data_5LB2 # _entry.id 5LB2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.385 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5LB2 pdb_00005lb2 10.2210/pdb5lb2/pdb WWPDB D_1200000346 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-10-19 2 'Structure model' 1 1 2016-11-30 3 'Structure model' 1 2 2024-02-07 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' chem_comp_atom 2 3 'Structure model' chem_comp_bond 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5LB2 _pdbx_database_status.recvd_initial_deposition_date 2016-06-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Marsh, M.' 1 'Fischer, G.' 2 'Moschetti, T.' 3 'Sharpe, T.' 4 'Scott, D.' 5 'Morgan, M.' 6 'Ng, H.' 7 'Skidmore, J.' 8 'Venkitaraman, A.' 9 'Abell, C.' 10 'Blundell, T.L.' 11 'Hyvonen, M.' 12 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Mol.Biol. _citation.journal_id_ASTM JMOBAK _citation.journal_id_CSD 0070 _citation.journal_id_ISSN 1089-8638 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 428 _citation.language ? _citation.page_first 4589 _citation.page_last 4607 _citation.title 'Engineering Archeal Surrogate Systems for the Development of Protein-Protein Interaction Inhibitors against Human RAD51.' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jmb.2016.10.009 _citation.pdbx_database_id_PubMed 27725183 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Moschetti, T.' 1 ? primary 'Sharpe, T.' 2 ? primary 'Fischer, G.' 3 ? primary 'Marsh, M.E.' 4 ? primary 'Ng, H.K.' 5 ? primary 'Morgan, M.' 6 ? primary 'Scott, D.E.' 7 ? primary 'Blundell, T.L.' 8 ? primary 'R Venkitaraman, A.' 9 ? primary 'Skidmore, J.' 10 ? primary 'Abell, C.' 11 ? primary 'Hyvonen, M.' 12 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'DNA repair and recombination protein RadA' 25302.002 1 ? ? ? ? 2 water nat water 18.015 41 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MATIGRISTGSKSLDKLLGGGIETQAITEVFGEFGSGKTQLAHTLAVMVQLPPEEGGLNGSVMWIDTENTFRPERIREIA QNRGLDPDEVLKHIAYARAFNSNHQMLLVQQASAMIKELLNTDRPVKLLIVDSLTSHFRSEYIGRGALAERQQKLAKHLA DLHRLANLYDIAVFVTNQVQAGGHILAHSATLRVYLRKGKGGKRIARLIDAPHLPEGEAVFSITEKGIED ; _entity_poly.pdbx_seq_one_letter_code_can ;MATIGRISTGSKSLDKLLGGGIETQAITEVFGEFGSGKTQLAHTLAVMVQLPPEEGGLNGSVMWIDTENTFRPERIREIA QNRGLDPDEVLKHIAYARAFNSNHQMLLVQQASAMIKELLNTDRPVKLLIVDSLTSHFRSEYIGRGALAERQQKLAKHLA DLHRLANLYDIAVFVTNQVQAGGHILAHSATLRVYLRKGKGGKRIARLIDAPHLPEGEAVFSITEKGIED ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 THR n 1 4 ILE n 1 5 GLY n 1 6 ARG n 1 7 ILE n 1 8 SER n 1 9 THR n 1 10 GLY n 1 11 SER n 1 12 LYS n 1 13 SER n 1 14 LEU n 1 15 ASP n 1 16 LYS n 1 17 LEU n 1 18 LEU n 1 19 GLY n 1 20 GLY n 1 21 GLY n 1 22 ILE n 1 23 GLU n 1 24 THR n 1 25 GLN n 1 26 ALA n 1 27 ILE n 1 28 THR n 1 29 GLU n 1 30 VAL n 1 31 PHE n 1 32 GLY n 1 33 GLU n 1 34 PHE n 1 35 GLY n 1 36 SER n 1 37 GLY n 1 38 LYS n 1 39 THR n 1 40 GLN n 1 41 LEU n 1 42 ALA n 1 43 HIS n 1 44 THR n 1 45 LEU n 1 46 ALA n 1 47 VAL n 1 48 MET n 1 49 VAL n 1 50 GLN n 1 51 LEU n 1 52 PRO n 1 53 PRO n 1 54 GLU n 1 55 GLU n 1 56 GLY n 1 57 GLY n 1 58 LEU n 1 59 ASN n 1 60 GLY n 1 61 SER n 1 62 VAL n 1 63 MET n 1 64 TRP n 1 65 ILE n 1 66 ASP n 1 67 THR n 1 68 GLU n 1 69 ASN n 1 70 THR n 1 71 PHE n 1 72 ARG n 1 73 PRO n 1 74 GLU n 1 75 ARG n 1 76 ILE n 1 77 ARG n 1 78 GLU n 1 79 ILE n 1 80 ALA n 1 81 GLN n 1 82 ASN n 1 83 ARG n 1 84 GLY n 1 85 LEU n 1 86 ASP n 1 87 PRO n 1 88 ASP n 1 89 GLU n 1 90 VAL n 1 91 LEU n 1 92 LYS n 1 93 HIS n 1 94 ILE n 1 95 ALA n 1 96 TYR n 1 97 ALA n 1 98 ARG n 1 99 ALA n 1 100 PHE n 1 101 ASN n 1 102 SER n 1 103 ASN n 1 104 HIS n 1 105 GLN n 1 106 MET n 1 107 LEU n 1 108 LEU n 1 109 VAL n 1 110 GLN n 1 111 GLN n 1 112 ALA n 1 113 SER n 1 114 ALA n 1 115 MET n 1 116 ILE n 1 117 LYS n 1 118 GLU n 1 119 LEU n 1 120 LEU n 1 121 ASN n 1 122 THR n 1 123 ASP n 1 124 ARG n 1 125 PRO n 1 126 VAL n 1 127 LYS n 1 128 LEU n 1 129 LEU n 1 130 ILE n 1 131 VAL n 1 132 ASP n 1 133 SER n 1 134 LEU n 1 135 THR n 1 136 SER n 1 137 HIS n 1 138 PHE n 1 139 ARG n 1 140 SER n 1 141 GLU n 1 142 TYR n 1 143 ILE n 1 144 GLY n 1 145 ARG n 1 146 GLY n 1 147 ALA n 1 148 LEU n 1 149 ALA n 1 150 GLU n 1 151 ARG n 1 152 GLN n 1 153 GLN n 1 154 LYS n 1 155 LEU n 1 156 ALA n 1 157 LYS n 1 158 HIS n 1 159 LEU n 1 160 ALA n 1 161 ASP n 1 162 LEU n 1 163 HIS n 1 164 ARG n 1 165 LEU n 1 166 ALA n 1 167 ASN n 1 168 LEU n 1 169 TYR n 1 170 ASP n 1 171 ILE n 1 172 ALA n 1 173 VAL n 1 174 PHE n 1 175 VAL n 1 176 THR n 1 177 ASN n 1 178 GLN n 1 179 VAL n 1 180 GLN n 1 181 ALA n 1 182 GLY n 1 183 GLY n 1 184 HIS n 1 185 ILE n 1 186 LEU n 1 187 ALA n 1 188 HIS n 1 189 SER n 1 190 ALA n 1 191 THR n 1 192 LEU n 1 193 ARG n 1 194 VAL n 1 195 TYR n 1 196 LEU n 1 197 ARG n 1 198 LYS n 1 199 GLY n 1 200 LYS n 1 201 GLY n 1 202 GLY n 1 203 LYS n 1 204 ARG n 1 205 ILE n 1 206 ALA n 1 207 ARG n 1 208 LEU n 1 209 ILE n 1 210 ASP n 1 211 ALA n 1 212 PRO n 1 213 HIS n 1 214 LEU n 1 215 PRO n 1 216 GLU n 1 217 GLY n 1 218 GLU n 1 219 ALA n 1 220 VAL n 1 221 PHE n 1 222 SER n 1 223 ILE n 1 224 THR n 1 225 GLU n 1 226 LYS n 1 227 GLY n 1 228 ILE n 1 229 GLU n 1 230 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 230 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'radA, PF1926' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 43587 / DSM 3638 / JCM 8422 / Vc1' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 186497 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pBAT4 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 107 ? ? ? A . n A 1 2 ALA 2 108 108 ALA ALA A . n A 1 3 THR 3 109 109 THR THR A . n A 1 4 ILE 4 110 110 ILE ILE A . n A 1 5 GLY 5 111 111 GLY GLY A . n A 1 6 ARG 6 112 112 ARG ARG A . n A 1 7 ILE 7 113 113 ILE ILE A . n A 1 8 SER 8 114 114 SER SER A . n A 1 9 THR 9 115 115 THR THR A . n A 1 10 GLY 10 116 116 GLY GLY A . n A 1 11 SER 11 117 117 SER SER A . n A 1 12 LYS 12 118 118 LYS LYS A . n A 1 13 SER 13 119 119 SER SER A . n A 1 14 LEU 14 120 120 LEU LEU A . n A 1 15 ASP 15 121 121 ASP ASP A . n A 1 16 LYS 16 122 122 LYS LYS A . n A 1 17 LEU 17 123 123 LEU LEU A . n A 1 18 LEU 18 124 124 LEU LEU A . n A 1 19 GLY 19 125 125 GLY GLY A . n A 1 20 GLY 20 126 126 GLY GLY A . n A 1 21 GLY 21 127 127 GLY GLY A . n A 1 22 ILE 22 128 128 ILE ILE A . n A 1 23 GLU 23 129 129 GLU GLU A . n A 1 24 THR 24 130 130 THR THR A . n A 1 25 GLN 25 131 131 GLN GLN A . n A 1 26 ALA 26 132 132 ALA ALA A . n A 1 27 ILE 27 133 133 ILE ILE A . n A 1 28 THR 28 134 134 THR THR A . n A 1 29 GLU 29 135 135 GLU GLU A . n A 1 30 VAL 30 136 136 VAL VAL A . n A 1 31 PHE 31 137 137 PHE PHE A . n A 1 32 GLY 32 138 138 GLY GLY A . n A 1 33 GLU 33 139 139 GLU GLU A . n A 1 34 PHE 34 140 140 PHE PHE A . n A 1 35 GLY 35 141 141 GLY GLY A . n A 1 36 SER 36 142 142 SER SER A . n A 1 37 GLY 37 143 143 GLY GLY A . n A 1 38 LYS 38 144 144 LYS LYS A . n A 1 39 THR 39 145 145 THR THR A . n A 1 40 GLN 40 146 146 GLN GLN A . n A 1 41 LEU 41 147 147 LEU LEU A . n A 1 42 ALA 42 148 148 ALA ALA A . n A 1 43 HIS 43 149 149 HIS HIS A . n A 1 44 THR 44 150 150 THR THR A . n A 1 45 LEU 45 151 151 LEU LEU A . n A 1 46 ALA 46 152 152 ALA ALA A . n A 1 47 VAL 47 153 153 VAL VAL A . n A 1 48 MET 48 154 154 MET MET A . n A 1 49 VAL 49 155 155 VAL VAL A . n A 1 50 GLN 50 156 156 GLN GLN A . n A 1 51 LEU 51 157 157 LEU LEU A . n A 1 52 PRO 52 158 158 PRO PRO A . n A 1 53 PRO 53 159 159 PRO PRO A . n A 1 54 GLU 54 160 160 GLU GLU A . n A 1 55 GLU 55 161 161 GLU GLU A . n A 1 56 GLY 56 162 162 GLY GLY A . n A 1 57 GLY 57 163 163 GLY GLY A . n A 1 58 LEU 58 164 164 LEU LEU A . n A 1 59 ASN 59 165 165 ASN ASN A . n A 1 60 GLY 60 166 166 GLY GLY A . n A 1 61 SER 61 167 167 SER SER A . n A 1 62 VAL 62 168 168 VAL VAL A . n A 1 63 MET 63 169 169 MET MET A . n A 1 64 TRP 64 170 170 TRP TRP A . n A 1 65 ILE 65 171 171 ILE ILE A . n A 1 66 ASP 66 172 172 ASP ASP A . n A 1 67 THR 67 173 173 THR THR A . n A 1 68 GLU 68 174 174 GLU GLU A . n A 1 69 ASN 69 175 175 ASN ASN A . n A 1 70 THR 70 176 176 THR THR A . n A 1 71 PHE 71 177 177 PHE PHE A . n A 1 72 ARG 72 178 178 ARG ARG A . n A 1 73 PRO 73 179 179 PRO PRO A . n A 1 74 GLU 74 180 180 GLU GLU A . n A 1 75 ARG 75 181 181 ARG ARG A . n A 1 76 ILE 76 182 182 ILE ILE A . n A 1 77 ARG 77 183 183 ARG ARG A . n A 1 78 GLU 78 184 184 GLU GLU A . n A 1 79 ILE 79 185 185 ILE ILE A . n A 1 80 ALA 80 186 186 ALA ALA A . n A 1 81 GLN 81 187 187 GLN GLN A . n A 1 82 ASN 82 188 188 ASN ASN A . n A 1 83 ARG 83 189 189 ARG ARG A . n A 1 84 GLY 84 190 190 GLY GLY A . n A 1 85 LEU 85 191 191 LEU LEU A . n A 1 86 ASP 86 192 192 ASP ASP A . n A 1 87 PRO 87 193 193 PRO PRO A . n A 1 88 ASP 88 194 194 ASP ASP A . n A 1 89 GLU 89 195 195 GLU GLU A . n A 1 90 VAL 90 196 196 VAL VAL A . n A 1 91 LEU 91 197 197 LEU LEU A . n A 1 92 LYS 92 198 198 LYS LYS A . n A 1 93 HIS 93 199 199 HIS HIS A . n A 1 94 ILE 94 200 200 ILE ILE A . n A 1 95 ALA 95 201 201 ALA ALA A . n A 1 96 TYR 96 202 202 TYR TYR A . n A 1 97 ALA 97 203 203 ALA ALA A . n A 1 98 ARG 98 204 204 ARG ARG A . n A 1 99 ALA 99 205 205 ALA ALA A . n A 1 100 PHE 100 206 206 PHE PHE A . n A 1 101 ASN 101 207 207 ASN ASN A . n A 1 102 SER 102 208 208 SER SER A . n A 1 103 ASN 103 209 209 ASN ASN A . n A 1 104 HIS 104 210 210 HIS HIS A . n A 1 105 GLN 105 211 211 GLN GLN A . n A 1 106 MET 106 212 212 MET MET A . n A 1 107 LEU 107 213 213 LEU LEU A . n A 1 108 LEU 108 214 214 LEU LEU A . n A 1 109 VAL 109 215 215 VAL VAL A . n A 1 110 GLN 110 216 216 GLN GLN A . n A 1 111 GLN 111 217 217 GLN GLN A . n A 1 112 ALA 112 218 218 ALA ALA A . n A 1 113 SER 113 219 219 SER SER A . n A 1 114 ALA 114 220 220 ALA ALA A . n A 1 115 MET 115 221 221 MET MET A . n A 1 116 ILE 116 222 222 ILE ILE A . n A 1 117 LYS 117 223 223 LYS LYS A . n A 1 118 GLU 118 224 224 GLU GLU A . n A 1 119 LEU 119 225 225 LEU LEU A . n A 1 120 LEU 120 226 226 LEU LEU A . n A 1 121 ASN 121 227 227 ASN ASN A . n A 1 122 THR 122 228 228 THR THR A . n A 1 123 ASP 123 229 229 ASP ASP A . n A 1 124 ARG 124 230 230 ARG ARG A . n A 1 125 PRO 125 231 231 PRO PRO A . n A 1 126 VAL 126 232 232 VAL VAL A . n A 1 127 LYS 127 233 233 LYS LYS A . n A 1 128 LEU 128 234 234 LEU LEU A . n A 1 129 LEU 129 235 235 LEU LEU A . n A 1 130 ILE 130 236 236 ILE ILE A . n A 1 131 VAL 131 237 237 VAL VAL A . n A 1 132 ASP 132 238 238 ASP ASP A . n A 1 133 SER 133 239 239 SER SER A . n A 1 134 LEU 134 240 240 LEU LEU A . n A 1 135 THR 135 241 241 THR THR A . n A 1 136 SER 136 242 242 SER SER A . n A 1 137 HIS 137 243 243 HIS HIS A . n A 1 138 PHE 138 244 244 PHE PHE A . n A 1 139 ARG 139 245 245 ARG ARG A . n A 1 140 SER 140 246 246 SER SER A . n A 1 141 GLU 141 247 247 GLU GLU A . n A 1 142 TYR 142 248 248 TYR TYR A . n A 1 143 ILE 143 249 249 ILE ILE A . n A 1 144 GLY 144 250 250 GLY GLY A . n A 1 145 ARG 145 251 251 ARG ARG A . n A 1 146 GLY 146 252 252 GLY GLY A . n A 1 147 ALA 147 253 253 ALA ALA A . n A 1 148 LEU 148 254 254 LEU LEU A . n A 1 149 ALA 149 255 255 ALA ALA A . n A 1 150 GLU 150 256 256 GLU GLU A . n A 1 151 ARG 151 257 257 ARG ARG A . n A 1 152 GLN 152 258 258 GLN GLN A . n A 1 153 GLN 153 259 259 GLN GLN A . n A 1 154 LYS 154 260 260 LYS LYS A . n A 1 155 LEU 155 261 261 LEU LEU A . n A 1 156 ALA 156 262 262 ALA ALA A . n A 1 157 LYS 157 263 263 LYS LYS A . n A 1 158 HIS 158 264 264 HIS HIS A . n A 1 159 LEU 159 265 265 LEU LEU A . n A 1 160 ALA 160 266 266 ALA ALA A . n A 1 161 ASP 161 267 267 ASP ASP A . n A 1 162 LEU 162 268 268 LEU LEU A . n A 1 163 HIS 163 269 269 HIS HIS A . n A 1 164 ARG 164 270 270 ARG ARG A . n A 1 165 LEU 165 271 271 LEU LEU A . n A 1 166 ALA 166 272 272 ALA ALA A . n A 1 167 ASN 167 273 273 ASN ASN A . n A 1 168 LEU 168 274 274 LEU LEU A . n A 1 169 TYR 169 275 275 TYR TYR A . n A 1 170 ASP 170 276 276 ASP ASP A . n A 1 171 ILE 171 277 277 ILE ILE A . n A 1 172 ALA 172 278 278 ALA ALA A . n A 1 173 VAL 173 279 279 VAL VAL A . n A 1 174 PHE 174 280 280 PHE PHE A . n A 1 175 VAL 175 281 281 VAL VAL A . n A 1 176 THR 176 282 282 THR THR A . n A 1 177 ASN 177 283 283 ASN ASN A . n A 1 178 GLN 178 284 284 GLN GLN A . n A 1 179 VAL 179 285 285 VAL VAL A . n A 1 180 GLN 180 299 ? ? ? A . n A 1 181 ALA 181 300 ? ? ? A . n A 1 182 GLY 182 301 ? ? ? A . n A 1 183 GLY 183 302 ? ? ? A . n A 1 184 HIS 184 303 ? ? ? A . n A 1 185 ILE 185 304 ? ? ? A . n A 1 186 LEU 186 305 ? ? ? A . n A 1 187 ALA 187 306 ? ? ? A . n A 1 188 HIS 188 307 307 HIS HIS A . n A 1 189 SER 189 308 308 SER SER A . n A 1 190 ALA 190 309 309 ALA ALA A . n A 1 191 THR 191 310 310 THR THR A . n A 1 192 LEU 192 311 311 LEU LEU A . n A 1 193 ARG 193 312 312 ARG ARG A . n A 1 194 VAL 194 313 313 VAL VAL A . n A 1 195 TYR 195 314 314 TYR TYR A . n A 1 196 LEU 196 315 315 LEU LEU A . n A 1 197 ARG 197 316 316 ARG ARG A . n A 1 198 LYS 198 317 317 LYS LYS A . n A 1 199 GLY 199 318 318 GLY GLY A . n A 1 200 LYS 200 319 319 LYS LYS A . n A 1 201 GLY 201 320 320 GLY GLY A . n A 1 202 GLY 202 321 321 GLY GLY A . n A 1 203 LYS 203 322 322 LYS LYS A . n A 1 204 ARG 204 323 323 ARG ARG A . n A 1 205 ILE 205 324 324 ILE ILE A . n A 1 206 ALA 206 325 325 ALA ALA A . n A 1 207 ARG 207 326 326 ARG ARG A . n A 1 208 LEU 208 327 327 LEU LEU A . n A 1 209 ILE 209 328 328 ILE ILE A . n A 1 210 ASP 210 329 329 ASP ASP A . n A 1 211 ALA 211 330 330 ALA ALA A . n A 1 212 PRO 212 331 331 PRO PRO A . n A 1 213 HIS 213 332 332 HIS HIS A . n A 1 214 LEU 214 333 333 LEU LEU A . n A 1 215 PRO 215 334 334 PRO PRO A . n A 1 216 GLU 216 335 335 GLU GLU A . n A 1 217 GLY 217 336 336 GLY GLY A . n A 1 218 GLU 218 337 337 GLU GLU A . n A 1 219 ALA 219 338 338 ALA ALA A . n A 1 220 VAL 220 339 339 VAL VAL A . n A 1 221 PHE 221 340 340 PHE PHE A . n A 1 222 SER 222 341 341 SER SER A . n A 1 223 ILE 223 342 342 ILE ILE A . n A 1 224 THR 224 343 343 THR THR A . n A 1 225 GLU 225 344 344 GLU GLU A . n A 1 226 LYS 226 345 345 LYS LYS A . n A 1 227 GLY 227 346 346 GLY GLY A . n A 1 228 ILE 228 347 347 ILE ILE A . n A 1 229 GLU 229 348 348 GLU GLU A . n A 1 230 ASP 230 349 349 ASP ASP A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 401 30 HOH HOH A . B 2 HOH 2 402 6 HOH HOH A . B 2 HOH 3 403 45 HOH HOH A . B 2 HOH 4 404 41 HOH HOH A . B 2 HOH 5 405 12 HOH HOH A . B 2 HOH 6 406 25 HOH HOH A . B 2 HOH 7 407 13 HOH HOH A . B 2 HOH 8 408 47 HOH HOH A . B 2 HOH 9 409 7 HOH HOH A . B 2 HOH 10 410 38 HOH HOH A . B 2 HOH 11 411 39 HOH HOH A . B 2 HOH 12 412 5 HOH HOH A . B 2 HOH 13 413 2 HOH HOH A . B 2 HOH 14 414 50 HOH HOH A . B 2 HOH 15 415 23 HOH HOH A . B 2 HOH 16 416 49 HOH HOH A . B 2 HOH 17 417 4 HOH HOH A . B 2 HOH 18 418 40 HOH HOH A . B 2 HOH 19 419 9 HOH HOH A . B 2 HOH 20 420 18 HOH HOH A . B 2 HOH 21 421 1 HOH HOH A . B 2 HOH 22 422 42 HOH HOH A . B 2 HOH 23 423 11 HOH HOH A . B 2 HOH 24 424 51 HOH HOH A . B 2 HOH 25 425 43 HOH HOH A . B 2 HOH 26 426 16 HOH HOH A . B 2 HOH 27 427 21 HOH HOH A . B 2 HOH 28 428 19 HOH HOH A . B 2 HOH 29 429 3 HOH HOH A . B 2 HOH 30 430 37 HOH HOH A . B 2 HOH 31 431 10 HOH HOH A . B 2 HOH 32 432 48 HOH HOH A . B 2 HOH 33 433 46 HOH HOH A . B 2 HOH 34 434 27 HOH HOH A . B 2 HOH 35 435 32 HOH HOH A . B 2 HOH 36 436 35 HOH HOH A . B 2 HOH 37 437 36 HOH HOH A . B 2 HOH 38 438 31 HOH HOH A . B 2 HOH 39 439 22 HOH HOH A . B 2 HOH 40 440 33 HOH HOH A . B 2 HOH 41 441 44 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.10.2 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? AMoRE ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5LB2 _cell.details ? _cell.formula_units_Z ? _cell.length_a 90.040 _cell.length_a_esd ? _cell.length_b 90.040 _cell.length_b_esd ? _cell.length_c 67.860 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5LB2 _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5LB2 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.12 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 60.63 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 292 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '25% PEG6000, 100 mM MES pH 7.0' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2008-08-10 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9796 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I02' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9796 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I02 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate 44.36 _reflns.entry_id 5LB2 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.10 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 18731 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.9 _reflns.pdbx_Rmerge_I_obs 0.056 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.051 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 29.46 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.10 _reflns_shell.d_res_low 2.23 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 4.20 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 99.4 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.394 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 10.9 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -1.1016 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] -1.1016 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 2.2032 _refine.B_iso_max ? _refine.B_iso_mean 50.05 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.9409 _refine.correlation_coeff_Fo_to_Fc_free 0.9262 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5LB2 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.10 _refine.ls_d_res_low 45.02 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 18731 _refine.ls_number_reflns_R_free 964 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.12 _refine.ls_percent_reflns_R_free 5.15 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2232 _refine.ls_R_factor_R_free 0.2524 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2217 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4A6P _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.163 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.160 _refine.pdbx_overall_SU_R_Blow_DPI 0.178 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI 0.181 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 5LB2 _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.326 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 1718 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 41 _refine_hist.number_atoms_total 1759 _refine_hist.d_res_high 2.10 _refine_hist.d_res_low 45.02 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 ? 1744 ? t_bond_d 2.00 HARMONIC 'X-RAY DIFFRACTION' ? 1.11 ? 2352 ? t_angle_deg 2.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 630 ? t_dihedral_angle_d 2.00 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? ? ? t_incorr_chiral_ct ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_pseud_angle ? ? 'X-RAY DIFFRACTION' ? ? ? 45 ? t_trig_c_planes 2.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 254 ? t_gen_planes 5.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 1744 ? t_it 20.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_nbd ? ? 'X-RAY DIFFRACTION' ? 3.08 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 19.91 ? ? ? t_other_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_improper_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 231 ? t_chiral_improper_torsion 5.00 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_sum_occupancies ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_distance ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 1964 ? t_ideal_dist_contact 4.00 SEMIHARMONIC # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.10 _refine_ls_shell.d_res_low 2.23 _refine_ls_shell.number_reflns_all 2876 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 156 _refine_ls_shell.number_reflns_R_work 2720 _refine_ls_shell.percent_reflns_obs 95.77 _refine_ls_shell.percent_reflns_R_free 5.42 _refine_ls_shell.R_factor_all 0.2663 _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2761 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.2657 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 9 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5LB2 _struct.title 'Apo-structure of humanised RadA-mutant humRadA2' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5LB2 _struct_keywords.text 'DNA repair, fragment based drug design, humanisation, hydrolase' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RADA_PYRFU _struct_ref.pdbx_db_accession O74036 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ATIGRISTGSKSLDKLLGGGIETQAITEVFGEFGSGKTQLAHTLAVMVQLPPEEGGLNGSVIWIDTENTFRPERIREIAQ NRGLDPDEVLKHIYVARAFNSNHQMLLVQQAEDKIKELLNTDRPVKLLIVDSLTSHFRSEYIGRGALAERQQKLAKHLAD LHRLANLYDIAVFVTNQVQARPDAFFGDPTRPIGGHILAHSATLRVYLRKGKGGKRIARLIDAPHLPEGEAVFSITEKGI ED ; _struct_ref.pdbx_align_begin 108 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5LB2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 230 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O74036 _struct_ref_seq.db_align_beg 108 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 349 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 108 _struct_ref_seq.pdbx_auth_seq_align_end 349 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5LB2 MET A 1 ? UNP O74036 ? ? 'initiating methionine' 107 1 1 5LB2 MET A 63 ? UNP O74036 ILE 169 'engineered mutation' 169 2 1 5LB2 ALA A 95 ? UNP O74036 TYR 201 'engineered mutation' 201 3 1 5LB2 TYR A 96 ? UNP O74036 VAL 202 'engineered mutation' 202 4 1 5LB2 SER A 113 ? UNP O74036 GLU 219 'engineered mutation' 219 5 1 5LB2 ALA A 114 ? UNP O74036 ASP 220 'engineered mutation' 220 6 1 5LB2 MET A 115 ? UNP O74036 LYS 221 'engineered mutation' 221 7 1 5LB2 ? A ? ? UNP O74036 ARG 288 deletion ? 8 1 5LB2 ? A ? ? UNP O74036 PRO 289 deletion ? 9 1 5LB2 ? A ? ? UNP O74036 ASP 290 deletion ? 10 1 5LB2 ? A ? ? UNP O74036 ALA 291 deletion ? 11 1 5LB2 ? A ? ? UNP O74036 PHE 292 deletion ? 12 1 5LB2 ? A ? ? UNP O74036 PHE 293 deletion ? 13 1 5LB2 ? A ? ? UNP O74036 GLY 294 deletion ? 14 1 5LB2 ? A ? ? UNP O74036 ASP 295 deletion ? 15 1 5LB2 ? A ? ? UNP O74036 PRO 296 deletion ? 16 1 5LB2 ? A ? ? UNP O74036 THR 297 deletion ? 17 1 5LB2 ? A ? ? UNP O74036 ARG 298 deletion ? 18 1 5LB2 ? A ? ? UNP O74036 PRO 299 deletion ? 19 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 10510 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 11 ? LEU A 18 ? SER A 117 LEU A 124 1 ? 8 HELX_P HELX_P2 AA2 GLY A 37 ? VAL A 49 ? GLY A 143 VAL A 155 1 ? 13 HELX_P HELX_P3 AA3 GLN A 50 ? LEU A 51 ? GLN A 156 LEU A 157 5 ? 2 HELX_P HELX_P4 AA4 PRO A 52 ? GLY A 56 ? PRO A 158 GLY A 162 5 ? 5 HELX_P HELX_P5 AA5 ARG A 72 ? ARG A 83 ? ARG A 178 ARG A 189 1 ? 12 HELX_P HELX_P6 AA6 ASP A 86 ? HIS A 93 ? ASP A 192 HIS A 199 1 ? 8 HELX_P HELX_P7 AA7 ASN A 101 ? LEU A 120 ? ASN A 207 LEU A 226 1 ? 20 HELX_P HELX_P8 AA8 THR A 135 ? TYR A 142 ? THR A 241 TYR A 248 1 ? 8 HELX_P HELX_P9 AA9 GLY A 146 ? TYR A 169 ? GLY A 252 TYR A 275 1 ? 24 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ASP _struct_mon_prot_cis.label_seq_id 132 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ASP _struct_mon_prot_cis.auth_seq_id 238 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 SER _struct_mon_prot_cis.pdbx_label_seq_id_2 133 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 SER _struct_mon_prot_cis.pdbx_auth_seq_id_2 239 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -2.30 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 9 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? parallel AA2 3 4 ? parallel AA2 4 5 ? parallel AA2 5 6 ? parallel AA2 6 7 ? anti-parallel AA2 7 8 ? anti-parallel AA2 8 9 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 6 ? ILE A 7 ? ARG A 112 ILE A 113 AA1 2 ILE A 22 ? GLU A 23 ? ILE A 128 GLU A 129 AA2 1 ILE A 94 ? ARG A 98 ? ILE A 200 ARG A 204 AA2 2 SER A 61 ? ASP A 66 ? SER A 167 ASP A 172 AA2 3 VAL A 126 ? ASP A 132 ? VAL A 232 ASP A 238 AA2 4 ALA A 172 ? GLN A 178 ? ALA A 278 GLN A 284 AA2 5 ALA A 26 ? GLY A 32 ? ALA A 132 GLY A 138 AA2 6 LEU A 192 ? LYS A 198 ? LEU A 311 LYS A 317 AA2 7 LYS A 203 ? ASP A 210 ? LYS A 322 ASP A 329 AA2 8 GLY A 217 ? THR A 224 ? GLY A 336 THR A 343 AA2 9 GLY A 227 ? GLU A 229 ? GLY A 346 GLU A 348 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 7 ? N ILE A 113 O ILE A 22 ? O ILE A 128 AA2 1 2 O ALA A 95 ? O ALA A 201 N VAL A 62 ? N VAL A 168 AA2 2 3 N ILE A 65 ? N ILE A 171 O ILE A 130 ? O ILE A 236 AA2 3 4 N LYS A 127 ? N LYS A 233 O ALA A 172 ? O ALA A 278 AA2 4 5 O VAL A 173 ? O VAL A 279 N THR A 28 ? N THR A 134 AA2 5 6 N GLU A 29 ? N GLU A 135 O LEU A 192 ? O LEU A 311 AA2 6 7 N TYR A 195 ? N TYR A 314 O ARG A 207 ? O ARG A 326 AA2 7 8 N ALA A 206 ? N ALA A 325 O ALA A 219 ? O ALA A 338 AA2 8 9 N SER A 222 ? N SER A 341 O GLU A 229 ? O GLU A 348 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 435 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id B _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 107 ? A MET 1 2 1 Y 1 A GLN 299 ? A GLN 180 3 1 Y 1 A ALA 300 ? A ALA 181 4 1 Y 1 A GLY 301 ? A GLY 182 5 1 Y 1 A GLY 302 ? A GLY 183 6 1 Y 1 A HIS 303 ? A HIS 184 7 1 Y 1 A ILE 304 ? A ILE 185 8 1 Y 1 A LEU 305 ? A LEU 186 9 1 Y 1 A ALA 306 ? A ALA 187 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 PHE N N N N 236 PHE CA C N S 237 PHE C C N N 238 PHE O O N N 239 PHE CB C N N 240 PHE CG C Y N 241 PHE CD1 C Y N 242 PHE CD2 C Y N 243 PHE CE1 C Y N 244 PHE CE2 C Y N 245 PHE CZ C Y N 246 PHE OXT O N N 247 PHE H H N N 248 PHE H2 H N N 249 PHE HA H N N 250 PHE HB2 H N N 251 PHE HB3 H N N 252 PHE HD1 H N N 253 PHE HD2 H N N 254 PHE HE1 H N N 255 PHE HE2 H N N 256 PHE HZ H N N 257 PHE HXT H N N 258 PRO N N N N 259 PRO CA C N S 260 PRO C C N N 261 PRO O O N N 262 PRO CB C N N 263 PRO CG C N N 264 PRO CD C N N 265 PRO OXT O N N 266 PRO H H N N 267 PRO HA H N N 268 PRO HB2 H N N 269 PRO HB3 H N N 270 PRO HG2 H N N 271 PRO HG3 H N N 272 PRO HD2 H N N 273 PRO HD3 H N N 274 PRO HXT H N N 275 SER N N N N 276 SER CA C N S 277 SER C C N N 278 SER O O N N 279 SER CB C N N 280 SER OG O N N 281 SER OXT O N N 282 SER H H N N 283 SER H2 H N N 284 SER HA H N N 285 SER HB2 H N N 286 SER HB3 H N N 287 SER HG H N N 288 SER HXT H N N 289 THR N N N N 290 THR CA C N S 291 THR C C N N 292 THR O O N N 293 THR CB C N R 294 THR OG1 O N N 295 THR CG2 C N N 296 THR OXT O N N 297 THR H H N N 298 THR H2 H N N 299 THR HA H N N 300 THR HB H N N 301 THR HG1 H N N 302 THR HG21 H N N 303 THR HG22 H N N 304 THR HG23 H N N 305 THR HXT H N N 306 TRP N N N N 307 TRP CA C N S 308 TRP C C N N 309 TRP O O N N 310 TRP CB C N N 311 TRP CG C Y N 312 TRP CD1 C Y N 313 TRP CD2 C Y N 314 TRP NE1 N Y N 315 TRP CE2 C Y N 316 TRP CE3 C Y N 317 TRP CZ2 C Y N 318 TRP CZ3 C Y N 319 TRP CH2 C Y N 320 TRP OXT O N N 321 TRP H H N N 322 TRP H2 H N N 323 TRP HA H N N 324 TRP HB2 H N N 325 TRP HB3 H N N 326 TRP HD1 H N N 327 TRP HE1 H N N 328 TRP HE3 H N N 329 TRP HZ2 H N N 330 TRP HZ3 H N N 331 TRP HH2 H N N 332 TRP HXT H N N 333 TYR N N N N 334 TYR CA C N S 335 TYR C C N N 336 TYR O O N N 337 TYR CB C N N 338 TYR CG C Y N 339 TYR CD1 C Y N 340 TYR CD2 C Y N 341 TYR CE1 C Y N 342 TYR CE2 C Y N 343 TYR CZ C Y N 344 TYR OH O N N 345 TYR OXT O N N 346 TYR H H N N 347 TYR H2 H N N 348 TYR HA H N N 349 TYR HB2 H N N 350 TYR HB3 H N N 351 TYR HD1 H N N 352 TYR HD2 H N N 353 TYR HE1 H N N 354 TYR HE2 H N N 355 TYR HH H N N 356 TYR HXT H N N 357 VAL N N N N 358 VAL CA C N S 359 VAL C C N N 360 VAL O O N N 361 VAL CB C N N 362 VAL CG1 C N N 363 VAL CG2 C N N 364 VAL OXT O N N 365 VAL H H N N 366 VAL H2 H N N 367 VAL HA H N N 368 VAL HB H N N 369 VAL HG11 H N N 370 VAL HG12 H N N 371 VAL HG13 H N N 372 VAL HG21 H N N 373 VAL HG22 H N N 374 VAL HG23 H N N 375 VAL HXT H N N 376 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 THR N CA sing N N 277 THR N H sing N N 278 THR N H2 sing N N 279 THR CA C sing N N 280 THR CA CB sing N N 281 THR CA HA sing N N 282 THR C O doub N N 283 THR C OXT sing N N 284 THR CB OG1 sing N N 285 THR CB CG2 sing N N 286 THR CB HB sing N N 287 THR OG1 HG1 sing N N 288 THR CG2 HG21 sing N N 289 THR CG2 HG22 sing N N 290 THR CG2 HG23 sing N N 291 THR OXT HXT sing N N 292 TRP N CA sing N N 293 TRP N H sing N N 294 TRP N H2 sing N N 295 TRP CA C sing N N 296 TRP CA CB sing N N 297 TRP CA HA sing N N 298 TRP C O doub N N 299 TRP C OXT sing N N 300 TRP CB CG sing N N 301 TRP CB HB2 sing N N 302 TRP CB HB3 sing N N 303 TRP CG CD1 doub Y N 304 TRP CG CD2 sing Y N 305 TRP CD1 NE1 sing Y N 306 TRP CD1 HD1 sing N N 307 TRP CD2 CE2 doub Y N 308 TRP CD2 CE3 sing Y N 309 TRP NE1 CE2 sing Y N 310 TRP NE1 HE1 sing N N 311 TRP CE2 CZ2 sing Y N 312 TRP CE3 CZ3 doub Y N 313 TRP CE3 HE3 sing N N 314 TRP CZ2 CH2 doub Y N 315 TRP CZ2 HZ2 sing N N 316 TRP CZ3 CH2 sing Y N 317 TRP CZ3 HZ3 sing N N 318 TRP CH2 HH2 sing N N 319 TRP OXT HXT sing N N 320 TYR N CA sing N N 321 TYR N H sing N N 322 TYR N H2 sing N N 323 TYR CA C sing N N 324 TYR CA CB sing N N 325 TYR CA HA sing N N 326 TYR C O doub N N 327 TYR C OXT sing N N 328 TYR CB CG sing N N 329 TYR CB HB2 sing N N 330 TYR CB HB3 sing N N 331 TYR CG CD1 doub Y N 332 TYR CG CD2 sing Y N 333 TYR CD1 CE1 sing Y N 334 TYR CD1 HD1 sing N N 335 TYR CD2 CE2 doub Y N 336 TYR CD2 HD2 sing N N 337 TYR CE1 CZ doub Y N 338 TYR CE1 HE1 sing N N 339 TYR CE2 CZ sing Y N 340 TYR CE2 HE2 sing N N 341 TYR CZ OH sing N N 342 TYR OH HH sing N N 343 TYR OXT HXT sing N N 344 VAL N CA sing N N 345 VAL N H sing N N 346 VAL N H2 sing N N 347 VAL CA C sing N N 348 VAL CA CB sing N N 349 VAL CA HA sing N N 350 VAL C O doub N N 351 VAL C OXT sing N N 352 VAL CB CG1 sing N N 353 VAL CB CG2 sing N N 354 VAL CB HB sing N N 355 VAL CG1 HG11 sing N N 356 VAL CG1 HG12 sing N N 357 VAL CG1 HG13 sing N N 358 VAL CG2 HG21 sing N N 359 VAL CG2 HG22 sing N N 360 VAL CG2 HG23 sing N N 361 VAL OXT HXT sing N N 362 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4A6P _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 5LB2 _atom_sites.fract_transf_matrix[1][1] 0.011106 _atom_sites.fract_transf_matrix[1][2] 0.006412 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012824 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014736 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_