data_5KC0 # _entry.id 5KC0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5KC0 pdb_00005kc0 10.2210/pdb5kc0/pdb WWPDB D_1000221157 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5KC0 _pdbx_database_status.recvd_initial_deposition_date 2016-06-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Karpowich, N.K.' 1 'Wang, D.N.' 2 'Song, J.M.' 3 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Mol.Biol. _citation.journal_id_ASTM JMOBAK _citation.journal_id_CSD 0070 _citation.journal_id_ISSN 1089-8638 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 428 _citation.language ? _citation.page_first 3118 _citation.page_last 3130 _citation.title 'An Aromatic Cap Seals the Substrate Binding Site in an ECF-Type S Subunit for Riboflavin.' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jmb.2016.06.003 _citation.pdbx_database_id_PubMed 27312125 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Karpowich, N.K.' 1 ? primary 'Song, J.' 2 ? primary 'Wang, D.N.' 3 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5KC0 _cell.details ? _cell.formula_units_Z ? _cell.length_a 72.611 _cell.length_a_esd ? _cell.length_b 72.611 _cell.length_b_esd ? _cell.length_c 232.912 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5KC0 _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Riboflavin transporter RibU' 20785.846 1 ? ? ? ? 2 non-polymer man 'nonyl beta-D-glucopyranoside' 306.395 2 ? ? ? ? 3 non-polymer syn RIBOFLAVIN 376.364 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Riboflavin ECF transporter S component RibU' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSSIKKISFVGIFSALATLVMFLEFPIFPQASFLKYDPSEIPALIVSFLLGPGVGMFVVLVKDILFFLMKSGDPVGIAMN AVLGMSFVGIAGLIYHRNKSRATAIKGMIVATLFATAFALGLNALIVPLYFEAPFELYLKFFPFILAFNLVKFGIDSVVT FFVYKKVSSILKLETVEGRSNNGSNSLVPR ; _entity_poly.pdbx_seq_one_letter_code_can ;MSSIKKISFVGIFSALATLVMFLEFPIFPQASFLKYDPSEIPALIVSFLLGPGVGMFVVLVKDILFFLMKSGDPVGIAMN AVLGMSFVGIAGLIYHRNKSRATAIKGMIVATLFATAFALGLNALIVPLYFEAPFELYLKFFPFILAFNLVKFGIDSVVT FFVYKKVSSILKLETVEGRSNNGSNSLVPR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 SER n 1 4 ILE n 1 5 LYS n 1 6 LYS n 1 7 ILE n 1 8 SER n 1 9 PHE n 1 10 VAL n 1 11 GLY n 1 12 ILE n 1 13 PHE n 1 14 SER n 1 15 ALA n 1 16 LEU n 1 17 ALA n 1 18 THR n 1 19 LEU n 1 20 VAL n 1 21 MET n 1 22 PHE n 1 23 LEU n 1 24 GLU n 1 25 PHE n 1 26 PRO n 1 27 ILE n 1 28 PHE n 1 29 PRO n 1 30 GLN n 1 31 ALA n 1 32 SER n 1 33 PHE n 1 34 LEU n 1 35 LYS n 1 36 TYR n 1 37 ASP n 1 38 PRO n 1 39 SER n 1 40 GLU n 1 41 ILE n 1 42 PRO n 1 43 ALA n 1 44 LEU n 1 45 ILE n 1 46 VAL n 1 47 SER n 1 48 PHE n 1 49 LEU n 1 50 LEU n 1 51 GLY n 1 52 PRO n 1 53 GLY n 1 54 VAL n 1 55 GLY n 1 56 MET n 1 57 PHE n 1 58 VAL n 1 59 VAL n 1 60 LEU n 1 61 VAL n 1 62 LYS n 1 63 ASP n 1 64 ILE n 1 65 LEU n 1 66 PHE n 1 67 PHE n 1 68 LEU n 1 69 MET n 1 70 LYS n 1 71 SER n 1 72 GLY n 1 73 ASP n 1 74 PRO n 1 75 VAL n 1 76 GLY n 1 77 ILE n 1 78 ALA n 1 79 MET n 1 80 ASN n 1 81 ALA n 1 82 VAL n 1 83 LEU n 1 84 GLY n 1 85 MET n 1 86 SER n 1 87 PHE n 1 88 VAL n 1 89 GLY n 1 90 ILE n 1 91 ALA n 1 92 GLY n 1 93 LEU n 1 94 ILE n 1 95 TYR n 1 96 HIS n 1 97 ARG n 1 98 ASN n 1 99 LYS n 1 100 SER n 1 101 ARG n 1 102 ALA n 1 103 THR n 1 104 ALA n 1 105 ILE n 1 106 LYS n 1 107 GLY n 1 108 MET n 1 109 ILE n 1 110 VAL n 1 111 ALA n 1 112 THR n 1 113 LEU n 1 114 PHE n 1 115 ALA n 1 116 THR n 1 117 ALA n 1 118 PHE n 1 119 ALA n 1 120 LEU n 1 121 GLY n 1 122 LEU n 1 123 ASN n 1 124 ALA n 1 125 LEU n 1 126 ILE n 1 127 VAL n 1 128 PRO n 1 129 LEU n 1 130 TYR n 1 131 PHE n 1 132 GLU n 1 133 ALA n 1 134 PRO n 1 135 PHE n 1 136 GLU n 1 137 LEU n 1 138 TYR n 1 139 LEU n 1 140 LYS n 1 141 PHE n 1 142 PHE n 1 143 PRO n 1 144 PHE n 1 145 ILE n 1 146 LEU n 1 147 ALA n 1 148 PHE n 1 149 ASN n 1 150 LEU n 1 151 VAL n 1 152 LYS n 1 153 PHE n 1 154 GLY n 1 155 ILE n 1 156 ASP n 1 157 SER n 1 158 VAL n 1 159 VAL n 1 160 THR n 1 161 PHE n 1 162 PHE n 1 163 VAL n 1 164 TYR n 1 165 LYS n 1 166 LYS n 1 167 VAL n 1 168 SER n 1 169 SER n 1 170 ILE n 1 171 LEU n 1 172 LYS n 1 173 LEU n 1 174 GLU n 1 175 THR n 1 176 VAL n 1 177 GLU n 1 178 GLY n 1 179 ARG n 1 180 SER n 1 181 ASN n 1 182 ASN n 1 183 GLY n 1 184 SER n 1 185 ASN n 1 186 SER n 1 187 LEU n 1 188 VAL n 1 189 PRO n 1 190 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 190 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ribU, TM_1455' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 43589 / MSB8 / DSM 3109 / JCM 10099' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 243274 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pBADCtmycHis _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RIBU_THEMA _struct_ref.pdbx_db_accession Q9X1G6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSSIKKISFVGIFSALATLVMFLEFPIFPQASFLKYDPSEIPALIVSFLLGPGVGMFVVLVKDILFFLMKSGDPVGIAMN AVLGMSFVGIAGLIYHRNKSRATAIKGMIVATLFATAFALGLNALIVPLYFEAPFELYLKFFPFILAFNLVKFGIDSVVT FFVYKKVSSILKLETVEGRSNNG ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5KC0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 183 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9X1G6 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 183 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 183 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5KC0 SER A 184 ? UNP Q9X1G6 ? ? 'expression tag' 184 1 1 5KC0 ASN A 185 ? UNP Q9X1G6 ? ? 'expression tag' 185 2 1 5KC0 SER A 186 ? UNP Q9X1G6 ? ? 'expression tag' 186 3 1 5KC0 LEU A 187 ? UNP Q9X1G6 ? ? 'expression tag' 187 4 1 5KC0 VAL A 188 ? UNP Q9X1G6 ? ? 'expression tag' 188 5 1 5KC0 PRO A 189 ? UNP Q9X1G6 ? ? 'expression tag' 189 6 1 5KC0 ARG A 190 ? UNP Q9X1G6 ? ? 'expression tag' 190 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BNG D-saccharide n 'nonyl beta-D-glucopyranoside' 'Beta-NONYLGLUCOSIDE; nonyl beta-D-glucoside; nonyl D-glucoside; nonyl glucoside' 'C15 H30 O6' 306.395 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 RBF non-polymer . RIBOFLAVIN 'RIBOFLAVINE; VITAMIN B2' 'C17 H20 N4 O6' 376.364 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5KC0 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 4.42 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 72.20 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100 mM sodium acetate, pH 4.5, 28% PEG400, and 50 mM magnesium acetate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2012-10-26 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NSLS BEAMLINE X29A' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.979 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X29A _diffrn_source.pdbx_synchrotron_site NSLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5KC0 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.2 _reflns.d_resolution_low 37.431 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6009 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F 2.0 _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 91.2 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 18.8 _reflns.pdbx_Rmerge_I_obs 0.058 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 31.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 3.2 _reflns_shell.d_res_low 3.28 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.062 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5KC0 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.2001 _refine.ls_d_res_low 37.4 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6009 _refine.ls_number_reflns_R_free 301 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 91.28 _refine.ls_percent_reflns_R_free 5.01 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2681 _refine.ls_R_factor_R_free 0.2983 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2663 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.01 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3P5N _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 32.45 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.45 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1278 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 69 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1347 _refine_hist.d_res_high 3.2001 _refine_hist.d_res_low 37.4 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.003 ? 1387 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.639 ? 1875 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 12.305 ? 779 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.037 ? 225 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 217 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 3.2001 4.0310 . . 134 2541 84.00 . . . 0.2862 . 0.2865 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.0310 37.4335 . . 167 3167 98.00 . . . 0.3025 . 0.2599 . . . . . . . . . . # _struct.entry_id 5KC0 _struct.title 'Crystal structure of TmRibU, hexagonal crystal form' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5KC0 _struct_keywords.text 'membrane transport, integral membrane protein, vitamins, thermophile, Transport Protein-Membrane Protein complex' _struct_keywords.pdbx_keywords 'Transport Protein/Membrane Protein' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # _struct_biol.id 1 _struct_biol.details 'Monomer confirmed by Analytical SEC' # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 3 ? MET A 21 ? SER A 3 MET A 21 1 ? 19 HELX_P HELX_P2 AA2 GLU A 40 ? GLY A 51 ? GLU A 40 GLY A 51 1 ? 12 HELX_P HELX_P3 AA3 GLY A 51 ? LYS A 70 ? GLY A 51 LYS A 70 1 ? 20 HELX_P HELX_P4 AA4 ASP A 73 ? HIS A 96 ? ASP A 73 HIS A 96 1 ? 24 HELX_P HELX_P5 AA5 SER A 100 ? LEU A 125 ? SER A 100 LEU A 125 1 ? 26 HELX_P HELX_P6 AA6 ILE A 126 ? PHE A 131 ? ILE A 126 PHE A 131 1 ? 6 HELX_P HELX_P7 AA7 PRO A 134 ? LYS A 166 ? PRO A 134 LYS A 166 1 ? 33 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag none _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id ASN _struct_conn.ptnr1_label_seq_id 149 _struct_conn.ptnr1_label_atom_id OD1 _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id D _struct_conn.ptnr2_label_comp_id RBF _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id N3 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id ASN _struct_conn.ptnr1_auth_seq_id 149 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id RBF _struct_conn.ptnr2_auth_seq_id 303 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.301 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _atom_sites.entry_id 5KC0 _atom_sites.fract_transf_matrix[1][1] 0.013772 _atom_sites.fract_transf_matrix[1][2] 0.007951 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015903 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004293 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 PHE 13 13 13 PHE PHE A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 MET 21 21 21 MET MET A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 TYR 36 36 36 TYR TYR A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 MET 56 56 56 MET MET A . n A 1 57 PHE 57 57 57 PHE PHE A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 PHE 66 66 66 PHE PHE A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 MET 69 69 69 MET MET A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 MET 79 79 79 MET MET A . n A 1 80 ASN 80 80 80 ASN ASN A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 MET 85 85 85 MET MET A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 PHE 87 87 87 PHE PHE A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 TYR 95 95 95 TYR TYR A . n A 1 96 HIS 96 96 96 HIS HIS A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 ASN 98 98 98 ASN ASN A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 ARG 101 101 101 ARG ARG A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 ILE 105 105 105 ILE ILE A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 MET 108 108 108 MET MET A . n A 1 109 ILE 109 109 109 ILE ILE A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 THR 112 112 112 THR THR A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 PHE 114 114 114 PHE PHE A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 THR 116 116 116 THR THR A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 PHE 118 118 118 PHE PHE A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 GLY 121 121 121 GLY GLY A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 ASN 123 123 123 ASN ASN A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 ILE 126 126 126 ILE ILE A . n A 1 127 VAL 127 127 127 VAL VAL A . n A 1 128 PRO 128 128 128 PRO PRO A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 TYR 130 130 130 TYR TYR A . n A 1 131 PHE 131 131 131 PHE PHE A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 ALA 133 133 133 ALA ALA A . n A 1 134 PRO 134 134 134 PRO PRO A . n A 1 135 PHE 135 135 135 PHE PHE A . n A 1 136 GLU 136 136 136 GLU GLU A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 TYR 138 138 138 TYR TYR A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 LYS 140 140 140 LYS LYS A . n A 1 141 PHE 141 141 141 PHE PHE A . n A 1 142 PHE 142 142 142 PHE PHE A . n A 1 143 PRO 143 143 143 PRO PRO A . n A 1 144 PHE 144 144 144 PHE PHE A . n A 1 145 ILE 145 145 145 ILE ILE A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 ALA 147 147 147 ALA ALA A . n A 1 148 PHE 148 148 148 PHE PHE A . n A 1 149 ASN 149 149 149 ASN ASN A . n A 1 150 LEU 150 150 150 LEU LEU A . n A 1 151 VAL 151 151 151 VAL VAL A . n A 1 152 LYS 152 152 152 LYS LYS A . n A 1 153 PHE 153 153 153 PHE PHE A . n A 1 154 GLY 154 154 154 GLY GLY A . n A 1 155 ILE 155 155 155 ILE ILE A . n A 1 156 ASP 156 156 156 ASP ASP A . n A 1 157 SER 157 157 157 SER SER A . n A 1 158 VAL 158 158 158 VAL VAL A . n A 1 159 VAL 159 159 159 VAL VAL A . n A 1 160 THR 160 160 160 THR THR A . n A 1 161 PHE 161 161 161 PHE PHE A . n A 1 162 PHE 162 162 162 PHE PHE A . n A 1 163 VAL 163 163 163 VAL VAL A . n A 1 164 TYR 164 164 164 TYR TYR A . n A 1 165 LYS 165 165 165 LYS LYS A . n A 1 166 LYS 166 166 166 LYS LYS A . n A 1 167 VAL 167 167 167 VAL VAL A . n A 1 168 SER 168 168 ? ? ? A . n A 1 169 SER 169 169 ? ? ? A . n A 1 170 ILE 170 170 ? ? ? A . n A 1 171 LEU 171 171 ? ? ? A . n A 1 172 LYS 172 172 ? ? ? A . n A 1 173 LEU 173 173 ? ? ? A . n A 1 174 GLU 174 174 ? ? ? A . n A 1 175 THR 175 175 ? ? ? A . n A 1 176 VAL 176 176 ? ? ? A . n A 1 177 GLU 177 177 ? ? ? A . n A 1 178 GLY 178 178 ? ? ? A . n A 1 179 ARG 179 179 ? ? ? A . n A 1 180 SER 180 180 ? ? ? A . n A 1 181 ASN 181 181 ? ? ? A . n A 1 182 ASN 182 182 ? ? ? A . n A 1 183 GLY 183 183 ? ? ? A . n A 1 184 SER 184 184 ? ? ? A . n A 1 185 ASN 185 185 ? ? ? A . n A 1 186 SER 186 186 ? ? ? A . n A 1 187 LEU 187 187 ? ? ? A . n A 1 188 VAL 188 188 ? ? ? A . n A 1 189 PRO 189 189 ? ? ? A . n A 1 190 ARG 190 190 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 BNG 1 301 301 BNG BNG A . C 2 BNG 1 302 302 BNG BNG A . D 3 RBF 1 303 190 RBF RBF A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1640 ? 1 MORE 1 ? 1 'SSA (A^2)' 8710 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-06-29 2 'Structure model' 1 1 2016-08-17 3 'Structure model' 1 2 2017-11-01 4 'Structure model' 1 3 2020-07-29 5 'Structure model' 1 4 2023-09-27 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 4 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Author supporting evidence' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Derived calculations' 7 4 'Structure model' 'Structure summary' 8 5 'Structure model' 'Data collection' 9 5 'Structure model' 'Database references' 10 5 'Structure model' 'Refinement description' 11 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' citation 2 3 'Structure model' pdbx_struct_assembly_auth_evidence 3 3 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' chem_comp 5 4 'Structure model' entity 6 4 'Structure model' pdbx_chem_comp_identifier 7 4 'Structure model' pdbx_entity_nonpoly 8 4 'Structure model' struct_site 9 4 'Structure model' struct_site_gen 10 5 'Structure model' chem_comp 11 5 'Structure model' chem_comp_atom 12 5 'Structure model' chem_comp_bond 13 5 'Structure model' database_2 14 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_citation.journal_id_CSD' 2 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 3 4 'Structure model' '_chem_comp.mon_nstd_flag' 4 4 'Structure model' '_chem_comp.name' 5 4 'Structure model' '_chem_comp.type' 6 4 'Structure model' '_entity.pdbx_description' 7 4 'Structure model' '_pdbx_entity_nonpoly.name' 8 5 'Structure model' '_chem_comp.pdbx_synonyms' 9 5 'Structure model' '_database_2.pdbx_DOI' 10 5 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 27.4819 _pdbx_refine_tls.origin_y 11.8601 _pdbx_refine_tls.origin_z 125.5656 _pdbx_refine_tls.T[1][1] 0.6897 _pdbx_refine_tls.T[2][2] 0.6202 _pdbx_refine_tls.T[3][3] 0.6305 _pdbx_refine_tls.T[1][2] -0.1944 _pdbx_refine_tls.T[1][3] 0.0395 _pdbx_refine_tls.T[2][3] -0.0009 _pdbx_refine_tls.L[1][1] 0.6812 _pdbx_refine_tls.L[2][2] 1.4289 _pdbx_refine_tls.L[3][3] 0.7406 _pdbx_refine_tls.L[1][2] -0.2610 _pdbx_refine_tls.L[1][3] 0.2510 _pdbx_refine_tls.L[2][3] 0.8362 _pdbx_refine_tls.S[1][1] 0.2788 _pdbx_refine_tls.S[1][2] -0.3748 _pdbx_refine_tls.S[1][3] 0.2047 _pdbx_refine_tls.S[2][1] 0.0736 _pdbx_refine_tls.S[2][2] -0.2977 _pdbx_refine_tls.S[2][3] -0.0754 _pdbx_refine_tls.S[3][1] -0.2609 _pdbx_refine_tls.S[3][2] 0.1451 _pdbx_refine_tls.S[3][3] 0.0513 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id ? _pdbx_refine_tls_group.beg_auth_seq_id ? _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id ? _pdbx_refine_tls_group.end_auth_seq_id ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.10.1_2155: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD2 A ASP 73 ? ? "O5'" A RBF 303 ? ? 1.26 2 1 O A GLY 76 ? ? "O3'" A RBF 303 ? ? 1.26 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 3 ? ? 54.98 -78.35 2 1 LEU A 23 ? ? -83.06 30.08 3 1 ILE A 27 ? ? 69.82 -23.81 4 1 LYS A 70 ? ? -119.90 60.62 5 1 HIS A 96 ? ? -72.92 -148.33 6 1 ARG A 97 ? ? 43.43 -79.35 7 1 LYS A 166 ? ? -78.61 22.51 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A TYR 164 ? CG ? A TYR 164 CG 2 1 Y 1 A TYR 164 ? CD1 ? A TYR 164 CD1 3 1 Y 1 A TYR 164 ? CD2 ? A TYR 164 CD2 4 1 Y 1 A TYR 164 ? CE1 ? A TYR 164 CE1 5 1 Y 1 A TYR 164 ? CE2 ? A TYR 164 CE2 6 1 Y 1 A TYR 164 ? CZ ? A TYR 164 CZ 7 1 Y 1 A TYR 164 ? OH ? A TYR 164 OH 8 1 Y 1 A LYS 165 ? CG ? A LYS 165 CG 9 1 Y 1 A LYS 165 ? CD ? A LYS 165 CD 10 1 Y 1 A LYS 165 ? CE ? A LYS 165 CE 11 1 Y 1 A LYS 165 ? NZ ? A LYS 165 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A SER 168 ? A SER 168 3 1 Y 1 A SER 169 ? A SER 169 4 1 Y 1 A ILE 170 ? A ILE 170 5 1 Y 1 A LEU 171 ? A LEU 171 6 1 Y 1 A LYS 172 ? A LYS 172 7 1 Y 1 A LEU 173 ? A LEU 173 8 1 Y 1 A GLU 174 ? A GLU 174 9 1 Y 1 A THR 175 ? A THR 175 10 1 Y 1 A VAL 176 ? A VAL 176 11 1 Y 1 A GLU 177 ? A GLU 177 12 1 Y 1 A GLY 178 ? A GLY 178 13 1 Y 1 A ARG 179 ? A ARG 179 14 1 Y 1 A SER 180 ? A SER 180 15 1 Y 1 A ASN 181 ? A ASN 181 16 1 Y 1 A ASN 182 ? A ASN 182 17 1 Y 1 A GLY 183 ? A GLY 183 18 1 Y 1 A SER 184 ? A SER 184 19 1 Y 1 A ASN 185 ? A ASN 185 20 1 Y 1 A SER 186 ? A SER 186 21 1 Y 1 A LEU 187 ? A LEU 187 22 1 Y 1 A VAL 188 ? A VAL 188 23 1 Y 1 A PRO 189 ? A PRO 189 24 1 Y 1 A ARG 190 ? A ARG 190 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 BNG C1 C N R 74 BNG C2 C N R 75 BNG C3 C N S 76 BNG C4 C N S 77 BNG C5 C N R 78 BNG C6 C N N 79 BNG "C1'" C N N 80 BNG "C2'" C N N 81 BNG "C3'" C N N 82 BNG "C4'" C N N 83 BNG "C5'" C N N 84 BNG "C6'" C N N 85 BNG "C7'" C N N 86 BNG "C8'" C N N 87 BNG "C9'" C N N 88 BNG O1 O N N 89 BNG O2 O N N 90 BNG O3 O N N 91 BNG O4 O N N 92 BNG O5 O N N 93 BNG O6 O N N 94 BNG H1 H N N 95 BNG H2 H N N 96 BNG H3 H N N 97 BNG H4 H N N 98 BNG H5 H N N 99 BNG H61 H N N 100 BNG H62 H N N 101 BNG "H1'1" H N N 102 BNG "H1'2" H N N 103 BNG "H2'1" H N N 104 BNG "H2'2" H N N 105 BNG "H3'1" H N N 106 BNG "H3'2" H N N 107 BNG "H4'1" H N N 108 BNG "H4'2" H N N 109 BNG "H5'1" H N N 110 BNG "H5'2" H N N 111 BNG "H6'1" H N N 112 BNG "H6'2" H N N 113 BNG "H7'1" H N N 114 BNG "H7'2" H N N 115 BNG "H8'1" H N N 116 BNG "H8'2" H N N 117 BNG "H9'1" H N N 118 BNG "H9'2" H N N 119 BNG "H9'3" H N N 120 BNG HO2 H N N 121 BNG HO3 H N N 122 BNG HO4 H N N 123 BNG HO6 H N N 124 GLN N N N N 125 GLN CA C N S 126 GLN C C N N 127 GLN O O N N 128 GLN CB C N N 129 GLN CG C N N 130 GLN CD C N N 131 GLN OE1 O N N 132 GLN NE2 N N N 133 GLN OXT O N N 134 GLN H H N N 135 GLN H2 H N N 136 GLN HA H N N 137 GLN HB2 H N N 138 GLN HB3 H N N 139 GLN HG2 H N N 140 GLN HG3 H N N 141 GLN HE21 H N N 142 GLN HE22 H N N 143 GLN HXT H N N 144 GLU N N N N 145 GLU CA C N S 146 GLU C C N N 147 GLU O O N N 148 GLU CB C N N 149 GLU CG C N N 150 GLU CD C N N 151 GLU OE1 O N N 152 GLU OE2 O N N 153 GLU OXT O N N 154 GLU H H N N 155 GLU H2 H N N 156 GLU HA H N N 157 GLU HB2 H N N 158 GLU HB3 H N N 159 GLU HG2 H N N 160 GLU HG3 H N N 161 GLU HE2 H N N 162 GLU HXT H N N 163 GLY N N N N 164 GLY CA C N N 165 GLY C C N N 166 GLY O O N N 167 GLY OXT O N N 168 GLY H H N N 169 GLY H2 H N N 170 GLY HA2 H N N 171 GLY HA3 H N N 172 GLY HXT H N N 173 HIS N N N N 174 HIS CA C N S 175 HIS C C N N 176 HIS O O N N 177 HIS CB C N N 178 HIS CG C Y N 179 HIS ND1 N Y N 180 HIS CD2 C Y N 181 HIS CE1 C Y N 182 HIS NE2 N Y N 183 HIS OXT O N N 184 HIS H H N N 185 HIS H2 H N N 186 HIS HA H N N 187 HIS HB2 H N N 188 HIS HB3 H N N 189 HIS HD1 H N N 190 HIS HD2 H N N 191 HIS HE1 H N N 192 HIS HE2 H N N 193 HIS HXT H N N 194 ILE N N N N 195 ILE CA C N S 196 ILE C C N N 197 ILE O O N N 198 ILE CB C N S 199 ILE CG1 C N N 200 ILE CG2 C N N 201 ILE CD1 C N N 202 ILE OXT O N N 203 ILE H H N N 204 ILE H2 H N N 205 ILE HA H N N 206 ILE HB H N N 207 ILE HG12 H N N 208 ILE HG13 H N N 209 ILE HG21 H N N 210 ILE HG22 H N N 211 ILE HG23 H N N 212 ILE HD11 H N N 213 ILE HD12 H N N 214 ILE HD13 H N N 215 ILE HXT H N N 216 LEU N N N N 217 LEU CA C N S 218 LEU C C N N 219 LEU O O N N 220 LEU CB C N N 221 LEU CG C N N 222 LEU CD1 C N N 223 LEU CD2 C N N 224 LEU OXT O N N 225 LEU H H N N 226 LEU H2 H N N 227 LEU HA H N N 228 LEU HB2 H N N 229 LEU HB3 H N N 230 LEU HG H N N 231 LEU HD11 H N N 232 LEU HD12 H N N 233 LEU HD13 H N N 234 LEU HD21 H N N 235 LEU HD22 H N N 236 LEU HD23 H N N 237 LEU HXT H N N 238 LYS N N N N 239 LYS CA C N S 240 LYS C C N N 241 LYS O O N N 242 LYS CB C N N 243 LYS CG C N N 244 LYS CD C N N 245 LYS CE C N N 246 LYS NZ N N N 247 LYS OXT O N N 248 LYS H H N N 249 LYS H2 H N N 250 LYS HA H N N 251 LYS HB2 H N N 252 LYS HB3 H N N 253 LYS HG2 H N N 254 LYS HG3 H N N 255 LYS HD2 H N N 256 LYS HD3 H N N 257 LYS HE2 H N N 258 LYS HE3 H N N 259 LYS HZ1 H N N 260 LYS HZ2 H N N 261 LYS HZ3 H N N 262 LYS HXT H N N 263 MET N N N N 264 MET CA C N S 265 MET C C N N 266 MET O O N N 267 MET CB C N N 268 MET CG C N N 269 MET SD S N N 270 MET CE C N N 271 MET OXT O N N 272 MET H H N N 273 MET H2 H N N 274 MET HA H N N 275 MET HB2 H N N 276 MET HB3 H N N 277 MET HG2 H N N 278 MET HG3 H N N 279 MET HE1 H N N 280 MET HE2 H N N 281 MET HE3 H N N 282 MET HXT H N N 283 PHE N N N N 284 PHE CA C N S 285 PHE C C N N 286 PHE O O N N 287 PHE CB C N N 288 PHE CG C Y N 289 PHE CD1 C Y N 290 PHE CD2 C Y N 291 PHE CE1 C Y N 292 PHE CE2 C Y N 293 PHE CZ C Y N 294 PHE OXT O N N 295 PHE H H N N 296 PHE H2 H N N 297 PHE HA H N N 298 PHE HB2 H N N 299 PHE HB3 H N N 300 PHE HD1 H N N 301 PHE HD2 H N N 302 PHE HE1 H N N 303 PHE HE2 H N N 304 PHE HZ H N N 305 PHE HXT H N N 306 PRO N N N N 307 PRO CA C N S 308 PRO C C N N 309 PRO O O N N 310 PRO CB C N N 311 PRO CG C N N 312 PRO CD C N N 313 PRO OXT O N N 314 PRO H H N N 315 PRO HA H N N 316 PRO HB2 H N N 317 PRO HB3 H N N 318 PRO HG2 H N N 319 PRO HG3 H N N 320 PRO HD2 H N N 321 PRO HD3 H N N 322 PRO HXT H N N 323 RBF N1 N N N 324 RBF C2 C N N 325 RBF O2 O N N 326 RBF N3 N N N 327 RBF C4 C N N 328 RBF O4 O N N 329 RBF C4A C N N 330 RBF N5 N N N 331 RBF C5A C Y N 332 RBF C6 C Y N 333 RBF C7 C Y N 334 RBF C7M C N N 335 RBF C8 C Y N 336 RBF C8M C N N 337 RBF C9 C Y N 338 RBF C9A C Y N 339 RBF N10 N N N 340 RBF C10 C N N 341 RBF "C1'" C N N 342 RBF "C2'" C N S 343 RBF "O2'" O N N 344 RBF "C3'" C N S 345 RBF "O3'" O N N 346 RBF "C4'" C N R 347 RBF "O4'" O N N 348 RBF "C5'" C N N 349 RBF "O5'" O N N 350 RBF HN3 H N N 351 RBF HC6 H N N 352 RBF HC71 H N N 353 RBF HC72 H N N 354 RBF HC73 H N N 355 RBF HC81 H N N 356 RBF HC82 H N N 357 RBF HC83 H N N 358 RBF HC9 H N N 359 RBF HC11 H N N 360 RBF HC12 H N N 361 RBF "HC2'" H N N 362 RBF "HO2'" H N N 363 RBF "HC3'" H N N 364 RBF "HO3'" H N N 365 RBF "HC4'" H N N 366 RBF "HO4'" H N N 367 RBF HC51 H N N 368 RBF HC52 H N N 369 RBF "HO5'" H N N 370 SER N N N N 371 SER CA C N S 372 SER C C N N 373 SER O O N N 374 SER CB C N N 375 SER OG O N N 376 SER OXT O N N 377 SER H H N N 378 SER H2 H N N 379 SER HA H N N 380 SER HB2 H N N 381 SER HB3 H N N 382 SER HG H N N 383 SER HXT H N N 384 THR N N N N 385 THR CA C N S 386 THR C C N N 387 THR O O N N 388 THR CB C N R 389 THR OG1 O N N 390 THR CG2 C N N 391 THR OXT O N N 392 THR H H N N 393 THR H2 H N N 394 THR HA H N N 395 THR HB H N N 396 THR HG1 H N N 397 THR HG21 H N N 398 THR HG22 H N N 399 THR HG23 H N N 400 THR HXT H N N 401 TYR N N N N 402 TYR CA C N S 403 TYR C C N N 404 TYR O O N N 405 TYR CB C N N 406 TYR CG C Y N 407 TYR CD1 C Y N 408 TYR CD2 C Y N 409 TYR CE1 C Y N 410 TYR CE2 C Y N 411 TYR CZ C Y N 412 TYR OH O N N 413 TYR OXT O N N 414 TYR H H N N 415 TYR H2 H N N 416 TYR HA H N N 417 TYR HB2 H N N 418 TYR HB3 H N N 419 TYR HD1 H N N 420 TYR HD2 H N N 421 TYR HE1 H N N 422 TYR HE2 H N N 423 TYR HH H N N 424 TYR HXT H N N 425 VAL N N N N 426 VAL CA C N S 427 VAL C C N N 428 VAL O O N N 429 VAL CB C N N 430 VAL CG1 C N N 431 VAL CG2 C N N 432 VAL OXT O N N 433 VAL H H N N 434 VAL H2 H N N 435 VAL HA H N N 436 VAL HB H N N 437 VAL HG11 H N N 438 VAL HG12 H N N 439 VAL HG13 H N N 440 VAL HG21 H N N 441 VAL HG22 H N N 442 VAL HG23 H N N 443 VAL HXT H N N 444 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 BNG C1 C2 sing N N 70 BNG C1 O1 sing N N 71 BNG C1 O5 sing N N 72 BNG C1 H1 sing N N 73 BNG C2 C3 sing N N 74 BNG C2 O2 sing N N 75 BNG C2 H2 sing N N 76 BNG C3 C4 sing N N 77 BNG C3 O3 sing N N 78 BNG C3 H3 sing N N 79 BNG C4 C5 sing N N 80 BNG C4 O4 sing N N 81 BNG C4 H4 sing N N 82 BNG C5 C6 sing N N 83 BNG C5 O5 sing N N 84 BNG C5 H5 sing N N 85 BNG C6 O6 sing N N 86 BNG C6 H61 sing N N 87 BNG C6 H62 sing N N 88 BNG "C1'" "C2'" sing N N 89 BNG "C1'" O1 sing N N 90 BNG "C1'" "H1'1" sing N N 91 BNG "C1'" "H1'2" sing N N 92 BNG "C2'" "C3'" sing N N 93 BNG "C2'" "H2'1" sing N N 94 BNG "C2'" "H2'2" sing N N 95 BNG "C3'" "C4'" sing N N 96 BNG "C3'" "H3'1" sing N N 97 BNG "C3'" "H3'2" sing N N 98 BNG "C4'" "C5'" sing N N 99 BNG "C4'" "H4'1" sing N N 100 BNG "C4'" "H4'2" sing N N 101 BNG "C5'" "C6'" sing N N 102 BNG "C5'" "H5'1" sing N N 103 BNG "C5'" "H5'2" sing N N 104 BNG "C6'" "C7'" sing N N 105 BNG "C6'" "H6'1" sing N N 106 BNG "C6'" "H6'2" sing N N 107 BNG "C7'" "C8'" sing N N 108 BNG "C7'" "H7'1" sing N N 109 BNG "C7'" "H7'2" sing N N 110 BNG "C8'" "C9'" sing N N 111 BNG "C8'" "H8'1" sing N N 112 BNG "C8'" "H8'2" sing N N 113 BNG "C9'" "H9'1" sing N N 114 BNG "C9'" "H9'2" sing N N 115 BNG "C9'" "H9'3" sing N N 116 BNG O2 HO2 sing N N 117 BNG O3 HO3 sing N N 118 BNG O4 HO4 sing N N 119 BNG O6 HO6 sing N N 120 GLN N CA sing N N 121 GLN N H sing N N 122 GLN N H2 sing N N 123 GLN CA C sing N N 124 GLN CA CB sing N N 125 GLN CA HA sing N N 126 GLN C O doub N N 127 GLN C OXT sing N N 128 GLN CB CG sing N N 129 GLN CB HB2 sing N N 130 GLN CB HB3 sing N N 131 GLN CG CD sing N N 132 GLN CG HG2 sing N N 133 GLN CG HG3 sing N N 134 GLN CD OE1 doub N N 135 GLN CD NE2 sing N N 136 GLN NE2 HE21 sing N N 137 GLN NE2 HE22 sing N N 138 GLN OXT HXT sing N N 139 GLU N CA sing N N 140 GLU N H sing N N 141 GLU N H2 sing N N 142 GLU CA C sing N N 143 GLU CA CB sing N N 144 GLU CA HA sing N N 145 GLU C O doub N N 146 GLU C OXT sing N N 147 GLU CB CG sing N N 148 GLU CB HB2 sing N N 149 GLU CB HB3 sing N N 150 GLU CG CD sing N N 151 GLU CG HG2 sing N N 152 GLU CG HG3 sing N N 153 GLU CD OE1 doub N N 154 GLU CD OE2 sing N N 155 GLU OE2 HE2 sing N N 156 GLU OXT HXT sing N N 157 GLY N CA sing N N 158 GLY N H sing N N 159 GLY N H2 sing N N 160 GLY CA C sing N N 161 GLY CA HA2 sing N N 162 GLY CA HA3 sing N N 163 GLY C O doub N N 164 GLY C OXT sing N N 165 GLY OXT HXT sing N N 166 HIS N CA sing N N 167 HIS N H sing N N 168 HIS N H2 sing N N 169 HIS CA C sing N N 170 HIS CA CB sing N N 171 HIS CA HA sing N N 172 HIS C O doub N N 173 HIS C OXT sing N N 174 HIS CB CG sing N N 175 HIS CB HB2 sing N N 176 HIS CB HB3 sing N N 177 HIS CG ND1 sing Y N 178 HIS CG CD2 doub Y N 179 HIS ND1 CE1 doub Y N 180 HIS ND1 HD1 sing N N 181 HIS CD2 NE2 sing Y N 182 HIS CD2 HD2 sing N N 183 HIS CE1 NE2 sing Y N 184 HIS CE1 HE1 sing N N 185 HIS NE2 HE2 sing N N 186 HIS OXT HXT sing N N 187 ILE N CA sing N N 188 ILE N H sing N N 189 ILE N H2 sing N N 190 ILE CA C sing N N 191 ILE CA CB sing N N 192 ILE CA HA sing N N 193 ILE C O doub N N 194 ILE C OXT sing N N 195 ILE CB CG1 sing N N 196 ILE CB CG2 sing N N 197 ILE CB HB sing N N 198 ILE CG1 CD1 sing N N 199 ILE CG1 HG12 sing N N 200 ILE CG1 HG13 sing N N 201 ILE CG2 HG21 sing N N 202 ILE CG2 HG22 sing N N 203 ILE CG2 HG23 sing N N 204 ILE CD1 HD11 sing N N 205 ILE CD1 HD12 sing N N 206 ILE CD1 HD13 sing N N 207 ILE OXT HXT sing N N 208 LEU N CA sing N N 209 LEU N H sing N N 210 LEU N H2 sing N N 211 LEU CA C sing N N 212 LEU CA CB sing N N 213 LEU CA HA sing N N 214 LEU C O doub N N 215 LEU C OXT sing N N 216 LEU CB CG sing N N 217 LEU CB HB2 sing N N 218 LEU CB HB3 sing N N 219 LEU CG CD1 sing N N 220 LEU CG CD2 sing N N 221 LEU CG HG sing N N 222 LEU CD1 HD11 sing N N 223 LEU CD1 HD12 sing N N 224 LEU CD1 HD13 sing N N 225 LEU CD2 HD21 sing N N 226 LEU CD2 HD22 sing N N 227 LEU CD2 HD23 sing N N 228 LEU OXT HXT sing N N 229 LYS N CA sing N N 230 LYS N H sing N N 231 LYS N H2 sing N N 232 LYS CA C sing N N 233 LYS CA CB sing N N 234 LYS CA HA sing N N 235 LYS C O doub N N 236 LYS C OXT sing N N 237 LYS CB CG sing N N 238 LYS CB HB2 sing N N 239 LYS CB HB3 sing N N 240 LYS CG CD sing N N 241 LYS CG HG2 sing N N 242 LYS CG HG3 sing N N 243 LYS CD CE sing N N 244 LYS CD HD2 sing N N 245 LYS CD HD3 sing N N 246 LYS CE NZ sing N N 247 LYS CE HE2 sing N N 248 LYS CE HE3 sing N N 249 LYS NZ HZ1 sing N N 250 LYS NZ HZ2 sing N N 251 LYS NZ HZ3 sing N N 252 LYS OXT HXT sing N N 253 MET N CA sing N N 254 MET N H sing N N 255 MET N H2 sing N N 256 MET CA C sing N N 257 MET CA CB sing N N 258 MET CA HA sing N N 259 MET C O doub N N 260 MET C OXT sing N N 261 MET CB CG sing N N 262 MET CB HB2 sing N N 263 MET CB HB3 sing N N 264 MET CG SD sing N N 265 MET CG HG2 sing N N 266 MET CG HG3 sing N N 267 MET SD CE sing N N 268 MET CE HE1 sing N N 269 MET CE HE2 sing N N 270 MET CE HE3 sing N N 271 MET OXT HXT sing N N 272 PHE N CA sing N N 273 PHE N H sing N N 274 PHE N H2 sing N N 275 PHE CA C sing N N 276 PHE CA CB sing N N 277 PHE CA HA sing N N 278 PHE C O doub N N 279 PHE C OXT sing N N 280 PHE CB CG sing N N 281 PHE CB HB2 sing N N 282 PHE CB HB3 sing N N 283 PHE CG CD1 doub Y N 284 PHE CG CD2 sing Y N 285 PHE CD1 CE1 sing Y N 286 PHE CD1 HD1 sing N N 287 PHE CD2 CE2 doub Y N 288 PHE CD2 HD2 sing N N 289 PHE CE1 CZ doub Y N 290 PHE CE1 HE1 sing N N 291 PHE CE2 CZ sing Y N 292 PHE CE2 HE2 sing N N 293 PHE CZ HZ sing N N 294 PHE OXT HXT sing N N 295 PRO N CA sing N N 296 PRO N CD sing N N 297 PRO N H sing N N 298 PRO CA C sing N N 299 PRO CA CB sing N N 300 PRO CA HA sing N N 301 PRO C O doub N N 302 PRO C OXT sing N N 303 PRO CB CG sing N N 304 PRO CB HB2 sing N N 305 PRO CB HB3 sing N N 306 PRO CG CD sing N N 307 PRO CG HG2 sing N N 308 PRO CG HG3 sing N N 309 PRO CD HD2 sing N N 310 PRO CD HD3 sing N N 311 PRO OXT HXT sing N N 312 RBF N1 C2 sing N N 313 RBF N1 C10 doub N N 314 RBF C2 O2 doub N N 315 RBF C2 N3 sing N N 316 RBF N3 C4 sing N N 317 RBF N3 HN3 sing N N 318 RBF C4 O4 doub N N 319 RBF C4 C4A sing N N 320 RBF C4A N5 doub N N 321 RBF C4A C10 sing N N 322 RBF N5 C5A sing N N 323 RBF C5A C6 doub Y N 324 RBF C5A C9A sing Y N 325 RBF C6 C7 sing Y N 326 RBF C6 HC6 sing N N 327 RBF C7 C7M sing N N 328 RBF C7 C8 doub Y N 329 RBF C7M HC71 sing N N 330 RBF C7M HC72 sing N N 331 RBF C7M HC73 sing N N 332 RBF C8 C8M sing N N 333 RBF C8 C9 sing Y N 334 RBF C8M HC81 sing N N 335 RBF C8M HC82 sing N N 336 RBF C8M HC83 sing N N 337 RBF C9 C9A doub Y N 338 RBF C9 HC9 sing N N 339 RBF C9A N10 sing N N 340 RBF N10 C10 sing N N 341 RBF N10 "C1'" sing N N 342 RBF "C1'" "C2'" sing N N 343 RBF "C1'" HC11 sing N N 344 RBF "C1'" HC12 sing N N 345 RBF "C2'" "O2'" sing N N 346 RBF "C2'" "C3'" sing N N 347 RBF "C2'" "HC2'" sing N N 348 RBF "O2'" "HO2'" sing N N 349 RBF "C3'" "O3'" sing N N 350 RBF "C3'" "C4'" sing N N 351 RBF "C3'" "HC3'" sing N N 352 RBF "O3'" "HO3'" sing N N 353 RBF "C4'" "O4'" sing N N 354 RBF "C4'" "C5'" sing N N 355 RBF "C4'" "HC4'" sing N N 356 RBF "O4'" "HO4'" sing N N 357 RBF "C5'" "O5'" sing N N 358 RBF "C5'" HC51 sing N N 359 RBF "C5'" HC52 sing N N 360 RBF "O5'" "HO5'" sing N N 361 SER N CA sing N N 362 SER N H sing N N 363 SER N H2 sing N N 364 SER CA C sing N N 365 SER CA CB sing N N 366 SER CA HA sing N N 367 SER C O doub N N 368 SER C OXT sing N N 369 SER CB OG sing N N 370 SER CB HB2 sing N N 371 SER CB HB3 sing N N 372 SER OG HG sing N N 373 SER OXT HXT sing N N 374 THR N CA sing N N 375 THR N H sing N N 376 THR N H2 sing N N 377 THR CA C sing N N 378 THR CA CB sing N N 379 THR CA HA sing N N 380 THR C O doub N N 381 THR C OXT sing N N 382 THR CB OG1 sing N N 383 THR CB CG2 sing N N 384 THR CB HB sing N N 385 THR OG1 HG1 sing N N 386 THR CG2 HG21 sing N N 387 THR CG2 HG22 sing N N 388 THR CG2 HG23 sing N N 389 THR OXT HXT sing N N 390 TYR N CA sing N N 391 TYR N H sing N N 392 TYR N H2 sing N N 393 TYR CA C sing N N 394 TYR CA CB sing N N 395 TYR CA HA sing N N 396 TYR C O doub N N 397 TYR C OXT sing N N 398 TYR CB CG sing N N 399 TYR CB HB2 sing N N 400 TYR CB HB3 sing N N 401 TYR CG CD1 doub Y N 402 TYR CG CD2 sing Y N 403 TYR CD1 CE1 sing Y N 404 TYR CD1 HD1 sing N N 405 TYR CD2 CE2 doub Y N 406 TYR CD2 HD2 sing N N 407 TYR CE1 CZ doub Y N 408 TYR CE1 HE1 sing N N 409 TYR CE2 CZ sing Y N 410 TYR CE2 HE2 sing N N 411 TYR CZ OH sing N N 412 TYR OH HH sing N N 413 TYR OXT HXT sing N N 414 VAL N CA sing N N 415 VAL N H sing N N 416 VAL N H2 sing N N 417 VAL CA C sing N N 418 VAL CA CB sing N N 419 VAL CA HA sing N N 420 VAL C O doub N N 421 VAL C OXT sing N N 422 VAL CB CG1 sing N N 423 VAL CB CG2 sing N N 424 VAL CB HB sing N N 425 VAL CG1 HG11 sing N N 426 VAL CG1 HG12 sing N N 427 VAL CG1 HG13 sing N N 428 VAL CG2 HG21 sing N N 429 VAL CG2 HG22 sing N N 430 VAL CG2 HG23 sing N N 431 VAL OXT HXT sing N N 432 # _pdbx_chem_comp_identifier.comp_id BNG _pdbx_chem_comp_identifier.type 'IUPAC CARBOHYDRATE SYMBOL' _pdbx_chem_comp_identifier.program PDB-CARE _pdbx_chem_comp_identifier.program_version 1.0 _pdbx_chem_comp_identifier.identifier b-nonylglucoside # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'nonyl beta-D-glucopyranoside' BNG 3 RIBOFLAVIN RBF # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3P5N _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #