_deposition_date 2016-05-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kitaoku, Y.' 1 'Numata, T.' 2 'Fukamizo, T.' 3 'Ohnuma, T.' 4 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country NE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Plant Mol. Biol.' _citation.journal_id_ASTM PMBIDB _citation.journal_id_CSD 2006 _citation.journal_id_ISSN 1573-5028 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 93 _citation.language ? _citation.page_first 97 _citation.page_last 108 _citation.title 'Chitin oligosaccharide binding to the lysin motif of a novel type of chitinase from the multicellular green alga, Volvox carteri.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1007/s11103-016-0549-5 _citation.pdbx_database_id_PubMed 27807643 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kitaoku, Y.' 1 ? primary 'Fukamizo, T.' 2 ? primary 'Numata, T.' 3 ? primary 'Ohnuma, T.' 4 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5K2L _cell.details ? _cell.formula_units_Z ? _cell.length_a 29.130 _cell.length_a_esd ? _cell.length_b 29.130 _cell.length_b_esd ? _cell.length_c 94.257 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5K2L _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Chitinase, lysozyme' 5290.043 1 ? ? 'UNP RESIDUES 104-151' ? 2 non-polymer syn 1,2-ETHANEDIOL 62.068 1 ? ? ? ? 3 water nat water 18.015 89 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MGCTYTIQPGDTFWAIAQRRGTTVDVIQSLNPGVNPARLQVGQVINVPC _entity_poly.pdbx_seq_one_letter_code_can MGCTYTIQPGDTFWAIAQRRGTTVDVIQSLNPGVNPARLQVGQVINVPC _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 CYS n 1 4 THR n 1 5 TYR n 1 6 THR n 1 7 ILE n 1 8 GLN n 1 9 PRO n 1 10 GLY n 1 11 ASP n 1 12 THR n 1 13 PHE n 1 14 TRP n 1 15 ALA n 1 16 ILE n 1 17 ALA n 1 18 GLN n 1 19 ARG n 1 20 ARG n 1 21 GLY n 1 22 THR n 1 23 THR n 1 24 VAL n 1 25 ASP n 1 26 VAL n 1 27 ILE n 1 28 GLN n 1 29 SER n 1 30 LEU n 1 31 ASN n 1 32 PRO n 1 33 GLY n 1 34 VAL n 1 35 ASN n 1 36 PRO n 1 37 ALA n 1 38 ARG n 1 39 LEU n 1 40 GLN n 1 41 VAL n 1 42 GLY n 1 43 GLN n 1 44 VAL n 1 45 ILE n 1 46 ASN n 1 47 VAL n 1 48 PRO n 1 49 CYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 49 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'chi4, VOLCADRAFT_127242' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Volvox carteri f. nagariensis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3068 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'SHuffle(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code D8UFB5_VOLCA _struct_ref.pdbx_db_accession D8UFB5 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GCTYTIQPGDTFWAIAQRRGTTVDVIQSLNPGVNPARLQVGQVINVPC _struct_ref.pdbx_align_begin 104 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5K2L _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 49 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession D8UFB5 _struct_ref_seq.db_align_beg 104 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 151 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 49 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 5K2L _struct_ref_seq_dif.mon_id MET _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code D8UFB5 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'initiating methionine' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5K2L _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.00 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 34.92 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.2 M Sodium citrate tribasic dihydrate, 20 % PEG 3350 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 95 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-11-02 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.98 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PHOTON FACTORY BEAMLINE BL-17A' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.98 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL-17A _diffrn_source.pdbx_synchrotron_site 'Photon Factory' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5K2L _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.20 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13481 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.5 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 23.5 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 73.0 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.20 _reflns_shell.d_res_low 1.22 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 0.10 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 0.10 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] -0.20 _refine.B_iso_max ? _refine.B_iso_mean 9.587 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.970 _refine.correlation_coeff_Fo_to_Fc_free 0.960 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5K2L _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.20 _refine.ls_d_res_low 27.83 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12739 _refine.ls_number_reflns_R_free 688 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.64 _refine.ls_percent_reflns_R_free 5.1 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.14073 _refine.ls_R_factor_R_free 0.17959 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.13871 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4PXV _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.042 _refine.pdbx_overall_ESU_R_Free 0.043 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 1.063 _refine.overall_SU_ML 0.022 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 369 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 4 _refine_hist.number_atoms_solvent 89 _refine_hist.number_atoms_total 462 _refine_hist.d_res_high 1.20 _refine_hist.d_res_low 27.83 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.026 0.020 419 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 413 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.999 1.939 577 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 2.852 3.006 940 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 4.578 5.000 57 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 44.655 23.500 20 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 15.040 15.000 67 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 13.457 15.000 5 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.136 0.200 66 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.010 0.021 493 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.020 0.020 104 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 1.420 0.752 207 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 1.163 0.743 205 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 1.408 1.124 259 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 1.582 1.130 260 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 3.040 1.130 212 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 3.035 1.137 213 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 3.362 1.559 314 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 3.903 9.916 590 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 3.900 9.933 591 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? 8.858 3.000 832 ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? 14.866 5.000 6 ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? 6.963 5.000 903 ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.201 _refine_ls_shell.d_res_low 1.232 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 50 _refine_ls_shell.number_reflns_R_work 919 _refine_ls_shell.percent_reflns_obs 98.88 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.164 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.127 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5K2L _struct.title 'Crystal structure of LysM domain from Volvox carteri chitinase' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5K2L _struct_keywords.text 'chitin binding module, chitinase, Volvox carteri, green alga, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 12 ? GLY A 21 ? THR A 12 GLY A 21 1 ? 10 HELX_P HELX_P2 AA2 THR A 23 ? ASN A 31 ? THR A 23 ASN A 31 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 49 SG A ? A CYS 3 A CYS 49 1_555 ? ? ? ? ? ? ? 2.050 ? ? disulf2 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 49 SG B ? A CYS 3 A CYS 49 1_555 ? ? ? ? ? ? ? 2.048 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 CYS A 3 ? THR A 6 ? CYS A 3 THR A 6 AA1 2 VAL A 44 ? VAL A 47 ? VAL A 44 VAL A 47 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id TYR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 5 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 5 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ILE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 45 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 45 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id EDO _struct_site.pdbx_auth_seq_id 101 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 9 _struct_site.details 'binding site for residue EDO A 101' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 9 GLN A 8 ? GLN A 8 . ? 1_555 ? 2 AC1 9 GLY A 10 ? GLY A 10 . ? 1_555 ? 3 AC1 9 ASP A 11 ? ASP A 11 . ? 1_555 ? 4 AC1 9 ASP A 25 ? ASP A 25 . ? 3_445 ? 5 AC1 9 LEU A 39 ? LEU A 39 . ? 1_555 ? 6 AC1 9 VAL A 41 ? VAL A 41 . ? 1_555 ? 7 AC1 9 HOH C . ? HOH A 201 . ? 1_555 ? 8 AC1 9 HOH C . ? HOH A 202 . ? 1_555 ? 9 AC1 9 HOH C . ? HOH A 277 . ? 3_545 ? # _atom_sites.entry_id 5K2L _atom_sites.fract_transf_matrix[1][1] 0.034329 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.034329 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010609 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 TYR 5 5 5 TYR TYR A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 PHE 13 13 13 PHE PHE A . n A 1 14 TRP 14 14 14 TRP TRP A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 GLN 40 40 40 GLN GLN A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 CYS 49 49 49 CYS CYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 EDO 1 101 1 EDO EDO A . C 3 HOH 1 201 71 HOH HOH A . C 3 HOH 2 202 72 HOH HOH A . C 3 HOH 3 203 20 HOH HOH A . C 3 HOH 4 204 57 HOH HOH A . C 3 HOH 5 205 82 HOH HOH A . C 3 HOH 6 206 13 HOH HOH A . C 3 HOH 7 207 55 HOH HOH A . C 3 HOH 8 208 22 HOH HOH A . C 3 HOH 9 209 92 HOH HOH A . C 3 HOH 10 210 7 HOH HOH A . C 3 HOH 11 211 48 HOH HOH A . C 3 HOH 12 212 31 HOH HOH A . C 3 HOH 13 213 83 HOH HOH A . C 3 HOH 14 214 96 HOH HOH A . C 3 HOH 15 215 61 HOH HOH A . C 3 HOH 16 216 9 HOH HOH A . C 3 HOH 17 217 35 HOH HOH A . C 3 HOH 18 218 27 HOH HOH A . C 3 HOH 19 219 47 HOH HOH A . C 3 HOH 20 220 15 HOH HOH A . C 3 HOH 21 221 3 HOH HOH A . C 3 HOH 22 222 25 HOH HOH A . C 3 HOH 23 223 40 HOH HOH A . C 3 HOH 24 224 76 HOH HOH A . C 3 HOH 25 225 32 HOH HOH A . C 3 HOH 26 226 29 HOH HOH A . C 3 HOH 27 227 6 HOH HOH A . C 3 HOH 28 228 93 HOH HOH A . C 3 HOH 29 229 26 HOH HOH A . C 3 HOH 30 230 18 HOH HOH A . C 3 HOH 31 231 69 HOH HOH A . C 3 HOH 32 232 41 HOH HOH A . C 3 HOH 33 233 36 HOH HOH A . C 3 HOH 34 234 43 HOH HOH A . C 3 HOH 35 235 52 HOH HOH A . C 3 HOH 36 236 17 HOH HOH A . C 3 HOH 37 237 97 HOH HOH A . C 3 HOH 38 238 16 HOH HOH A . C 3 HOH 39 239 1 HOH HOH A . C 3 HOH 40 240 94 HOH HOH A . C 3 HOH 41 241 5 HOH HOH A . C 3 HOH 42 242 85 HOH HOH A . C 3 HOH 43 243 14 HOH HOH A . C 3 HOH 44 244 19 HOH HOH A . C 3 HOH 45 245 30 HOH HOH A . C 3 HOH 46 246 39 HOH HOH A . C 3 HOH 47 247 63 HOH HOH A . C 3 HOH 48 248 33 HOH HOH A . C 3 HOH 49 249 44 HOH HOH A . C 3 HOH 50 250 8 HOH HOH A . C 3 HOH 51 251 24 HOH HOH A . C 3 HOH 52 252 46 HOH HOH A . C 3 HOH 53 253 11 HOH HOH A . C 3 HOH 54 254 4 HOH HOH A . C 3 HOH 55 255 80 HOH HOH A . C 3 HOH 56 256 10 HOH HOH A . C 3 HOH 57 257 45 HOH HOH A . C 3 HOH 58 258 34 HOH HOH A . C 3 HOH 59 259 37 HOH HOH A . C 3 HOH 60 260 2 HOH HOH A . C 3 HOH 61 261 28 HOH HOH A . C 3 HOH 62 262 77 HOH HOH A . C 3 HOH 63 263 70 HOH HOH A . C 3 HOH 64 264 89 HOH HOH A . C 3 HOH 65 265 59 HOH HOH A . C 3 HOH 66 266 50 HOH HOH A . C 3 HOH 67 267 78 HOH HOH A . C 3 HOH 68 268 21 HOH HOH A . C 3 HOH 69 269 42 HOH HOH A . C 3 HOH 70 270 62 HOH HOH A . C 3 HOH 71 271 60 HOH HOH A . C 3 HOH 72 272 67 HOH HOH A . C 3 HOH 73 273 68 HOH HOH A . C 3 HOH 74 274 66 HOH HOH A . C 3 HOH 75 275 53 HOH HOH A . C 3 HOH 76 276 65 HOH HOH A . C 3 HOH 77 277 74 HOH HOH A . C 3 HOH 78 278 64 HOH HOH A . C 3 HOH 79 279 12 HOH HOH A . C 3 HOH 80 280 81 HOH HOH A . C 3 HOH 81 281 99 HOH HOH A . C 3 HOH 82 282 90 HOH HOH A . C 3 HOH 83 283 49 HOH HOH A . C 3 HOH 84 284 95 HOH HOH A . C 3 HOH 85 285 23 HOH HOH A . C 3 HOH 86 286 87 HOH HOH A . C 3 HOH 87 287 58 HOH HOH A . C 3 HOH 88 288 88 HOH HOH A . C 3 HOH 89 289 98 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-02-22 2 'Structure model' 1 1 2020-02-19 3 'Structure model' 1 2 2023-11-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' diffrn_source 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 2 3 'Structure model' '_database_2.pdbx_DOI' 3 3 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0049 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 3 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O2 A EDO 101 ? ? O A HOH 201 ? ? 1.46 2 1 O1 A EDO 101 ? ? O A HOH 202 ? ? 1.48 3 1 O A HOH 235 ? ? O A HOH 240 ? ? 1.55 4 1 O A HOH 218 ? ? O A HOH 224 ? ? 1.56 5 1 O A HOH 265 ? ? O A HOH 282 ? ? 1.73 6 1 NE2 A GLN 8 ? B O A HOH 203 ? ? 1.74 7 1 O A HOH 222 ? ? O A HOH 242 ? ? 1.75 8 1 O A HOH 234 ? ? O A HOH 240 ? ? 1.78 9 1 NE2 A GLN 18 ? B O A HOH 204 ? ? 1.84 10 1 O A HOH 262 ? ? O A HOH 267 ? ? 1.93 11 1 NE A ARG 20 ? B O A HOH 205 ? ? 2.03 12 1 O A HOH 209 ? ? O A HOH 228 ? ? 2.17 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 218 ? ? 1_555 O A HOH 236 ? ? 3_445 1.80 2 1 O A HOH 216 ? ? 1_555 O A HOH 249 ? ? 7_655 1.91 3 1 O A HOH 213 ? ? 1_555 O A HOH 225 ? ? 7_545 2.18 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CZ A ARG 20 ? A NH2 A ARG 20 ? A 1.417 1.326 0.091 0.013 N 2 1 CB A ASP 25 ? ? CG A ASP 25 ? ? 1.352 1.513 -0.161 0.021 N 3 1 CG A ASP 25 ? ? OD2 A ASP 25 ? ? 1.399 1.249 0.150 0.023 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CG A MET 1 ? ? SD A MET 1 ? ? CE A MET 1 ? ? 111.05 100.20 10.85 1.60 N 2 1 NE A ARG 20 ? A CZ A ARG 20 ? A NH1 A ARG 20 ? A 116.69 120.30 -3.61 0.50 N 3 1 NE A ARG 20 ? A CZ A ARG 20 ? A NH2 A ARG 20 ? A 123.42 120.30 3.12 0.50 N # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 289 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 5.99 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 EDO C1 C N N 88 EDO O1 O N N 89 EDO C2 C N N 90 EDO O2 O N N 91 EDO H11 H N N 92 EDO H12 H N N 93 EDO HO1 H N N 94 EDO H21 H N N 95 EDO H22 H N N 96 EDO HO2 H N N 97 GLN N N N N 98 GLN CA C N S 99 GLN C C N N 100 GLN O O N N 101 GLN CB C N N 102 GLN CG C N N 103 GLN CD C N N 104 GLN OE1 O N N 105 GLN NE2 N N N 106 GLN OXT O N N 107 GLN H H N N 108 GLN H2 H N N 109 GLN HA H N N 110 GLN HB2 H N N 111 GLN HB3 H N N 112 GLN HG2 H N N 113 GLN HG3 H N N 114 GLN HE21 H N N 115 GLN HE22 H N N 116 GLN HXT H N N 117 GLY N N N N 118 GLY CA C N N 119 GLY C C N N 120 GLY O O N N 121 GLY OXT O N N 122 GLY H H N N 123 GLY H2 H N N 124 GLY HA2 H N N 125 GLY HA3 H N N 126 GLY HXT H N N 127 HOH O O N N 128 HOH H1 H N N 129 HOH H2 H N N 130 ILE N N N N 131 ILE CA C N S 132 ILE C C N N 133 ILE O O N N 134 ILE CB C N S 135 ILE CG1 C N N 136 ILE CG2 C N N 137 ILE CD1 C N N 138 ILE OXT O N N 139 ILE H H N N 140 ILE H2 H N N 141 ILE HA H N N 142 ILE HB H N N 143 ILE HG12 H N N 144 ILE HG13 H N N 145 ILE HG21 H N N 146 ILE HG22 H N N 147 ILE HG23 H N N 148 ILE HD11 H N N 149 ILE HD12 H N N 150 ILE HD13 H N N 151 ILE HXT H N N 152 LEU N N N N 153 LEU CA C N S 154 LEU C C N N 155 LEU O O N N 156 LEU CB C N N 157 LEU CG C N N 158 LEU CD1 C N N 159 LEU CD2 C N N 160 LEU OXT O N N 161 LEU H H N N 162 LEU H2 H N N 163 LEU HA H N N 164 LEU HB2 H N N 165 LEU HB3 H N N 166 LEU HG H N N 167 LEU HD11 H N N 168 LEU HD12 H N N 169 LEU HD13 H N N 170 LEU HD21 H N N 171 LEU HD22 H N N 172 LEU HD23 H N N 173 LEU HXT H N N 174 MET N N N N 175 MET CA C N S 176 MET C C N N 177 MET O O N N 178 MET CB C N N 179 MET CG C N N 180 MET SD S N N 181 MET CE C N N 182 MET OXT O N N 183 MET H H N N 184 MET H2 H N N 185 MET HA H N N 186 MET HB2 H N N 187 MET HB3 H N N 188 MET HG2 H N N 189 MET HG3 H N N 190 MET HE1 H N N 191 MET HE2 H N N 192 MET HE3 H N N 193 MET HXT H N N 194 PHE N N N N 195 PHE CA C N S 196 PHE C C N N 197 PHE O O N N 198 PHE CB C N N 199 PHE CG C Y N 200 PHE CD1 C Y N 201 PHE CD2 C Y N 202 PHE CE1 C Y N 203 PHE CE2 C Y N 204 PHE CZ C Y N 205 PHE OXT O N N 206 PHE H H N N 207 PHE H2 H N N 208 PHE HA H N N 209 PHE HB2 H N N 210 PHE HB3 H N N 211 PHE HD1 H N N 212 PHE HD2 H N N 213 PHE HE1 H N N 214 PHE HE2 H N N 215 PHE HZ H N N 216 PHE HXT H N N 217 PRO N N N N 218 PRO CA C N S 219 PRO C C N N 220 PRO O O N N 221 PRO CB C N N 222 PRO CG C N N 223 PRO CD C N N 224 PRO OXT O N N 225 PRO H H N N 226 PRO HA H N N 227 PRO HB2 H N N 228 PRO HB3 H N N 229 PRO HG2 H N N 230 PRO HG3 H N N 231 PRO HD2 H N N 232 PRO HD3 H N N 233 PRO HXT H N N 234 SER N N N N 235 SER CA C N S 236 SER C C N N 237 SER O O N N 238 SER CB C N N 239 SER OG O N N 240 SER OXT O N N 241 SER H H N N 242 SER H2 H N N 243 SER HA H N N 244 SER HB2 H N N 245 SER HB3 H N N 246 SER HG H N N 247 SER HXT H N N 248 THR N N N N 249 THR CA C N S 250 THR C C N N 251 THR O O N N 252 THR CB C N R 253 THR OG1 O N N 254 THR CG2 C N N 255 THR OXT O N N 256 THR H H N N 257 THR H2 H N N 258 THR HA H N N 259 THR HB H N N 260 THR HG1 H N N 261 THR HG21 H N N 262 THR HG22 H N N 263 THR HG23 H N N 264 THR HXT H N N 265 TRP N N N N 266 TRP CA C N S 267 TRP C C N N 268 TRP O O N N 269 TRP CB C N N 270 TRP CG C Y N 271 TRP CD1 C Y N 272 TRP CD2 C Y N 273 TRP NE1 N Y N 274 TRP CE2 C Y N 275 TRP CE3 C Y N 276 TRP CZ2 C Y N 277 TRP CZ3 C Y N 278 TRP CH2 C Y N 279 TRP OXT O N N 280 TRP H H N N 281 TRP H2 H N N 282 TRP HA H N N 283 TRP HB2 H N N 284 TRP HB3 H N N 285 TRP HD1 H N N 286 TRP HE1 H N N 287 TRP HE3 H N N 288 TRP HZ2 H N N 289 TRP HZ3 H N N 290 TRP HH2 H N N 291 TRP HXT H N N 292 TYR N N N N 293 TYR CA C N S 294 TYR C C N N 295 TYR O O N N 296 TYR CB C N N 297 TYR CG C Y N 298 TYR CD1 C Y N 299 TYR CD2 C Y N 300 TYR CE1 C Y N 301 TYR CE2 C Y N 302 TYR CZ C Y N 303 TYR OH O N N 304 TYR OXT O N N 305 TYR H H N N 306 TYR H2 H N N 307 TYR HA H N N 308 TYR HB2 H N N 309 TYR HB3 H N N 310 TYR HD1 H N N 311 TYR HD2 H N N 312 TYR HE1 H N N 313 TYR HE2 H N N 314 TYR HH H N N 315 TYR HXT H N N 316 VAL N N N N 317 VAL CA C N S 318 VAL C C N N 319 VAL O O N N 320 VAL CB C N N 321 VAL CG1 C N N 322 VAL CG2 C N N 323 VAL OXT O N N 324 VAL H H N N 325 VAL H2 H N N 326 VAL HA H N N 327 VAL HB H N N 328 VAL HG11 H N N 329 VAL HG12 H N N 330 VAL HG13 H N N 331 VAL HG21 H N N 332 VAL HG22 H N N 333 VAL HG23 H N N 334 VAL HXT H N N 335 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 EDO C1 O1 sing N N 83 EDO C1 C2 sing N N 84 EDO C1 H11 sing N N 85 EDO C1 H12 sing N N 86 EDO O1 HO1 sing N N 87 EDO C2 O2 sing N N 88 EDO C2 H21 sing N N 89 EDO C2 H22 sing N N 90 EDO O2 HO2 sing N N 91 GLN N CA sing N N 92 GLN N H sing N N 93 GLN N H2 sing N N 94 GLN CA C sing N N 95 GLN CA CB sing N N 96 GLN CA HA sing N N 97 GLN C O doub N N 98 GLN C OXT sing N N 99 GLN CB CG sing N N 100 GLN CB HB2 sing N N 101 GLN CB HB3 sing N N 102 GLN CG CD sing N N 103 GLN CG HG2 sing N N 104 GLN CG HG3 sing N N 105 GLN CD OE1 doub N N 106 GLN CD NE2 sing N N 107 GLN NE2 HE21 sing N N 108 GLN NE2 HE22 sing N N 109 GLN OXT HXT sing N N 110 GLY N CA sing N N 111 GLY N H sing N N 112 GLY N H2 sing N N 113 GLY CA C sing N N 114 GLY CA HA2 sing N N 115 GLY CA HA3 sing N N 116 GLY C O doub N N 117 GLY C OXT sing N N 118 GLY OXT HXT sing N N 119 HOH O H1 sing N N 120 HOH O H2 sing N N 121 ILE N CA sing N N 122 ILE N H sing N N 123 ILE N H2 sing N N 124 ILE CA C sing N N 125 ILE CA CB sing N N 126 ILE CA HA sing N N 127 ILE C O doub N N 128 ILE C OXT sing N N 129 ILE CB CG1 sing N N 130 ILE CB CG2 sing N N 131 ILE CB HB sing N N 132 ILE CG1 CD1 sing N N 133 ILE CG1 HG12 sing N N 134 ILE CG1 HG13 sing N N 135 ILE CG2 HG21 sing N N 136 ILE CG2 HG22 sing N N 137 ILE CG2 HG23 sing N N 138 ILE CD1 HD11 sing N N 139 ILE CD1 HD12 sing N N 140 ILE CD1 HD13 sing N N 141 ILE OXT HXT sing N N 142 LEU N CA sing N N 143 LEU N H sing N N 144 LEU N H2 sing N N 145 LEU CA C sing N N 146 LEU CA CB sing N N 147 LEU CA HA sing N N 148 LEU C O doub N N 149 LEU C OXT sing N N 150 LEU CB CG sing N N 151 LEU CB HB2 sing N N 152 LEU CB HB3 sing N N 153 LEU CG CD1 sing N N 154 LEU CG CD2 sing N N 155 LEU CG HG sing N N 156 LEU CD1 HD11 sing N N 157 LEU CD1 HD12 sing N N 158 LEU CD1 HD13 sing N N 159 LEU CD2 HD21 sing N N 160 LEU CD2 HD22 sing N N 161 LEU CD2 HD23 sing N N 162 LEU OXT HXT sing N N 163 MET N CA sing N N 164 MET N H sing N N 165 MET N H2 sing N N 166 MET CA C sing N N 167 MET CA CB sing N N 168 MET CA HA sing N N 169 MET C O doub N N 170 MET C OXT sing N N 171 MET CB CG sing N N 172 MET CB HB2 sing N N 173 MET CB HB3 sing N N 174 MET CG SD sing N N 175 MET CG HG2 sing N N 176 MET CG HG3 sing N N 177 MET SD CE sing N N 178 MET CE HE1 sing N N 179 MET CE HE2 sing N N 180 MET CE HE3 sing N N 181 MET OXT HXT sing N N 182 PHE N CA sing N N 183 PHE N H sing N N 184 PHE N H2 sing N N 185 PHE CA C sing N N 186 PHE CA CB sing N N 187 PHE CA HA sing N N 188 PHE C O doub N N 189 PHE C OXT sing N N 190 PHE CB CG sing N N 191 PHE CB HB2 sing N N 192 PHE CB HB3 sing N N 193 PHE CG CD1 doub Y N 194 PHE CG CD2 sing Y N 195 PHE CD1 CE1 sing Y N 196 PHE CD1 HD1 sing N N 197 PHE CD2 CE2 doub Y N 198 PHE CD2 HD2 sing N N 199 PHE CE1 CZ doub Y N 200 PHE CE1 HE1 sing N N 201 PHE CE2 CZ sing Y N 202 PHE CE2 HE2 sing N N 203 PHE CZ HZ sing N N 204 PHE OXT HXT sing N N 205 PRO N CA sing N N 206 PRO N CD sing N N 207 PRO N H sing N N 208 PRO CA C sing N N 209 PRO CA CB sing N N 210 PRO CA HA sing N N 211 PRO C O doub N N 212 PRO C OXT sing N N 213 PRO CB CG sing N N 214 PRO CB HB2 sing N N 215 PRO CB HB3 sing N N 216 PRO CG CD sing N N 217 PRO CG HG2 sing N N 218 PRO CG HG3 sing N N 219 PRO CD HD2 sing N N 220 PRO CD HD3 sing N N 221 PRO OXT HXT sing N N 222 SER N CA sing N N 223 SER N H sing N N 224 SER N H2 sing N N 225 SER CA C sing N N 226 SER CA CB sing N N 227 SER CA HA sing N N 228 SER C O doub N N 229 SER C OXT sing N N 230 SER CB OG sing N N 231 SER CB HB2 sing N N 232 SER CB HB3 sing N N 233 SER OG HG sing N N 234 SER OXT HXT sing N N 235 THR N CA sing N N 236 THR N H sing N N 237 THR N H2 sing N N 238 THR CA C sing N N 239 THR CA CB sing N N 240 THR CA HA sing N N 241 THR C O doub N N 242 THR C OXT sing N N 243 THR CB OG1 sing N N 244 THR CB CG2 sing N N 245 THR CB HB sing N N 246 THR OG1 HG1 sing N N 247 THR CG2 HG21 sing N N 248 THR CG2 HG22 sing N N 249 THR CG2 HG23 sing N N 250 THR OXT HXT sing N N 251 TRP N CA sing N N 252 TRP N H sing N N 253 TRP N H2 sing N N 254 TRP CA C sing N N 255 TRP CA CB sing N N 256 TRP CA HA sing N N 257 TRP C O doub N N 258 TRP C OXT sing N N 259 TRP CB CG sing N N 260 TRP CB HB2 sing N N 261 TRP CB HB3 sing N N 262 TRP CG CD1 doub Y N 263 TRP CG CD2 sing Y N 264 TRP CD1 NE1 sing Y N 265 TRP CD1 HD1 sing N N 266 TRP CD2 CE2 doub Y N 267 TRP CD2 CE3 sing Y N 268 TRP NE1 CE2 sing Y N 269 TRP NE1 HE1 sing N N 270 TRP CE2 CZ2 sing Y N 271 TRP CE3 CZ3 doub Y N 272 TRP CE3 HE3 sing N N 273 TRP CZ2 CH2 doub Y N 274 TRP CZ2 HZ2 sing N N 275 TRP CZ3 CH2 sing Y N 276 TRP CZ3 HZ3 sing N N 277 TRP CH2 HH2 sing N N 278 TRP OXT HXT sing N N 279 TYR N CA sing N N 280 TYR N H sing N N 281 TYR N H2 sing N N 282 TYR CA C sing N N 283 TYR CA CB sing N N 284 TYR CA HA sing N N 285 TYR C O doub N N 286 TYR C OXT sing N N 287 TYR CB CG sing N N 288 TYR CB HB2 sing N N 289 TYR CB HB3 sing N N 290 TYR CG CD1 doub Y N 291 TYR CG CD2 sing Y N 292 TYR CD1 CE1 sing Y N 293 TYR CD1 HD1 sing N N 294 TYR CD2 CE2 doub Y N 295 TYR CD2 HD2 sing N N 296 TYR CE1 CZ doub Y N 297 TYR CE1 HE1 sing N N 298 TYR CE2 CZ sing Y N 299 TYR CE2 HE2 sing N N 300 TYR CZ OH sing N N 301 TYR OH HH sing N N 302 TYR OXT HXT sing N N 303 VAL N CA sing N N 304 VAL N H sing N N 305 VAL N H2 sing N N 306 VAL CA C sing N N 307 VAL CA CB sing N N 308 VAL CA HA sing N N 309 VAL C O doub N N 310 VAL C OXT sing N N 311 VAL CB CG1 sing N N 312 VAL CB CG2 sing N N 313 VAL CB HB sing N N 314 VAL CG1 HG11 sing N N 315 VAL CG1 HG12 sing N N 316 VAL CG1 HG13 sing N N 317 VAL CG2 HG21 sing N N 318 VAL CG2 HG22 sing N N 319 VAL CG2 HG23 sing N N 320 VAL OXT HXT sing N N 321 # _pdbx_audit_support.funding_organization 'Strategic Project to Support the Formation of Research Bases at Private Universities: Matching Fund Subsidy from the MEXT' _pdbx_audit_support.country Japan _pdbx_audit_support.grant_number S1101035 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 1,2-ETHANEDIOL EDO 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4PXV _pdbx_initial_refinement_model.details ? #