data_5L7M # _entry.id 5L7M # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5L7M pdb_00005l7m 10.2210/pdb5l7m/pdb WWPDB D_1200000243 ? ? BMRB 34005 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.db_id 34005 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5L7M _pdbx_database_status.recvd_initial_deposition_date 2016-06-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Monneau, Y.R.' 1 'Lortat-Jacob, H.' 2 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Open Biol' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2046-2441 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 7 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Solution structure of CXCL13 and heparan sulfate binding show that GAG binding site and cellular signalling rely on distinct domains. ; _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1098/rsob.170133 _citation.pdbx_database_id_PubMed 29070611 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Monneau, Y.R.' 1 ? primary 'Luo, L.' 2 ? primary 'Sankaranarayanan, N.V.' 3 ? primary 'Nagarajan, B.' 4 ? primary 'Vives, R.R.' 5 ? primary 'Baleux, F.' 6 ? primary 'Desai, U.R.' 7 ? primary 'Arenzana-Seidedos, F.' 8 ? primary 'Lortat-Jacob, H.' 9 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'C-X-C motif chemokine 13' _entity.formula_weight 9807.674 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'B lymphocyte chemoattractant,CXC chemokine BLC,Small-inducible cytokine B13' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ILEAHYTNLKCRCSGVISTVVGLNIIDRIQVTPPGNGCPKTEVVIWTKMKKVICVNPRAKWLQRLLRHVQSKSLSSTPQA PVSKRRAA ; _entity_poly.pdbx_seq_one_letter_code_can ;ILEAHYTNLKCRCSGVISTVVGLNIIDRIQVTPPGNGCPKTEVVIWTKMKKVICVNPRAKWLQRLLRHVQSKSLSSTPQA PVSKRRAA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ILE n 1 2 LEU n 1 3 GLU n 1 4 ALA n 1 5 HIS n 1 6 TYR n 1 7 THR n 1 8 ASN n 1 9 LEU n 1 10 LYS n 1 11 CYS n 1 12 ARG n 1 13 CYS n 1 14 SER n 1 15 GLY n 1 16 VAL n 1 17 ILE n 1 18 SER n 1 19 THR n 1 20 VAL n 1 21 VAL n 1 22 GLY n 1 23 LEU n 1 24 ASN n 1 25 ILE n 1 26 ILE n 1 27 ASP n 1 28 ARG n 1 29 ILE n 1 30 GLN n 1 31 VAL n 1 32 THR n 1 33 PRO n 1 34 PRO n 1 35 GLY n 1 36 ASN n 1 37 GLY n 1 38 CYS n 1 39 PRO n 1 40 LYS n 1 41 THR n 1 42 GLU n 1 43 VAL n 1 44 VAL n 1 45 ILE n 1 46 TRP n 1 47 THR n 1 48 LYS n 1 49 MET n 1 50 LYS n 1 51 LYS n 1 52 VAL n 1 53 ILE n 1 54 CYS n 1 55 VAL n 1 56 ASN n 1 57 PRO n 1 58 ARG n 1 59 ALA n 1 60 LYS n 1 61 TRP n 1 62 LEU n 1 63 GLN n 1 64 ARG n 1 65 LEU n 1 66 LEU n 1 67 ARG n 1 68 HIS n 1 69 VAL n 1 70 GLN n 1 71 SER n 1 72 LYS n 1 73 SER n 1 74 LEU n 1 75 SER n 1 76 SER n 1 77 THR n 1 78 PRO n 1 79 GLN n 1 80 ALA n 1 81 PRO n 1 82 VAL n 1 83 SER n 1 84 LYS n 1 85 ARG n 1 86 ARG n 1 87 ALA n 1 88 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 88 _entity_src_gen.gene_src_common_name Mouse _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Cxcl13, Blc, Scyb13' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant 'Codon Plus' _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CXL13_MOUSE _struct_ref.pdbx_db_accession O55038 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ILEAHYTNLKCRCSGVISTVVGLNIIDRIQVTPPGNGCPKTEVVIWTKMKKVICVNPRAKWLQRLLRHVQSKSLSSTPQA PVSKRRAA ; _struct_ref.pdbx_align_begin 22 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5L7M _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 88 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O55038 _struct_ref_seq.db_align_beg 22 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 109 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 88 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 14 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 2 '3D HNCA' 1 isotropic 13 1 2 '3D HNCACB' 1 isotropic 4 1 2 '2D 1H-13C HSQC aliphatic' 1 isotropic 5 1 2 '2D 1H-13C HSQC aromatic' 1 isotropic 6 1 2 '3D HCCH-TOCSY' 1 isotropic 7 1 2 '3D HCCH-TOCSY' 1 isotropic 8 1 1 '3D 1H-15N TOCSY-HSQC' 2 isotropic 9 1 1 '3D 1H-15N NOESY-HSQC' 2 isotropic 10 1 2 '2D (HB)CB(CG)(CD)HD' 1 isotropic 11 1 2 '3D 1H-13C NOESY-HMQC' 1 isotropic 12 1 3 '3D 1H-15N NOESY-HSQC' 3 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120 _pdbx_nmr_exptl_sample_conditions.details ;20 mM KP 100 mM NaCl ; _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label all _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '850 uM [U-15N] CXCL13, 90% H2O/10% D2O' '90% H2O/10% D2O' dN-CXCL13-N solution ? 2 '560 uM U-[15N,13C] CXCL13, 90% H2O/10% D2O' '90% H2O/10% D2O' dN-CXCL13-CN solution ? 3 '250 uM [U-15N] CXCL13, 90% H2O/10% D2O' '90% H2O/10% D2O' CXC13-N solution ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III' ? Bruker 700 ? 2 'AVANCE III' ? Bruker 600 ? 3 'AVANCE III' ? Bruker 850 ? # _pdbx_nmr_refine.entry_id 5L7M _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'in presence of water' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 5L7M _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 5L7M _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CNS ? 'Brunger, Adams, Clore, Gros, Nilges and Read' 2 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 3 'chemical shift assignment' Sparky ? Goddard # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5L7M _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 5L7M _struct.title 'Murin CXCL13 solution structure' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5L7M _struct_keywords.text 'Chemokine structure, N-terminal domain, Signaling protein, GAG binding' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id LEU _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 62 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id VAL _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 69 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id LEU _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 62 _struct_conf.end_auth_comp_id VAL _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 69 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 11 SG ? ? ? 1_555 A CYS 38 SG ? ? A CYS 11 A CYS 38 1_555 ? ? ? ? ? ? ? 2.022 ? ? disulf2 disulf ? ? A CYS 13 SG ? ? ? 1_555 A CYS 54 SG ? ? A CYS 13 A CYS 54 1_555 ? ? ? ? ? ? ? 2.024 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 26 ? THR A 32 ? ILE A 26 THR A 32 AA1 2 GLU A 42 ? THR A 47 ? GLU A 42 THR A 47 AA1 3 VAL A 52 ? VAL A 55 ? VAL A 52 VAL A 55 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLN A 30 ? N GLN A 30 O VAL A 44 ? O VAL A 44 AA1 2 3 N VAL A 43 ? N VAL A 43 O VAL A 55 ? O VAL A 55 # _atom_sites.entry_id 5L7M _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ILE 1 1 1 ILE ILE A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 HIS 5 5 5 HIS HIS A . n A 1 6 TYR 6 6 6 TYR TYR A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 CYS 13 13 13 CYS CYS A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 TRP 46 46 46 TRP TRP A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 MET 49 49 49 MET MET A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 CYS 54 54 54 CYS CYS A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 TRP 61 61 61 TRP TRP A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 HIS 68 68 68 HIS HIS A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 THR 77 77 77 THR THR A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 ALA 88 88 88 ALA ALA A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 8230 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-06-21 2 'Structure model' 1 1 2017-08-30 3 'Structure model' 1 2 2017-12-06 4 'Structure model' 1 3 2019-05-08 5 'Structure model' 1 4 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' 6 5 'Structure model' 'Experimental preparation' 7 5 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_audit_support 2 3 'Structure model' citation 3 3 'Structure model' citation_author 4 4 'Structure model' pdbx_nmr_software 5 5 'Structure model' database_2 6 5 'Structure model' pdbx_database_status 7 5 'Structure model' pdbx_nmr_sample_details 8 5 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_audit_support.funding_organization' 2 3 'Structure model' '_citation.country' 3 3 'Structure model' '_citation.journal_abbrev' 4 3 'Structure model' '_citation.journal_id_CSD' 5 3 'Structure model' '_citation.journal_id_ISSN' 6 3 'Structure model' '_citation.journal_volume' 7 3 'Structure model' '_citation.pdbx_database_id_DOI' 8 3 'Structure model' '_citation.pdbx_database_id_PubMed' 9 3 'Structure model' '_citation.title' 10 3 'Structure model' '_citation.year' 11 4 'Structure model' '_pdbx_nmr_software.name' 12 5 'Structure model' '_database_2.pdbx_DOI' 13 5 'Structure model' '_database_2.pdbx_database_accession' 14 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' 15 5 'Structure model' '_pdbx_nmr_sample_details.contents' 16 5 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 CXCL13 850 ? uM '[U-15N]' 2 CXCL13 560 ? uM 'U-[15N,13C]' 3 CXCL13 250 ? uM '[U-15N]' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 4 ? ? -54.63 99.35 2 1 PRO A 81 ? ? -54.85 103.51 3 1 VAL A 82 ? ? -67.70 85.40 4 2 SER A 75 ? ? -148.11 -158.84 5 2 PRO A 81 ? ? -69.74 80.37 6 2 SER A 83 ? ? -62.48 97.96 7 3 SER A 73 ? ? -117.97 74.06 8 3 PRO A 78 ? ? -61.54 94.87 9 4 PRO A 34 ? ? -63.73 84.09 10 4 LEU A 74 ? ? -65.26 91.50 11 4 SER A 76 ? ? -79.00 -75.84 12 4 PRO A 78 ? ? -58.58 96.23 13 5 SER A 14 ? ? -82.81 -153.16 14 5 ASN A 36 ? ? -89.68 41.08 15 5 PRO A 81 ? ? -65.98 87.87 16 5 SER A 83 ? ? -68.82 91.74 17 6 PRO A 34 ? ? -57.82 99.39 18 6 PRO A 57 ? ? -61.88 0.19 19 6 VAL A 82 ? ? -56.99 109.22 20 7 ALA A 4 ? ? -144.18 30.50 21 7 TYR A 6 ? ? -64.83 92.33 22 7 SER A 71 ? ? -64.98 94.22 23 7 SER A 73 ? ? -69.67 82.82 24 7 SER A 75 ? ? -58.23 101.12 25 7 PRO A 78 ? ? -53.61 103.95 26 7 SER A 83 ? ? -65.23 90.99 27 8 LEU A 2 ? ? -166.34 11.05 28 8 LYS A 72 ? ? 78.98 -2.98 29 8 VAL A 82 ? ? -64.48 91.27 30 8 ARG A 85 ? ? -62.20 97.08 31 9 ALA A 87 ? ? -68.07 88.65 32 10 THR A 7 ? ? -63.92 93.03 33 10 ASN A 8 ? ? 59.80 83.15 34 10 LYS A 72 ? ? 69.48 67.62 35 10 LEU A 74 ? ? -63.33 80.54 36 10 PRO A 78 ? ? -61.13 89.90 37 10 PRO A 81 ? ? -68.54 94.07 38 11 LEU A 9 ? ? -64.91 98.43 39 11 LYS A 10 ? ? -110.07 -107.85 40 11 PRO A 39 ? ? -86.25 32.91 41 11 LEU A 74 ? ? -53.88 103.08 42 11 PRO A 78 ? ? -55.76 95.90 43 11 SER A 83 ? ? -99.55 30.84 44 11 ARG A 85 ? ? -172.25 140.79 45 12 THR A 7 ? ? -66.54 2.57 46 12 ASN A 8 ? ? -45.29 99.93 47 12 SER A 14 ? ? -87.34 31.29 48 12 LYS A 72 ? ? -90.00 -73.40 49 12 LEU A 74 ? ? -69.34 93.21 50 12 LYS A 84 ? ? -163.61 111.31 51 13 THR A 7 ? ? -69.28 86.60 52 13 VAL A 82 ? ? 40.45 82.03 53 14 ASN A 8 ? ? -90.87 42.81 54 14 SER A 73 ? ? -145.77 19.64 55 14 LEU A 74 ? ? 55.37 73.58 56 15 SER A 71 ? ? -127.36 -159.11 57 15 PRO A 78 ? ? -56.29 104.88 58 16 LYS A 10 ? ? 179.74 174.25 59 16 ASN A 36 ? ? -68.51 88.94 60 16 SER A 73 ? ? -69.14 76.10 61 16 SER A 75 ? ? -66.43 90.37 62 16 PRO A 78 ? ? -57.76 83.50 63 17 ALA A 4 ? ? -59.96 97.17 64 17 PRO A 34 ? ? -52.76 92.59 65 17 PRO A 39 ? ? -68.52 81.96 66 17 GLN A 70 ? ? -67.71 85.12 67 17 SER A 73 ? ? -68.14 85.66 68 17 SER A 75 ? ? -65.76 98.54 69 17 PRO A 81 ? ? -56.09 107.84 70 17 SER A 83 ? ? -166.89 84.26 71 18 ASN A 8 ? ? -94.74 -60.48 72 18 PRO A 34 ? ? -52.81 97.56 73 18 PRO A 78 ? ? -65.88 -171.12 74 18 ALA A 80 ? ? 72.03 134.86 75 18 VAL A 82 ? ? -48.76 107.88 76 19 SER A 14 ? ? -86.71 40.51 77 19 LEU A 74 ? ? -63.48 97.17 78 19 VAL A 82 ? ? -64.79 92.23 79 19 ARG A 86 ? ? -56.61 101.85 80 20 PRO A 34 ? ? -61.78 99.99 81 20 LEU A 74 ? ? -64.71 97.10 # _pdbx_audit_support.funding_organization 'French National Research Agency' _pdbx_audit_support.country France _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 #