data_5KH9 # _entry.id 5KH9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5KH9 pdb_00005kh9 10.2210/pdb5kh9/pdb WWPDB D_1000222213 ? ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 5KH3 PDB . unspecified 5KH7 PDB . unspecified 5B8D PDB . # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5KH9 _pdbx_database_status.recvd_initial_deposition_date 2016-06-14 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Harding, R.J.' 1 'Tempel, W.' 2 'Ravichandran, M.' 3 'Collins, P.' 4 'Pearce, N.' 5 'Brandao-Neto, J.' 6 'Douangamath, A.' 7 'Schapira, M.' 8 'Bountra, C.' 9 'Edwards, A.M.' 10 'von Delft, F.' 11 'Santhakumar, V.' 12 'Arrowsmith, C.M.' 13 'Structural Genomics Consortium (SGC)' 14 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Med. Chem.' _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 1520-4804 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 60 _citation.language ? _citation.page_first 9090 _citation.page_last 9096 _citation.title 'Small Molecule Antagonists of the Interaction between the Histone Deacetylase 6 Zinc-Finger Domain and Ubiquitin.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.7b00933 _citation.pdbx_database_id_PubMed 29019676 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Harding, R.J.' 1 0000-0002-1134-391X primary 'Ferreira de Freitas, R.' 2 0000-0001-6195-4236 primary 'Collins, P.' 3 0000-0002-6265-9922 primary 'Franzoni, I.' 4 0000-0001-8110-6218 primary 'Ravichandran, M.' 5 ? primary 'Ouyang, H.' 6 ? primary 'Juarez-Ornelas, K.A.' 7 ? primary 'Lautens, M.' 8 ? primary 'Schapira, M.' 9 0000-0002-1047-3309 primary 'von Delft, F.' 10 ? primary 'Santhakumar, V.' 11 ? primary 'Arrowsmith, C.H.' 12 0000-0002-4971-3250 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5KH9 _cell.details ? _cell.formula_units_Z ? _cell.length_a 41.434 _cell.length_a_esd ? _cell.length_b 44.157 _cell.length_b_esd ? _cell.length_c 56.549 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5KH9 _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Histone deacetylase 6' 11932.607 1 3.5.1.98 ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 3 ? ? ? ? 3 non-polymer syn 'FORMIC ACID' 46.025 1 ? ? ? ? 4 non-polymer syn '6-methyl-5-[(4-propan-2-ylphenyl)amino]-2~{H}-1,2,4-triazin-3-one' 244.292 1 ? ? ? ? 5 non-polymer syn 'UNKNOWN ATOM OR ION' ? 33 ? ? ? ? 6 non-polymer syn 'SODIUM ION' 22.990 1 ? ? ? ? 7 water nat water 18.015 79 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name HD6 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSPLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYC QAYVHHQALLDVKNIAHQNKFGEDMPH ; _entity_poly.pdbx_seq_one_letter_code_can ;GSPLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYC QAYVHHQALLDVKNIAHQNKFGEDMPH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 PRO n 1 4 LEU n 1 5 PRO n 1 6 TRP n 1 7 CYS n 1 8 PRO n 1 9 HIS n 1 10 LEU n 1 11 VAL n 1 12 ALA n 1 13 VAL n 1 14 CYS n 1 15 PRO n 1 16 ILE n 1 17 PRO n 1 18 ALA n 1 19 ALA n 1 20 GLY n 1 21 LEU n 1 22 ASP n 1 23 VAL n 1 24 THR n 1 25 GLN n 1 26 PRO n 1 27 CYS n 1 28 GLY n 1 29 ASP n 1 30 CYS n 1 31 GLY n 1 32 THR n 1 33 ILE n 1 34 GLN n 1 35 GLU n 1 36 ASN n 1 37 TRP n 1 38 VAL n 1 39 CYS n 1 40 LEU n 1 41 SER n 1 42 CYS n 1 43 TYR n 1 44 GLN n 1 45 VAL n 1 46 TYR n 1 47 CYS n 1 48 GLY n 1 49 ARG n 1 50 TYR n 1 51 ILE n 1 52 ASN n 1 53 GLY n 1 54 HIS n 1 55 MET n 1 56 LEU n 1 57 GLN n 1 58 HIS n 1 59 HIS n 1 60 GLY n 1 61 ASN n 1 62 SER n 1 63 GLY n 1 64 HIS n 1 65 PRO n 1 66 LEU n 1 67 VAL n 1 68 LEU n 1 69 SER n 1 70 TYR n 1 71 ILE n 1 72 ASP n 1 73 LEU n 1 74 SER n 1 75 ALA n 1 76 TRP n 1 77 CYS n 1 78 TYR n 1 79 TYR n 1 80 CYS n 1 81 GLN n 1 82 ALA n 1 83 TYR n 1 84 VAL n 1 85 HIS n 1 86 HIS n 1 87 GLN n 1 88 ALA n 1 89 LEU n 1 90 LEU n 1 91 ASP n 1 92 VAL n 1 93 LYS n 1 94 ASN n 1 95 ILE n 1 96 ALA n 1 97 HIS n 1 98 GLN n 1 99 ASN n 1 100 LYS n 1 101 PHE n 1 102 GLY n 1 103 GLU n 1 104 ASP n 1 105 MET n 1 106 PRO n 1 107 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 107 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'HDAC6, KIAA0901, JM21' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3) codon plus' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28-lic _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code HDAC6_HUMAN _struct_ref.pdbx_db_accession Q9UBN7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;PLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQA YVHHQALLDVKNIAHQNKFGEDMPH ; _struct_ref.pdbx_align_begin 1109 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5KH9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 107 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9UBN7 _struct_ref_seq.db_align_beg 1109 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1213 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1109 _struct_ref_seq.pdbx_auth_seq_align_end 1213 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5KH9 GLY A 1 ? UNP Q9UBN7 ? ? 'expression tag' 1107 1 1 5KH9 SER A 2 ? UNP Q9UBN7 ? ? 'expression tag' 1108 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 6T5 non-polymer . '6-methyl-5-[(4-propan-2-ylphenyl)amino]-2~{H}-1,2,4-triazin-3-one' ? 'C13 H16 N4 O' 244.292 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FMT non-polymer . 'FORMIC ACID' ? 'C H2 O2' 46.025 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 UNX non-polymer . 'UNKNOWN ATOM OR ION' ? ? ? VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5KH9 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.17 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 43.26 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.6 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2M Na-formate, 0.2M Na-acetate pH4.6, 5% ethylene glycol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-10-02 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.92819 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.92819 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04-1 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5KH9 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.070 _reflns.d_resolution_low 34.810 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 46238 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.400 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.500 _reflns.pdbx_Rmerge_I_obs 0.062 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.500 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.069 _reflns.pdbx_Rpim_I_all 0.028 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 256160 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 1.070 1.100 ? 1.100 ? ? ? ? ? 96.600 ? ? ? ? 0.957 ? ? ? ? ? ? ? ? 3.100 ? ? ? ? ? ? ? 1 1 ? ? 4.790 34.810 ? 45.000 ? ? ? ? ? 99.800 ? ? ? ? 0.041 ? ? ? ? ? ? ? ? 5.600 ? ? ? ? ? ? ? 2 1 ? ? # _refine.aniso_B[1][1] -0.7500 _refine.aniso_B[1][2] -0.0000 _refine.aniso_B[1][3] -0.0000 _refine.aniso_B[2][2] -0.4000 _refine.aniso_B[2][3] -0.0000 _refine.aniso_B[3][3] 1.1500 _refine.B_iso_max 193.070 _refine.B_iso_mean 14.7550 _refine.B_iso_min 7.960 _refine.correlation_coeff_Fo_to_Fc 0.9790 _refine.correlation_coeff_Fo_to_Fc_free 0.9780 _refine.details ;Users of this crystal structure: verify our intepretion of the electron density. Amplitudes and unmerged intensities are included with this deposition. Diffraction images will be deposited in a public repository. Geometry restraints for the fragment candidate were prepared with GRADE. Ambiguous difference density suggests some form of covalent modification of Cys1147. ; _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5KH9 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.0700 _refine.ls_d_res_low 34.8000 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 44074 _refine.ls_number_reflns_R_free 2104 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.2900 _refine.ls_percent_reflns_R_free 4.6000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1363 _refine.ls_R_factor_R_free 0.1503 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1356 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model 'pdbid 3C5K' _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.0250 _refine.pdbx_overall_ESU_R_Free 0.0240 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 0.9310 _refine.overall_SU_ML 0.0200 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 1.0700 _refine_hist.d_res_low 34.8000 _refine_hist.pdbx_number_atoms_ligand 58 _refine_hist.number_atoms_solvent 79 _refine_hist.number_atoms_total 915 _refine_hist.pdbx_number_residues_total 100 _refine_hist.pdbx_B_iso_mean_ligand 32.92 _refine_hist.pdbx_B_iso_mean_solvent 28.67 _refine_hist.pdbx_number_atoms_protein 778 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.015 0.019 897 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.003 0.020 797 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.615 1.921 1241 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.111 3.000 1839 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.316 5.000 114 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 32.088 24.762 42 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 11.439 15.000 122 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 8.940 15.000 1 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.114 0.200 129 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.012 0.021 1139 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 228 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 1.432 1.248 430 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 1.430 1.248 431 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 1.978 1.881 543 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 2.231 3.000 1694 ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? 33.838 5.000 31 ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? 16.791 5.000 1739 ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.0700 _refine_ls_shell.d_res_low 1.0980 _refine_ls_shell.number_reflns_all 3269 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 158 _refine_ls_shell.number_reflns_R_work 3111 _refine_ls_shell.percent_reflns_obs 96.2600 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2710 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.3030 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5KH9 _struct.title ;Crystal structure of a low occupancy fragment candidate (5-[(4-Isopropylphenyl)amino]-6-methyl-1,2,4-triazin-3(2H)-one) bound in the ubiquitin binding pocket of the HDAC6 zinc-finger domain ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5KH9 _struct_keywords.text 'HISTONE DEACETYLASE, HDAC, HDAC6, FRAGMENT SCREENING, STRUCTURAL GENOMICS CONSORTIUM, SGC, DIAMOND I04-1 XCHEM, PANDDA, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 4 ? G N N 5 ? H N N 5 ? I N N 5 ? J N N 5 ? K N N 5 ? L N N 5 ? M N N 5 ? N N N 5 ? O N N 5 ? P N N 5 ? Q N N 5 ? R N N 5 ? S N N 5 ? T N N 5 ? U N N 5 ? V N N 5 ? W N N 5 ? X N N 5 ? Y N N 5 ? Z N N 5 ? AA N N 5 ? BA N N 5 ? CA N N 5 ? DA N N 5 ? EA N N 5 ? FA N N 5 ? GA N N 5 ? HA N N 5 ? IA N N 5 ? JA N N 5 ? KA N N 5 ? LA N N 5 ? MA N N 5 ? NA N N 6 ? OA N N 7 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 9 ? VAL A 13 ? HIS A 1115 VAL A 1119 5 ? 5 HELX_P HELX_P2 AA2 GLY A 53 ? GLY A 63 ? GLY A 1159 GLY A 1169 1 ? 11 HELX_P HELX_P3 AA3 HIS A 86 ? ALA A 88 ? HIS A 1192 ALA A 1194 5 ? 3 HELX_P HELX_P4 AA4 LEU A 89 ? GLY A 102 ? LEU A 1195 GLY A 1208 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 7 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 1113 A ZN 1303 1_555 ? ? ? ? ? ? ? 2.342 ? ? metalc2 metalc ? ? A HIS 9 ND1 ? ? ? 1_555 D ZN . ZN ? ? A HIS 1115 A ZN 1303 1_555 ? ? ? ? ? ? ? 2.138 ? ? metalc3 metalc ? ? A CYS 27 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 1133 A ZN 1302 1_555 ? ? ? ? ? ? ? 2.373 ? ? metalc4 metalc ? ? A CYS 30 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 1136 A ZN 1302 1_555 ? ? ? ? ? ? ? 2.351 ? ? metalc5 metalc ? ? A CYS 39 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 1145 A ZN 1301 1_555 ? ? ? ? ? ? ? 2.304 ? ? metalc6 metalc ? ? A CYS 47 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 1153 A ZN 1302 1_555 ? ? ? ? ? ? ? 2.355 ? ? metalc7 metalc ? ? A TYR 50 O ? ? ? 1_555 NA NA . NA ? ? A TYR 1156 A NA 1339 1_555 ? ? ? ? ? ? ? 2.902 ? ? metalc8 metalc ? ? A ILE 51 O ? ? ? 1_555 NA NA . NA ? ? A ILE 1157 A NA 1339 1_555 ? ? ? ? ? ? ? 2.399 ? ? metalc9 metalc ? ? A HIS 54 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 1160 A ZN 1302 1_555 ? ? ? ? ? ? ? 2.122 ? ? metalc10 metalc ? ? A HIS 58 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 1164 A ZN 1301 1_555 ? ? ? ? ? ? ? 2.081 ? ? metalc11 metalc ? ? A HIS 64 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 1170 A ZN 1301 1_555 ? ? ? ? ? ? ? 2.068 ? ? metalc12 metalc ? ? A CYS 77 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 1183 A ZN 1303 1_555 ? ? ? ? ? ? ? 2.335 ? ? metalc13 metalc ? ? A CYS 80 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 1186 A ZN 1303 1_555 ? ? ? ? ? ? ? 2.534 ? ? metalc14 metalc ? ? NA NA . NA ? ? ? 1_555 OA HOH . O ? ? A NA 1339 A HOH 1458 1_555 ? ? ? ? ? ? ? 2.453 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 45 ? CYS A 47 ? VAL A 1151 CYS A 1153 AA1 2 ASN A 36 ? CYS A 39 ? ASN A 1142 CYS A 1145 AA1 3 LEU A 66 ? SER A 69 ? LEU A 1172 SER A 1175 AA1 4 ALA A 75 ? CYS A 77 ? ALA A 1181 CYS A 1183 AA1 5 ALA A 82 ? TYR A 83 ? ALA A 1188 TYR A 1189 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O TYR A 46 ? O TYR A 1152 N TRP A 37 ? N TRP A 1143 AA1 2 3 N VAL A 38 ? N VAL A 1144 O LEU A 68 ? O LEU A 1174 AA1 3 4 N VAL A 67 ? N VAL A 1173 O TRP A 76 ? O TRP A 1182 AA1 4 5 N CYS A 77 ? N CYS A 1183 O ALA A 82 ? O ALA A 1188 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 1301 ? 4 'binding site for residue ZN A 1301' AC2 Software A ZN 1302 ? 4 'binding site for residue ZN A 1302' AC3 Software A ZN 1303 ? 4 'binding site for residue ZN A 1303' AC4 Software A FMT 1304 ? 5 'binding site for residue FMT A 1304' AC5 Software A 6T5 1305 ? 6 'binding site for residue 6T5 A 1305' AC6 Software A NA 1339 ? 3 'binding site for residue NA A 1339' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 39 ? CYS A 1145 . ? 1_555 ? 2 AC1 4 CYS A 42 ? CYS A 1148 . ? 1_555 ? 3 AC1 4 HIS A 58 ? HIS A 1164 . ? 1_555 ? 4 AC1 4 HIS A 64 ? HIS A 1170 . ? 1_555 ? 5 AC2 4 CYS A 27 ? CYS A 1133 . ? 1_555 ? 6 AC2 4 CYS A 30 ? CYS A 1136 . ? 1_555 ? 7 AC2 4 CYS A 47 ? CYS A 1153 . ? 1_555 ? 8 AC2 4 HIS A 54 ? HIS A 1160 . ? 1_555 ? 9 AC3 4 CYS A 7 ? CYS A 1113 . ? 1_555 ? 10 AC3 4 HIS A 9 ? HIS A 1115 . ? 1_555 ? 11 AC3 4 CYS A 77 ? CYS A 1183 . ? 1_555 ? 12 AC3 4 CYS A 80 ? CYS A 1186 . ? 1_555 ? 13 AC4 5 TRP A 37 ? TRP A 1143 . ? 1_555 ? 14 AC4 5 GLY A 48 ? GLY A 1154 . ? 1_555 ? 15 AC4 5 ARG A 49 ? ARG A 1155 . ? 1_555 ? 16 AC4 5 TYR A 78 ? TYR A 1184 . ? 1_555 ? 17 AC4 5 HOH OA . ? HOH A 1422 . ? 1_555 ? 18 AC5 6 TRP A 37 ? TRP A 1143 . ? 1_555 ? 19 AC5 6 ARG A 49 ? ARG A 1155 . ? 1_555 ? 20 AC5 6 TRP A 76 ? TRP A 1182 . ? 1_555 ? 21 AC5 6 TYR A 83 ? TYR A 1189 . ? 1_555 ? 22 AC5 6 ASN A 94 ? ASN A 1200 . ? 3_555 ? 23 AC5 6 HOH OA . ? HOH A 1447 . ? 1_555 ? 24 AC6 3 TYR A 50 ? TYR A 1156 . ? 1_555 ? 25 AC6 3 ILE A 51 ? ILE A 1157 . ? 1_555 ? 26 AC6 3 HOH OA . ? HOH A 1458 . ? 1_555 ? # _atom_sites.entry_id 5KH9 _atom_sites.fract_transf_matrix[1][1] 0.024135 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022646 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017684 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N NA O S X ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1107 ? ? ? A . n A 1 2 SER 2 1108 ? ? ? A . n A 1 3 PRO 3 1109 1109 PRO PRO A . n A 1 4 LEU 4 1110 1110 LEU LEU A . n A 1 5 PRO 5 1111 1111 PRO PRO A . n A 1 6 TRP 6 1112 1112 TRP TRP A . n A 1 7 CYS 7 1113 1113 CYS CYS A . n A 1 8 PRO 8 1114 1114 PRO PRO A . n A 1 9 HIS 9 1115 1115 HIS HIS A . n A 1 10 LEU 10 1116 1116 LEU LEU A . n A 1 11 VAL 11 1117 1117 VAL VAL A . n A 1 12 ALA 12 1118 1118 ALA ALA A . n A 1 13 VAL 13 1119 1119 VAL VAL A . n A 1 14 CYS 14 1120 1120 CYS CYS A . n A 1 15 PRO 15 1121 1121 PRO PRO A . n A 1 16 ILE 16 1122 1122 ILE ILE A . n A 1 17 PRO 17 1123 1123 PRO PRO A . n A 1 18 ALA 18 1124 1124 ALA ALA A . n A 1 19 ALA 19 1125 1125 ALA ALA A . n A 1 20 GLY 20 1126 1126 GLY GLY A . n A 1 21 LEU 21 1127 1127 LEU LEU A . n A 1 22 ASP 22 1128 1128 ASP ASP A . n A 1 23 VAL 23 1129 1129 VAL VAL A . n A 1 24 THR 24 1130 1130 THR THR A . n A 1 25 GLN 25 1131 1131 GLN GLN A . n A 1 26 PRO 26 1132 1132 PRO PRO A . n A 1 27 CYS 27 1133 1133 CYS CYS A . n A 1 28 GLY 28 1134 1134 GLY GLY A . n A 1 29 ASP 29 1135 1135 ASP ASP A . n A 1 30 CYS 30 1136 1136 CYS CYS A . n A 1 31 GLY 31 1137 1137 GLY GLY A . n A 1 32 THR 32 1138 1138 THR THR A . n A 1 33 ILE 33 1139 1139 ILE ILE A . n A 1 34 GLN 34 1140 1140 GLN GLN A . n A 1 35 GLU 35 1141 1141 GLU GLU A . n A 1 36 ASN 36 1142 1142 ASN ASN A . n A 1 37 TRP 37 1143 1143 TRP TRP A . n A 1 38 VAL 38 1144 1144 VAL VAL A . n A 1 39 CYS 39 1145 1145 CYS CYS A . n A 1 40 LEU 40 1146 1146 LEU LEU A . n A 1 41 SER 41 1147 1147 SER SER A . n A 1 42 CYS 42 1148 1148 CYS CYS A . n A 1 43 TYR 43 1149 1149 TYR TYR A . n A 1 44 GLN 44 1150 1150 GLN GLN A . n A 1 45 VAL 45 1151 1151 VAL VAL A . n A 1 46 TYR 46 1152 1152 TYR TYR A . n A 1 47 CYS 47 1153 1153 CYS CYS A . n A 1 48 GLY 48 1154 1154 GLY GLY A . n A 1 49 ARG 49 1155 1155 ARG ARG A . n A 1 50 TYR 50 1156 1156 TYR TYR A . n A 1 51 ILE 51 1157 1157 ILE ILE A . n A 1 52 ASN 52 1158 1158 ASN ASN A . n A 1 53 GLY 53 1159 1159 GLY GLY A . n A 1 54 HIS 54 1160 1160 HIS HIS A . n A 1 55 MET 55 1161 1161 MET MET A . n A 1 56 LEU 56 1162 1162 LEU LEU A . n A 1 57 GLN 57 1163 1163 GLN GLN A . n A 1 58 HIS 58 1164 1164 HIS HIS A . n A 1 59 HIS 59 1165 1165 HIS HIS A . n A 1 60 GLY 60 1166 1166 GLY GLY A . n A 1 61 ASN 61 1167 1167 ASN ASN A . n A 1 62 SER 62 1168 1168 SER SER A . n A 1 63 GLY 63 1169 1169 GLY GLY A . n A 1 64 HIS 64 1170 1170 HIS HIS A . n A 1 65 PRO 65 1171 1171 PRO PRO A . n A 1 66 LEU 66 1172 1172 LEU LEU A . n A 1 67 VAL 67 1173 1173 VAL VAL A . n A 1 68 LEU 68 1174 1174 LEU LEU A . n A 1 69 SER 69 1175 1175 SER SER A . n A 1 70 TYR 70 1176 1176 TYR TYR A . n A 1 71 ILE 71 1177 1177 ILE ILE A . n A 1 72 ASP 72 1178 1178 ASP ASP A . n A 1 73 LEU 73 1179 1179 LEU LEU A . n A 1 74 SER 74 1180 1180 SER SER A . n A 1 75 ALA 75 1181 1181 ALA ALA A . n A 1 76 TRP 76 1182 1182 TRP TRP A . n A 1 77 CYS 77 1183 1183 CYS CYS A . n A 1 78 TYR 78 1184 1184 TYR TYR A . n A 1 79 TYR 79 1185 1185 TYR TYR A . n A 1 80 CYS 80 1186 1186 CYS CYS A . n A 1 81 GLN 81 1187 1187 GLN GLN A . n A 1 82 ALA 82 1188 1188 ALA ALA A . n A 1 83 TYR 83 1189 1189 TYR TYR A . n A 1 84 VAL 84 1190 1190 VAL VAL A . n A 1 85 HIS 85 1191 1191 HIS HIS A . n A 1 86 HIS 86 1192 1192 HIS HIS A . n A 1 87 GLN 87 1193 1193 GLN GLN A . n A 1 88 ALA 88 1194 1194 ALA ALA A . n A 1 89 LEU 89 1195 1195 LEU LEU A . n A 1 90 LEU 90 1196 1196 LEU LEU A . n A 1 91 ASP 91 1197 1197 ASP ASP A . n A 1 92 VAL 92 1198 1198 VAL VAL A . n A 1 93 LYS 93 1199 1199 LYS LYS A . n A 1 94 ASN 94 1200 1200 ASN ASN A . n A 1 95 ILE 95 1201 1201 ILE ILE A . n A 1 96 ALA 96 1202 1202 ALA ALA A . n A 1 97 HIS 97 1203 1203 HIS HIS A . n A 1 98 GLN 98 1204 1204 GLN GLN A . n A 1 99 ASN 99 1205 1205 ASN ASN A . n A 1 100 LYS 100 1206 1206 LYS LYS A . n A 1 101 PHE 101 1207 1207 PHE PHE A . n A 1 102 GLY 102 1208 1208 GLY GLY A . n A 1 103 GLU 103 1209 ? ? ? A . n A 1 104 ASP 104 1210 ? ? ? A . n A 1 105 MET 105 1211 ? ? ? A . n A 1 106 PRO 106 1212 ? ? ? A . n A 1 107 HIS 107 1213 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'Structural Genomics Consortium' _pdbx_SG_project.initial_of_center SGC # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 1301 201 ZN ZN A . C 2 ZN 1 1302 202 ZN ZN A . D 2 ZN 1 1303 203 ZN ZN A . E 3 FMT 1 1304 1 FMT FMT A . F 4 6T5 1 1305 1 6T5 469 A . G 5 UNX 1 1306 1 UNX UNX A . H 5 UNX 1 1307 2 UNX UNX A . I 5 UNX 1 1308 8 UNX UNX A . J 5 UNX 1 1309 10 UNX UNX A . K 5 UNX 1 1310 1 UNX UNX A . L 5 UNX 1 1311 2 UNX UNX A . M 5 UNX 1 1312 3 UNX UNX A . N 5 UNX 1 1313 4 UNX UNX A . O 5 UNX 1 1314 5 UNX UNX A . P 5 UNX 1 1315 6 UNX UNX A . Q 5 UNX 1 1316 7 UNX UNX A . R 5 UNX 1 1317 8 UNX UNX A . S 5 UNX 1 1318 10 UNX UNX A . T 5 UNX 1 1319 11 UNX UNX A . U 5 UNX 1 1320 13 UNX UNX A . V 5 UNX 1 1321 14 UNX UNX A . W 5 UNX 1 1322 16 UNX UNX A . X 5 UNX 1 1323 17 UNX UNX A . Y 5 UNX 1 1324 18 UNX UNX A . Z 5 UNX 1 1325 19 UNX UNX A . AA 5 UNX 1 1326 20 UNX UNX A . BA 5 UNX 1 1327 21 UNX UNX A . CA 5 UNX 1 1328 22 UNX UNX A . DA 5 UNX 1 1329 23 UNX UNX A . EA 5 UNX 1 1330 24 UNX UNX A . FA 5 UNX 1 1331 25 UNX UNX A . GA 5 UNX 1 1332 26 UNX UNX A . HA 5 UNX 1 1333 27 UNX UNX A . IA 5 UNX 1 1334 28 UNX UNX A . JA 5 UNX 1 1335 29 UNX UNX A . KA 5 UNX 1 1336 30 UNX UNX A . LA 5 UNX 1 1337 31 UNX UNX A . MA 5 UNX 1 1338 32 UNX UNX A . NA 6 NA 1 1339 1 NA NA A . OA 7 HOH 1 1401 92 HOH HOH A . OA 7 HOH 2 1402 61 HOH HOH A . OA 7 HOH 3 1403 99 HOH HOH A . OA 7 HOH 4 1404 32 HOH HOH A . OA 7 HOH 5 1405 270 HOH HOH A . OA 7 HOH 6 1406 248 HOH HOH A . OA 7 HOH 7 1407 33 HOH HOH A . OA 7 HOH 8 1408 212 HOH HOH A . OA 7 HOH 9 1409 216 HOH HOH A . OA 7 HOH 10 1410 41 HOH HOH A . OA 7 HOH 11 1411 252 HOH HOH A . OA 7 HOH 12 1412 209 HOH HOH A . OA 7 HOH 13 1413 235 HOH HOH A . OA 7 HOH 14 1414 63 HOH HOH A . OA 7 HOH 15 1415 30 HOH HOH A . OA 7 HOH 16 1416 34 HOH HOH A . OA 7 HOH 17 1417 305 HOH HOH A . OA 7 HOH 18 1418 211 HOH HOH A . OA 7 HOH 19 1419 43 HOH HOH A . OA 7 HOH 20 1420 100 HOH HOH A . OA 7 HOH 21 1421 232 HOH HOH A . OA 7 HOH 22 1422 204 HOH HOH A . OA 7 HOH 23 1423 255 HOH HOH A . OA 7 HOH 24 1424 244 HOH HOH A . OA 7 HOH 25 1425 262 HOH HOH A . OA 7 HOH 26 1426 341 HOH HOH A . OA 7 HOH 27 1427 214 HOH HOH A . OA 7 HOH 28 1428 340 HOH HOH A . OA 7 HOH 29 1429 206 HOH HOH A . OA 7 HOH 30 1430 233 HOH HOH A . OA 7 HOH 31 1431 276 HOH HOH A . OA 7 HOH 32 1432 98 HOH HOH A . OA 7 HOH 33 1433 258 HOH HOH A . OA 7 HOH 34 1434 238 HOH HOH A . OA 7 HOH 35 1435 20 HOH HOH A . OA 7 HOH 36 1436 331 HOH HOH A . OA 7 HOH 37 1437 42 HOH HOH A . OA 7 HOH 38 1438 225 HOH HOH A . OA 7 HOH 39 1439 228 HOH HOH A . OA 7 HOH 40 1440 207 HOH HOH A . OA 7 HOH 41 1441 249 HOH HOH A . OA 7 HOH 42 1442 93 HOH HOH A . OA 7 HOH 43 1443 44 HOH HOH A . OA 7 HOH 44 1444 237 HOH HOH A . OA 7 HOH 45 1445 241 HOH HOH A . OA 7 HOH 46 1446 280 HOH HOH A . OA 7 HOH 47 1447 37 HOH HOH A . OA 7 HOH 48 1448 40 HOH HOH A . OA 7 HOH 49 1449 347 HOH HOH A . OA 7 HOH 50 1450 88 HOH HOH A . OA 7 HOH 51 1451 218 HOH HOH A . OA 7 HOH 52 1452 59 HOH HOH A . OA 7 HOH 53 1453 210 HOH HOH A . OA 7 HOH 54 1454 240 HOH HOH A . OA 7 HOH 55 1455 250 HOH HOH A . OA 7 HOH 56 1456 283 HOH HOH A . OA 7 HOH 57 1457 101 HOH HOH A . OA 7 HOH 58 1458 297 HOH HOH A . OA 7 HOH 59 1459 239 HOH HOH A . OA 7 HOH 60 1460 2 HOH HOH A . OA 7 HOH 61 1461 327 HOH HOH A . OA 7 HOH 62 1462 261 HOH HOH A . OA 7 HOH 63 1463 221 HOH HOH A . OA 7 HOH 64 1464 95 HOH HOH A . OA 7 HOH 65 1465 76 HOH HOH A . OA 7 HOH 66 1466 91 HOH HOH A . OA 7 HOH 67 1467 277 HOH HOH A . OA 7 HOH 68 1468 97 HOH HOH A . OA 7 HOH 69 1469 58 HOH HOH A . OA 7 HOH 70 1470 38 HOH HOH A . OA 7 HOH 71 1471 279 HOH HOH A . OA 7 HOH 72 1472 342 HOH HOH A . OA 7 HOH 73 1473 344 HOH HOH A . OA 7 HOH 74 1474 356 HOH HOH A . OA 7 HOH 75 1475 36 HOH HOH A . OA 7 HOH 76 1476 45 HOH HOH A . OA 7 HOH 77 1477 94 HOH HOH A . OA 7 HOH 78 1478 4 HOH HOH A . OA 7 HOH 79 1479 31 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,AA,BA,CA,DA,EA,FA,GA,HA,IA,JA,KA,LA,MA,NA,OA # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 320 ? 1 MORE -10 ? 1 'SSA (A^2)' 6180 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 7 ? A CYS 1113 ? 1_555 ZN ? D ZN . ? A ZN 1303 ? 1_555 ND1 ? A HIS 9 ? A HIS 1115 ? 1_555 110.2 ? 2 SG ? A CYS 7 ? A CYS 1113 ? 1_555 ZN ? D ZN . ? A ZN 1303 ? 1_555 SG ? A CYS 77 ? A CYS 1183 ? 1_555 117.5 ? 3 ND1 ? A HIS 9 ? A HIS 1115 ? 1_555 ZN ? D ZN . ? A ZN 1303 ? 1_555 SG ? A CYS 77 ? A CYS 1183 ? 1_555 99.0 ? 4 SG ? A CYS 7 ? A CYS 1113 ? 1_555 ZN ? D ZN . ? A ZN 1303 ? 1_555 SG ? A CYS 80 ? A CYS 1186 ? 1_555 111.4 ? 5 ND1 ? A HIS 9 ? A HIS 1115 ? 1_555 ZN ? D ZN . ? A ZN 1303 ? 1_555 SG ? A CYS 80 ? A CYS 1186 ? 1_555 106.5 ? 6 SG ? A CYS 77 ? A CYS 1183 ? 1_555 ZN ? D ZN . ? A ZN 1303 ? 1_555 SG ? A CYS 80 ? A CYS 1186 ? 1_555 111.1 ? 7 SG ? A CYS 27 ? A CYS 1133 ? 1_555 ZN ? C ZN . ? A ZN 1302 ? 1_555 SG ? A CYS 30 ? A CYS 1136 ? 1_555 109.8 ? 8 SG ? A CYS 27 ? A CYS 1133 ? 1_555 ZN ? C ZN . ? A ZN 1302 ? 1_555 SG ? A CYS 47 ? A CYS 1153 ? 1_555 113.5 ? 9 SG ? A CYS 30 ? A CYS 1136 ? 1_555 ZN ? C ZN . ? A ZN 1302 ? 1_555 SG ? A CYS 47 ? A CYS 1153 ? 1_555 115.1 ? 10 SG ? A CYS 27 ? A CYS 1133 ? 1_555 ZN ? C ZN . ? A ZN 1302 ? 1_555 ND1 ? A HIS 54 ? A HIS 1160 ? 1_555 107.3 ? 11 SG ? A CYS 30 ? A CYS 1136 ? 1_555 ZN ? C ZN . ? A ZN 1302 ? 1_555 ND1 ? A HIS 54 ? A HIS 1160 ? 1_555 110.3 ? 12 SG ? A CYS 47 ? A CYS 1153 ? 1_555 ZN ? C ZN . ? A ZN 1302 ? 1_555 ND1 ? A HIS 54 ? A HIS 1160 ? 1_555 100.1 ? 13 SG ? A CYS 39 ? A CYS 1145 ? 1_555 ZN ? B ZN . ? A ZN 1301 ? 1_555 NE2 ? A HIS 58 ? A HIS 1164 ? 1_555 116.0 ? 14 SG ? A CYS 39 ? A CYS 1145 ? 1_555 ZN ? B ZN . ? A ZN 1301 ? 1_555 ND1 ? A HIS 64 ? A HIS 1170 ? 1_555 109.8 ? 15 NE2 ? A HIS 58 ? A HIS 1164 ? 1_555 ZN ? B ZN . ? A ZN 1301 ? 1_555 ND1 ? A HIS 64 ? A HIS 1170 ? 1_555 111.8 ? 16 O ? A TYR 50 ? A TYR 1156 ? 1_555 NA ? NA NA . ? A NA 1339 ? 1_555 O ? A ILE 51 ? A ILE 1157 ? 1_555 81.4 ? 17 O ? A TYR 50 ? A TYR 1156 ? 1_555 NA ? NA NA . ? A NA 1339 ? 1_555 O ? OA HOH . ? A HOH 1458 ? 1_555 88.7 ? 18 O ? A ILE 51 ? A ILE 1157 ? 1_555 NA ? NA NA . ? A NA 1339 ? 1_555 O ? OA HOH . ? A HOH 1458 ? 1_555 89.6 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-07-27 2 'Structure model' 1 1 2018-03-21 3 'Structure model' 1 2 2019-02-27 4 'Structure model' 1 3 2023-09-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Database references' 6 4 'Structure model' 'Data collection' 7 4 'Structure model' 'Database references' 8 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' diffrn_source 4 2 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' citation_author 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond 8 4 'Structure model' database_2 9 4 'Structure model' diffrn_radiation_wavelength 10 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 2 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 14 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 15 3 'Structure model' '_citation_author.identifier_ORCID' 16 4 'Structure model' '_database_2.pdbx_DOI' 17 4 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.5.26 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0151 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.20 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 SG A CYS 1148 ? ? UNK A UNX 1306 ? ? 1.56 2 1 SG A CYS 1148 ? ? UNK A UNX 1307 ? ? 1.56 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 OE1 _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 GLU _pdbx_validate_rmsd_angle.auth_seq_id_1 1141 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 A _pdbx_validate_rmsd_angle.auth_atom_id_2 CD _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 GLU _pdbx_validate_rmsd_angle.auth_seq_id_2 1141 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 A _pdbx_validate_rmsd_angle.auth_atom_id_3 OE2 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 GLU _pdbx_validate_rmsd_angle.auth_seq_id_3 1141 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 A _pdbx_validate_rmsd_angle.angle_value 114.82 _pdbx_validate_rmsd_angle.angle_target_value 123.30 _pdbx_validate_rmsd_angle.angle_deviation -8.48 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.20 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 1135 ? ? -93.84 -61.08 2 1 ASP A 1135 ? ? -93.80 -61.10 3 1 ILE A 1157 ? ? -101.13 -103.62 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ILE 1177 ? CD1 ? A ILE 71 CD1 2 1 Y 1 A GLN 1204 ? CD ? A GLN 98 CD 3 1 Y 1 A GLN 1204 ? OE1 ? A GLN 98 OE1 4 1 Y 1 A GLN 1204 ? NE2 ? A GLN 98 NE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 1107 ? A GLY 1 2 1 Y 1 A SER 1108 ? A SER 2 3 1 Y 1 A GLU 1209 ? A GLU 103 4 1 Y 1 A ASP 1210 ? A ASP 104 5 1 Y 1 A MET 1211 ? A MET 105 6 1 Y 1 A PRO 1212 ? A PRO 106 7 1 Y 1 A HIS 1213 ? A HIS 107 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 6T5 O O N N 1 6T5 C3 C N N 2 6T5 N1 N N N 3 6T5 N2 N N N 4 6T5 C1 C N N 5 6T5 C C N N 6 6T5 N N N N 7 6T5 C2 C N N 8 6T5 N3 N N N 9 6T5 C4 C Y N 10 6T5 C9 C Y N 11 6T5 C8 C Y N 12 6T5 C7 C Y N 13 6T5 C10 C N N 14 6T5 C12 C N N 15 6T5 C11 C N N 16 6T5 C6 C Y N 17 6T5 C5 C Y N 18 6T5 H1 H N N 19 6T5 H2 H N N 20 6T5 H3 H N N 21 6T5 H4 H N N 22 6T5 H5 H N N 23 6T5 H6 H N N 24 6T5 H7 H N N 25 6T5 H8 H N N 26 6T5 H9 H N N 27 6T5 H10 H N N 28 6T5 H11 H N N 29 6T5 H12 H N N 30 6T5 H13 H N N 31 6T5 H14 H N N 32 6T5 H15 H N N 33 6T5 H16 H N N 34 ALA N N N N 35 ALA CA C N S 36 ALA C C N N 37 ALA O O N N 38 ALA CB C N N 39 ALA OXT O N N 40 ALA H H N N 41 ALA H2 H N N 42 ALA HA H N N 43 ALA HB1 H N N 44 ALA HB2 H N N 45 ALA HB3 H N N 46 ALA HXT H N N 47 ARG N N N N 48 ARG CA C N S 49 ARG C C N N 50 ARG O O N N 51 ARG CB C N N 52 ARG CG C N N 53 ARG CD C N N 54 ARG NE N N N 55 ARG CZ C N N 56 ARG NH1 N N N 57 ARG NH2 N N N 58 ARG OXT O N N 59 ARG H H N N 60 ARG H2 H N N 61 ARG HA H N N 62 ARG HB2 H N N 63 ARG HB3 H N N 64 ARG HG2 H N N 65 ARG HG3 H N N 66 ARG HD2 H N N 67 ARG HD3 H N N 68 ARG HE H N N 69 ARG HH11 H N N 70 ARG HH12 H N N 71 ARG HH21 H N N 72 ARG HH22 H N N 73 ARG HXT H N N 74 ASN N N N N 75 ASN CA C N S 76 ASN C C N N 77 ASN O O N N 78 ASN CB C N N 79 ASN CG C N N 80 ASN OD1 O N N 81 ASN ND2 N N N 82 ASN OXT O N N 83 ASN H H N N 84 ASN H2 H N N 85 ASN HA H N N 86 ASN HB2 H N N 87 ASN HB3 H N N 88 ASN HD21 H N N 89 ASN HD22 H N N 90 ASN HXT H N N 91 ASP N N N N 92 ASP CA C N S 93 ASP C C N N 94 ASP O O N N 95 ASP CB C N N 96 ASP CG C N N 97 ASP OD1 O N N 98 ASP OD2 O N N 99 ASP OXT O N N 100 ASP H H N N 101 ASP H2 H N N 102 ASP HA H N N 103 ASP HB2 H N N 104 ASP HB3 H N N 105 ASP HD2 H N N 106 ASP HXT H N N 107 CYS N N N N 108 CYS CA C N R 109 CYS C C N N 110 CYS O O N N 111 CYS CB C N N 112 CYS SG S N N 113 CYS OXT O N N 114 CYS H H N N 115 CYS H2 H N N 116 CYS HA H N N 117 CYS HB2 H N N 118 CYS HB3 H N N 119 CYS HG H N N 120 CYS HXT H N N 121 FMT C C N N 122 FMT O1 O N N 123 FMT O2 O N N 124 FMT H H N N 125 FMT HO2 H N N 126 GLN N N N N 127 GLN CA C N S 128 GLN C C N N 129 GLN O O N N 130 GLN CB C N N 131 GLN CG C N N 132 GLN CD C N N 133 GLN OE1 O N N 134 GLN NE2 N N N 135 GLN OXT O N N 136 GLN H H N N 137 GLN H2 H N N 138 GLN HA H N N 139 GLN HB2 H N N 140 GLN HB3 H N N 141 GLN HG2 H N N 142 GLN HG3 H N N 143 GLN HE21 H N N 144 GLN HE22 H N N 145 GLN HXT H N N 146 GLU N N N N 147 GLU CA C N S 148 GLU C C N N 149 GLU O O N N 150 GLU CB C N N 151 GLU CG C N N 152 GLU CD C N N 153 GLU OE1 O N N 154 GLU OE2 O N N 155 GLU OXT O N N 156 GLU H H N N 157 GLU H2 H N N 158 GLU HA H N N 159 GLU HB2 H N N 160 GLU HB3 H N N 161 GLU HG2 H N N 162 GLU HG3 H N N 163 GLU HE2 H N N 164 GLU HXT H N N 165 GLY N N N N 166 GLY CA C N N 167 GLY C C N N 168 GLY O O N N 169 GLY OXT O N N 170 GLY H H N N 171 GLY H2 H N N 172 GLY HA2 H N N 173 GLY HA3 H N N 174 GLY HXT H N N 175 HIS N N N N 176 HIS CA C N S 177 HIS C C N N 178 HIS O O N N 179 HIS CB C N N 180 HIS CG C Y N 181 HIS ND1 N Y N 182 HIS CD2 C Y N 183 HIS CE1 C Y N 184 HIS NE2 N Y N 185 HIS OXT O N N 186 HIS H H N N 187 HIS H2 H N N 188 HIS HA H N N 189 HIS HB2 H N N 190 HIS HB3 H N N 191 HIS HD1 H N N 192 HIS HD2 H N N 193 HIS HE1 H N N 194 HIS HE2 H N N 195 HIS HXT H N N 196 HOH O O N N 197 HOH H1 H N N 198 HOH H2 H N N 199 ILE N N N N 200 ILE CA C N S 201 ILE C C N N 202 ILE O O N N 203 ILE CB C N S 204 ILE CG1 C N N 205 ILE CG2 C N N 206 ILE CD1 C N N 207 ILE OXT O N N 208 ILE H H N N 209 ILE H2 H N N 210 ILE HA H N N 211 ILE HB H N N 212 ILE HG12 H N N 213 ILE HG13 H N N 214 ILE HG21 H N N 215 ILE HG22 H N N 216 ILE HG23 H N N 217 ILE HD11 H N N 218 ILE HD12 H N N 219 ILE HD13 H N N 220 ILE HXT H N N 221 LEU N N N N 222 LEU CA C N S 223 LEU C C N N 224 LEU O O N N 225 LEU CB C N N 226 LEU CG C N N 227 LEU CD1 C N N 228 LEU CD2 C N N 229 LEU OXT O N N 230 LEU H H N N 231 LEU H2 H N N 232 LEU HA H N N 233 LEU HB2 H N N 234 LEU HB3 H N N 235 LEU HG H N N 236 LEU HD11 H N N 237 LEU HD12 H N N 238 LEU HD13 H N N 239 LEU HD21 H N N 240 LEU HD22 H N N 241 LEU HD23 H N N 242 LEU HXT H N N 243 LYS N N N N 244 LYS CA C N S 245 LYS C C N N 246 LYS O O N N 247 LYS CB C N N 248 LYS CG C N N 249 LYS CD C N N 250 LYS CE C N N 251 LYS NZ N N N 252 LYS OXT O N N 253 LYS H H N N 254 LYS H2 H N N 255 LYS HA H N N 256 LYS HB2 H N N 257 LYS HB3 H N N 258 LYS HG2 H N N 259 LYS HG3 H N N 260 LYS HD2 H N N 261 LYS HD3 H N N 262 LYS HE2 H N N 263 LYS HE3 H N N 264 LYS HZ1 H N N 265 LYS HZ2 H N N 266 LYS HZ3 H N N 267 LYS HXT H N N 268 MET N N N N 269 MET CA C N S 270 MET C C N N 271 MET O O N N 272 MET CB C N N 273 MET CG C N N 274 MET SD S N N 275 MET CE C N N 276 MET OXT O N N 277 MET H H N N 278 MET H2 H N N 279 MET HA H N N 280 MET HB2 H N N 281 MET HB3 H N N 282 MET HG2 H N N 283 MET HG3 H N N 284 MET HE1 H N N 285 MET HE2 H N N 286 MET HE3 H N N 287 MET HXT H N N 288 NA NA NA N N 289 PHE N N N N 290 PHE CA C N S 291 PHE C C N N 292 PHE O O N N 293 PHE CB C N N 294 PHE CG C Y N 295 PHE CD1 C Y N 296 PHE CD2 C Y N 297 PHE CE1 C Y N 298 PHE CE2 C Y N 299 PHE CZ C Y N 300 PHE OXT O N N 301 PHE H H N N 302 PHE H2 H N N 303 PHE HA H N N 304 PHE HB2 H N N 305 PHE HB3 H N N 306 PHE HD1 H N N 307 PHE HD2 H N N 308 PHE HE1 H N N 309 PHE HE2 H N N 310 PHE HZ H N N 311 PHE HXT H N N 312 PRO N N N N 313 PRO CA C N S 314 PRO C C N N 315 PRO O O N N 316 PRO CB C N N 317 PRO CG C N N 318 PRO CD C N N 319 PRO OXT O N N 320 PRO H H N N 321 PRO HA H N N 322 PRO HB2 H N N 323 PRO HB3 H N N 324 PRO HG2 H N N 325 PRO HG3 H N N 326 PRO HD2 H N N 327 PRO HD3 H N N 328 PRO HXT H N N 329 SER N N N N 330 SER CA C N S 331 SER C C N N 332 SER O O N N 333 SER CB C N N 334 SER OG O N N 335 SER OXT O N N 336 SER H H N N 337 SER H2 H N N 338 SER HA H N N 339 SER HB2 H N N 340 SER HB3 H N N 341 SER HG H N N 342 SER HXT H N N 343 THR N N N N 344 THR CA C N S 345 THR C C N N 346 THR O O N N 347 THR CB C N R 348 THR OG1 O N N 349 THR CG2 C N N 350 THR OXT O N N 351 THR H H N N 352 THR H2 H N N 353 THR HA H N N 354 THR HB H N N 355 THR HG1 H N N 356 THR HG21 H N N 357 THR HG22 H N N 358 THR HG23 H N N 359 THR HXT H N N 360 TRP N N N N 361 TRP CA C N S 362 TRP C C N N 363 TRP O O N N 364 TRP CB C N N 365 TRP CG C Y N 366 TRP CD1 C Y N 367 TRP CD2 C Y N 368 TRP NE1 N Y N 369 TRP CE2 C Y N 370 TRP CE3 C Y N 371 TRP CZ2 C Y N 372 TRP CZ3 C Y N 373 TRP CH2 C Y N 374 TRP OXT O N N 375 TRP H H N N 376 TRP H2 H N N 377 TRP HA H N N 378 TRP HB2 H N N 379 TRP HB3 H N N 380 TRP HD1 H N N 381 TRP HE1 H N N 382 TRP HE3 H N N 383 TRP HZ2 H N N 384 TRP HZ3 H N N 385 TRP HH2 H N N 386 TRP HXT H N N 387 TYR N N N N 388 TYR CA C N S 389 TYR C C N N 390 TYR O O N N 391 TYR CB C N N 392 TYR CG C Y N 393 TYR CD1 C Y N 394 TYR CD2 C Y N 395 TYR CE1 C Y N 396 TYR CE2 C Y N 397 TYR CZ C Y N 398 TYR OH O N N 399 TYR OXT O N N 400 TYR H H N N 401 TYR H2 H N N 402 TYR HA H N N 403 TYR HB2 H N N 404 TYR HB3 H N N 405 TYR HD1 H N N 406 TYR HD2 H N N 407 TYR HE1 H N N 408 TYR HE2 H N N 409 TYR HH H N N 410 TYR HXT H N N 411 VAL N N N N 412 VAL CA C N S 413 VAL C C N N 414 VAL O O N N 415 VAL CB C N N 416 VAL CG1 C N N 417 VAL CG2 C N N 418 VAL OXT O N N 419 VAL H H N N 420 VAL H2 H N N 421 VAL HA H N N 422 VAL HB H N N 423 VAL HG11 H N N 424 VAL HG12 H N N 425 VAL HG13 H N N 426 VAL HG21 H N N 427 VAL HG22 H N N 428 VAL HG23 H N N 429 VAL HXT H N N 430 ZN ZN ZN N N 431 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 6T5 O C3 doub N N 1 6T5 N1 C3 sing N N 2 6T5 N1 N2 sing N N 3 6T5 C3 N sing N N 4 6T5 N2 C1 doub N N 5 6T5 N C2 doub N N 6 6T5 C5 C6 doub Y N 7 6T5 C5 C4 sing Y N 8 6T5 C1 C2 sing N N 9 6T5 C1 C sing N N 10 6T5 C2 N3 sing N N 11 6T5 C6 C7 sing Y N 12 6T5 C11 C10 sing N N 13 6T5 N3 C4 sing N N 14 6T5 C4 C9 doub Y N 15 6T5 C7 C10 sing N N 16 6T5 C7 C8 doub Y N 17 6T5 C10 C12 sing N N 18 6T5 C9 C8 sing Y N 19 6T5 N1 H1 sing N N 20 6T5 C H2 sing N N 21 6T5 C H3 sing N N 22 6T5 C H4 sing N N 23 6T5 N3 H5 sing N N 24 6T5 C9 H6 sing N N 25 6T5 C8 H7 sing N N 26 6T5 C10 H8 sing N N 27 6T5 C12 H9 sing N N 28 6T5 C12 H10 sing N N 29 6T5 C12 H11 sing N N 30 6T5 C11 H12 sing N N 31 6T5 C11 H13 sing N N 32 6T5 C11 H14 sing N N 33 6T5 C6 H15 sing N N 34 6T5 C5 H16 sing N N 35 ALA N CA sing N N 36 ALA N H sing N N 37 ALA N H2 sing N N 38 ALA CA C sing N N 39 ALA CA CB sing N N 40 ALA CA HA sing N N 41 ALA C O doub N N 42 ALA C OXT sing N N 43 ALA CB HB1 sing N N 44 ALA CB HB2 sing N N 45 ALA CB HB3 sing N N 46 ALA OXT HXT sing N N 47 ARG N CA sing N N 48 ARG N H sing N N 49 ARG N H2 sing N N 50 ARG CA C sing N N 51 ARG CA CB sing N N 52 ARG CA HA sing N N 53 ARG C O doub N N 54 ARG C OXT sing N N 55 ARG CB CG sing N N 56 ARG CB HB2 sing N N 57 ARG CB HB3 sing N N 58 ARG CG CD sing N N 59 ARG CG HG2 sing N N 60 ARG CG HG3 sing N N 61 ARG CD NE sing N N 62 ARG CD HD2 sing N N 63 ARG CD HD3 sing N N 64 ARG NE CZ sing N N 65 ARG NE HE sing N N 66 ARG CZ NH1 sing N N 67 ARG CZ NH2 doub N N 68 ARG NH1 HH11 sing N N 69 ARG NH1 HH12 sing N N 70 ARG NH2 HH21 sing N N 71 ARG NH2 HH22 sing N N 72 ARG OXT HXT sing N N 73 ASN N CA sing N N 74 ASN N H sing N N 75 ASN N H2 sing N N 76 ASN CA C sing N N 77 ASN CA CB sing N N 78 ASN CA HA sing N N 79 ASN C O doub N N 80 ASN C OXT sing N N 81 ASN CB CG sing N N 82 ASN CB HB2 sing N N 83 ASN CB HB3 sing N N 84 ASN CG OD1 doub N N 85 ASN CG ND2 sing N N 86 ASN ND2 HD21 sing N N 87 ASN ND2 HD22 sing N N 88 ASN OXT HXT sing N N 89 ASP N CA sing N N 90 ASP N H sing N N 91 ASP N H2 sing N N 92 ASP CA C sing N N 93 ASP CA CB sing N N 94 ASP CA HA sing N N 95 ASP C O doub N N 96 ASP C OXT sing N N 97 ASP CB CG sing N N 98 ASP CB HB2 sing N N 99 ASP CB HB3 sing N N 100 ASP CG OD1 doub N N 101 ASP CG OD2 sing N N 102 ASP OD2 HD2 sing N N 103 ASP OXT HXT sing N N 104 CYS N CA sing N N 105 CYS N H sing N N 106 CYS N H2 sing N N 107 CYS CA C sing N N 108 CYS CA CB sing N N 109 CYS CA HA sing N N 110 CYS C O doub N N 111 CYS C OXT sing N N 112 CYS CB SG sing N N 113 CYS CB HB2 sing N N 114 CYS CB HB3 sing N N 115 CYS SG HG sing N N 116 CYS OXT HXT sing N N 117 FMT C O1 doub N N 118 FMT C O2 sing N N 119 FMT C H sing N N 120 FMT O2 HO2 sing N N 121 GLN N CA sing N N 122 GLN N H sing N N 123 GLN N H2 sing N N 124 GLN CA C sing N N 125 GLN CA CB sing N N 126 GLN CA HA sing N N 127 GLN C O doub N N 128 GLN C OXT sing N N 129 GLN CB CG sing N N 130 GLN CB HB2 sing N N 131 GLN CB HB3 sing N N 132 GLN CG CD sing N N 133 GLN CG HG2 sing N N 134 GLN CG HG3 sing N N 135 GLN CD OE1 doub N N 136 GLN CD NE2 sing N N 137 GLN NE2 HE21 sing N N 138 GLN NE2 HE22 sing N N 139 GLN OXT HXT sing N N 140 GLU N CA sing N N 141 GLU N H sing N N 142 GLU N H2 sing N N 143 GLU CA C sing N N 144 GLU CA CB sing N N 145 GLU CA HA sing N N 146 GLU C O doub N N 147 GLU C OXT sing N N 148 GLU CB CG sing N N 149 GLU CB HB2 sing N N 150 GLU CB HB3 sing N N 151 GLU CG CD sing N N 152 GLU CG HG2 sing N N 153 GLU CG HG3 sing N N 154 GLU CD OE1 doub N N 155 GLU CD OE2 sing N N 156 GLU OE2 HE2 sing N N 157 GLU OXT HXT sing N N 158 GLY N CA sing N N 159 GLY N H sing N N 160 GLY N H2 sing N N 161 GLY CA C sing N N 162 GLY CA HA2 sing N N 163 GLY CA HA3 sing N N 164 GLY C O doub N N 165 GLY C OXT sing N N 166 GLY OXT HXT sing N N 167 HIS N CA sing N N 168 HIS N H sing N N 169 HIS N H2 sing N N 170 HIS CA C sing N N 171 HIS CA CB sing N N 172 HIS CA HA sing N N 173 HIS C O doub N N 174 HIS C OXT sing N N 175 HIS CB CG sing N N 176 HIS CB HB2 sing N N 177 HIS CB HB3 sing N N 178 HIS CG ND1 sing Y N 179 HIS CG CD2 doub Y N 180 HIS ND1 CE1 doub Y N 181 HIS ND1 HD1 sing N N 182 HIS CD2 NE2 sing Y N 183 HIS CD2 HD2 sing N N 184 HIS CE1 NE2 sing Y N 185 HIS CE1 HE1 sing N N 186 HIS NE2 HE2 sing N N 187 HIS OXT HXT sing N N 188 HOH O H1 sing N N 189 HOH O H2 sing N N 190 ILE N CA sing N N 191 ILE N H sing N N 192 ILE N H2 sing N N 193 ILE CA C sing N N 194 ILE CA CB sing N N 195 ILE CA HA sing N N 196 ILE C O doub N N 197 ILE C OXT sing N N 198 ILE CB CG1 sing N N 199 ILE CB CG2 sing N N 200 ILE CB HB sing N N 201 ILE CG1 CD1 sing N N 202 ILE CG1 HG12 sing N N 203 ILE CG1 HG13 sing N N 204 ILE CG2 HG21 sing N N 205 ILE CG2 HG22 sing N N 206 ILE CG2 HG23 sing N N 207 ILE CD1 HD11 sing N N 208 ILE CD1 HD12 sing N N 209 ILE CD1 HD13 sing N N 210 ILE OXT HXT sing N N 211 LEU N CA sing N N 212 LEU N H sing N N 213 LEU N H2 sing N N 214 LEU CA C sing N N 215 LEU CA CB sing N N 216 LEU CA HA sing N N 217 LEU C O doub N N 218 LEU C OXT sing N N 219 LEU CB CG sing N N 220 LEU CB HB2 sing N N 221 LEU CB HB3 sing N N 222 LEU CG CD1 sing N N 223 LEU CG CD2 sing N N 224 LEU CG HG sing N N 225 LEU CD1 HD11 sing N N 226 LEU CD1 HD12 sing N N 227 LEU CD1 HD13 sing N N 228 LEU CD2 HD21 sing N N 229 LEU CD2 HD22 sing N N 230 LEU CD2 HD23 sing N N 231 LEU OXT HXT sing N N 232 LYS N CA sing N N 233 LYS N H sing N N 234 LYS N H2 sing N N 235 LYS CA C sing N N 236 LYS CA CB sing N N 237 LYS CA HA sing N N 238 LYS C O doub N N 239 LYS C OXT sing N N 240 LYS CB CG sing N N 241 LYS CB HB2 sing N N 242 LYS CB HB3 sing N N 243 LYS CG CD sing N N 244 LYS CG HG2 sing N N 245 LYS CG HG3 sing N N 246 LYS CD CE sing N N 247 LYS CD HD2 sing N N 248 LYS CD HD3 sing N N 249 LYS CE NZ sing N N 250 LYS CE HE2 sing N N 251 LYS CE HE3 sing N N 252 LYS NZ HZ1 sing N N 253 LYS NZ HZ2 sing N N 254 LYS NZ HZ3 sing N N 255 LYS OXT HXT sing N N 256 MET N CA sing N N 257 MET N H sing N N 258 MET N H2 sing N N 259 MET CA C sing N N 260 MET CA CB sing N N 261 MET CA HA sing N N 262 MET C O doub N N 263 MET C OXT sing N N 264 MET CB CG sing N N 265 MET CB HB2 sing N N 266 MET CB HB3 sing N N 267 MET CG SD sing N N 268 MET CG HG2 sing N N 269 MET CG HG3 sing N N 270 MET SD CE sing N N 271 MET CE HE1 sing N N 272 MET CE HE2 sing N N 273 MET CE HE3 sing N N 274 MET OXT HXT sing N N 275 PHE N CA sing N N 276 PHE N H sing N N 277 PHE N H2 sing N N 278 PHE CA C sing N N 279 PHE CA CB sing N N 280 PHE CA HA sing N N 281 PHE C O doub N N 282 PHE C OXT sing N N 283 PHE CB CG sing N N 284 PHE CB HB2 sing N N 285 PHE CB HB3 sing N N 286 PHE CG CD1 doub Y N 287 PHE CG CD2 sing Y N 288 PHE CD1 CE1 sing Y N 289 PHE CD1 HD1 sing N N 290 PHE CD2 CE2 doub Y N 291 PHE CD2 HD2 sing N N 292 PHE CE1 CZ doub Y N 293 PHE CE1 HE1 sing N N 294 PHE CE2 CZ sing Y N 295 PHE CE2 HE2 sing N N 296 PHE CZ HZ sing N N 297 PHE OXT HXT sing N N 298 PRO N CA sing N N 299 PRO N CD sing N N 300 PRO N H sing N N 301 PRO CA C sing N N 302 PRO CA CB sing N N 303 PRO CA HA sing N N 304 PRO C O doub N N 305 PRO C OXT sing N N 306 PRO CB CG sing N N 307 PRO CB HB2 sing N N 308 PRO CB HB3 sing N N 309 PRO CG CD sing N N 310 PRO CG HG2 sing N N 311 PRO CG HG3 sing N N 312 PRO CD HD2 sing N N 313 PRO CD HD3 sing N N 314 PRO OXT HXT sing N N 315 SER N CA sing N N 316 SER N H sing N N 317 SER N H2 sing N N 318 SER CA C sing N N 319 SER CA CB sing N N 320 SER CA HA sing N N 321 SER C O doub N N 322 SER C OXT sing N N 323 SER CB OG sing N N 324 SER CB HB2 sing N N 325 SER CB HB3 sing N N 326 SER OG HG sing N N 327 SER OXT HXT sing N N 328 THR N CA sing N N 329 THR N H sing N N 330 THR N H2 sing N N 331 THR CA C sing N N 332 THR CA CB sing N N 333 THR CA HA sing N N 334 THR C O doub N N 335 THR C OXT sing N N 336 THR CB OG1 sing N N 337 THR CB CG2 sing N N 338 THR CB HB sing N N 339 THR OG1 HG1 sing N N 340 THR CG2 HG21 sing N N 341 THR CG2 HG22 sing N N 342 THR CG2 HG23 sing N N 343 THR OXT HXT sing N N 344 TRP N CA sing N N 345 TRP N H sing N N 346 TRP N H2 sing N N 347 TRP CA C sing N N 348 TRP CA CB sing N N 349 TRP CA HA sing N N 350 TRP C O doub N N 351 TRP C OXT sing N N 352 TRP CB CG sing N N 353 TRP CB HB2 sing N N 354 TRP CB HB3 sing N N 355 TRP CG CD1 doub Y N 356 TRP CG CD2 sing Y N 357 TRP CD1 NE1 sing Y N 358 TRP CD1 HD1 sing N N 359 TRP CD2 CE2 doub Y N 360 TRP CD2 CE3 sing Y N 361 TRP NE1 CE2 sing Y N 362 TRP NE1 HE1 sing N N 363 TRP CE2 CZ2 sing Y N 364 TRP CE3 CZ3 doub Y N 365 TRP CE3 HE3 sing N N 366 TRP CZ2 CH2 doub Y N 367 TRP CZ2 HZ2 sing N N 368 TRP CZ3 CH2 sing Y N 369 TRP CZ3 HZ3 sing N N 370 TRP CH2 HH2 sing N N 371 TRP OXT HXT sing N N 372 TYR N CA sing N N 373 TYR N H sing N N 374 TYR N H2 sing N N 375 TYR CA C sing N N 376 TYR CA CB sing N N 377 TYR CA HA sing N N 378 TYR C O doub N N 379 TYR C OXT sing N N 380 TYR CB CG sing N N 381 TYR CB HB2 sing N N 382 TYR CB HB3 sing N N 383 TYR CG CD1 doub Y N 384 TYR CG CD2 sing Y N 385 TYR CD1 CE1 sing Y N 386 TYR CD1 HD1 sing N N 387 TYR CD2 CE2 doub Y N 388 TYR CD2 HD2 sing N N 389 TYR CE1 CZ doub Y N 390 TYR CE1 HE1 sing N N 391 TYR CE2 CZ sing Y N 392 TYR CE2 HE2 sing N N 393 TYR CZ OH sing N N 394 TYR OH HH sing N N 395 TYR OXT HXT sing N N 396 VAL N CA sing N N 397 VAL N H sing N N 398 VAL N H2 sing N N 399 VAL CA C sing N N 400 VAL CA CB sing N N 401 VAL CA HA sing N N 402 VAL C O doub N N 403 VAL C OXT sing N N 404 VAL CB CG1 sing N N 405 VAL CB CG2 sing N N 406 VAL CB HB sing N N 407 VAL CG1 HG11 sing N N 408 VAL CG1 HG12 sing N N 409 VAL CG1 HG13 sing N N 410 VAL CG2 HG21 sing N N 411 VAL CG2 HG22 sing N N 412 VAL CG2 HG23 sing N N 413 VAL OXT HXT sing N N 414 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 'FORMIC ACID' FMT 4 '6-methyl-5-[(4-propan-2-ylphenyl)amino]-2~{H}-1,2,4-triazin-3-one' 6T5 5 'UNKNOWN ATOM OR ION' UNX 6 'SODIUM ION' NA 7 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3C5K _pdbx_initial_refinement_model.details 'pdbid 3C5K' #