data_5M1U # _entry.id 5M1U # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.394 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5M1U pdb_00005m1u 10.2210/pdb5m1u/pdb WWPDB D_1200001702 ? ? BMRB 34052 ? 10.13018/BMR34052 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-10-11 2 'Structure model' 1 1 2018-02-21 3 'Structure model' 1 2 2018-04-04 4 'Structure model' 1 3 2024-06-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 3 'Structure model' '_citation.journal_volume' 11 3 'Structure model' '_citation.page_first' 12 3 'Structure model' '_citation.page_last' 13 4 'Structure model' '_database_2.pdbx_DOI' 14 4 'Structure model' '_database_2.pdbx_database_accession' 15 4 'Structure model' '_pdbx_nmr_spectrometer.model' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5M1U _pdbx_database_status.recvd_initial_deposition_date 2016-10-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution structure of CsgF in DHPC micelles' _pdbx_database_related.db_id 34052 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Spehr, J.' 1 'Schubeis, T.' 2 'Ahmed, M.' 3 'Ritter, C.' 4 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country NE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'FEBS Lett.' _citation.journal_id_ASTM FEBLAL _citation.journal_id_CSD 0165 _citation.journal_id_ISSN 1873-3468 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 592 _citation.language ? _citation.page_first 1020 _citation.page_last 1029 _citation.title 'Structural and functional characterization of the Curli adaptor protein CsgF.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/1873-3468.13002 _citation.pdbx_database_id_PubMed 29427517 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Schubeis, T.' 1 ? primary 'Spehr, J.' 2 ? primary 'Viereck, J.' 3 ? primary 'Kopping, L.' 4 ? primary 'Nagaraj, M.' 5 ? primary 'Ahmed, M.' 6 ? primary 'Ritter, C.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Curli production assembly/transport component CsgF' _entity.formula_weight 13947.131 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAGTMTFQFRNPNFGGNPNNGAFLLNSAQAQNSYKDPSYNDDFGIETPSALDNFTQAIQSQILGGLLSNINTGKPGRMVT NDYIVDIANRDGQLQLNVTDRKTGQTSTIQVSGLQNNSTDFHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MAGTMTFQFRNPNFGGNPNNGAFLLNSAQAQNSYKDPSYNDDFGIETPSALDNFTQAIQSQILGGLLSNINTGKPGRMVT NDYIVDIANRDGQLQLNVTDRKTGQTSTIQVSGLQNNSTDFHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 GLY n 1 4 THR n 1 5 MET n 1 6 THR n 1 7 PHE n 1 8 GLN n 1 9 PHE n 1 10 ARG n 1 11 ASN n 1 12 PRO n 1 13 ASN n 1 14 PHE n 1 15 GLY n 1 16 GLY n 1 17 ASN n 1 18 PRO n 1 19 ASN n 1 20 ASN n 1 21 GLY n 1 22 ALA n 1 23 PHE n 1 24 LEU n 1 25 LEU n 1 26 ASN n 1 27 SER n 1 28 ALA n 1 29 GLN n 1 30 ALA n 1 31 GLN n 1 32 ASN n 1 33 SER n 1 34 TYR n 1 35 LYS n 1 36 ASP n 1 37 PRO n 1 38 SER n 1 39 TYR n 1 40 ASN n 1 41 ASP n 1 42 ASP n 1 43 PHE n 1 44 GLY n 1 45 ILE n 1 46 GLU n 1 47 THR n 1 48 PRO n 1 49 SER n 1 50 ALA n 1 51 LEU n 1 52 ASP n 1 53 ASN n 1 54 PHE n 1 55 THR n 1 56 GLN n 1 57 ALA n 1 58 ILE n 1 59 GLN n 1 60 SER n 1 61 GLN n 1 62 ILE n 1 63 LEU n 1 64 GLY n 1 65 GLY n 1 66 LEU n 1 67 LEU n 1 68 SER n 1 69 ASN n 1 70 ILE n 1 71 ASN n 1 72 THR n 1 73 GLY n 1 74 LYS n 1 75 PRO n 1 76 GLY n 1 77 ARG n 1 78 MET n 1 79 VAL n 1 80 THR n 1 81 ASN n 1 82 ASP n 1 83 TYR n 1 84 ILE n 1 85 VAL n 1 86 ASP n 1 87 ILE n 1 88 ALA n 1 89 ASN n 1 90 ARG n 1 91 ASP n 1 92 GLY n 1 93 GLN n 1 94 LEU n 1 95 GLN n 1 96 LEU n 1 97 ASN n 1 98 VAL n 1 99 THR n 1 100 ASP n 1 101 ARG n 1 102 LYS n 1 103 THR n 1 104 GLY n 1 105 GLN n 1 106 THR n 1 107 SER n 1 108 THR n 1 109 ILE n 1 110 GLN n 1 111 VAL n 1 112 SER n 1 113 GLY n 1 114 LEU n 1 115 GLN n 1 116 ASN n 1 117 ASN n 1 118 SER n 1 119 THR n 1 120 ASP n 1 121 PHE n 1 122 HIS n 1 123 HIS n 1 124 HIS n 1 125 HIS n 1 126 HIS n 1 127 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 127 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'csgF, b1038, JW1021' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain K12 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83333 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET11d _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 MET 5 5 5 MET MET A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 ASN 69 69 69 ASN ASN A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 MET 78 78 78 MET MET A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 TYR 83 83 83 TYR TYR A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 ARG 90 90 90 ARG ARG A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 GLN 93 93 93 GLN GLN A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 GLN 95 95 95 GLN GLN A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 ASN 97 97 97 ASN ASN A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 THR 99 99 99 THR THR A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 ARG 101 101 101 ARG ARG A . n A 1 102 LYS 102 102 102 LYS LYS A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 GLN 105 105 105 GLN GLN A . n A 1 106 THR 106 106 106 THR THR A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 THR 108 108 108 THR THR A . n A 1 109 ILE 109 109 109 ILE ILE A . n A 1 110 GLN 110 110 110 GLN GLN A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 SER 112 112 112 SER SER A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 GLN 115 115 115 GLN GLN A . n A 1 116 ASN 116 116 116 ASN ASN A . n A 1 117 ASN 117 117 117 ASN ASN A . n A 1 118 SER 118 118 118 SER SER A . n A 1 119 THR 119 119 119 THR THR A . n A 1 120 ASP 120 120 120 ASP ASP A . n A 1 121 PHE 121 121 121 PHE PHE A . n A 1 122 HIS 122 122 122 HIS HIS A . n A 1 123 HIS 123 123 123 HIS HIS A . n A 1 124 HIS 124 124 124 HIS HIS A . n A 1 125 HIS 125 125 125 HIS HIS A . n A 1 126 HIS 126 126 126 HIS HIS A . n A 1 127 HIS 127 127 127 HIS HIS A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5M1U _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 5M1U _struct.title 'Solution structure of CsgF in DHPC micelles' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5M1U _struct_keywords.text 'Curli, Type VIII secretion system, Intrinsically disordered protein, transport protein' _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CSGF_ECOLI _struct_ref.pdbx_db_accession P0AE98 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AGTMTFQFRNPNFGGNPNNGAFLLNSAQAQNSYKDPSYNDDFGIETPSALDNFTQAIQSQILGGLLSNINTGKPGRMVTN DYIVDIANRDGQLQLNVTDRKTGQTSTIQVSGLQNNSTDF ; _struct_ref.pdbx_align_begin 19 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5M1U _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 121 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0AE98 _struct_ref_seq.db_align_beg 19 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 138 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 121 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5M1U MET A 1 ? UNP P0AE98 ? ? 'initiating methionine' 1 1 1 5M1U HIS A 122 ? UNP P0AE98 ? ? 'expression tag' 122 2 1 5M1U HIS A 123 ? UNP P0AE98 ? ? 'expression tag' 123 3 1 5M1U HIS A 124 ? UNP P0AE98 ? ? 'expression tag' 124 4 1 5M1U HIS A 125 ? UNP P0AE98 ? ? 'expression tag' 125 5 1 5M1U HIS A 126 ? UNP P0AE98 ? ? 'expression tag' 126 6 1 5M1U HIS A 127 ? UNP P0AE98 ? ? 'expression tag' 127 7 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 12250 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 41 ? THR A 47 ? ASP A 41 THR A 47 5 ? 7 HELX_P HELX_P2 AA2 LEU A 51 ? ILE A 62 ? LEU A 51 ILE A 62 1 ? 12 HELX_P HELX_P3 AA3 GLY A 64 ? ASN A 69 ? GLY A 64 ASN A 69 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 77 ? VAL A 79 ? ARG A 77 VAL A 79 AA1 2 TYR A 83 ? ARG A 90 ? TYR A 83 ARG A 90 AA1 3 GLN A 93 ? ASP A 100 ? GLN A 93 ASP A 100 AA1 4 THR A 106 ? GLN A 110 ? THR A 106 GLN A 110 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N MET A 78 ? N MET A 78 O VAL A 85 ? O VAL A 85 AA1 2 3 N ILE A 84 ? N ILE A 84 O THR A 99 ? O THR A 99 AA1 3 4 N VAL A 98 ? N VAL A 98 O SER A 107 ? O SER A 107 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 4 OD1 A ASP 82 ? ? HZ2 A LYS 102 ? ? 1.54 2 4 O A PRO 37 ? ? HG A SER 38 ? ? 1.60 3 7 HB3 A LYS 74 ? ? HB A ILE 87 ? ? 1.18 4 7 HZ1 A LYS 74 ? ? OD2 A ASP 86 ? ? 1.57 5 8 O A ASN 71 ? ? HG1 A THR 72 ? ? 1.59 6 11 O A ASN 71 ? ? HG1 A THR 72 ? ? 1.56 7 11 OD1 A ASP 100 ? ? HG1 A THR 103 ? ? 1.57 8 12 O A ASN 71 ? ? HG1 A THR 72 ? ? 1.59 9 12 OD1 A ASP 82 ? ? HH21 A ARG 101 ? ? 1.59 10 13 HB3 A PRO 37 ? ? H A PHE 43 ? ? 1.31 11 17 OD1 A ASP 100 ? ? H A THR 103 ? ? 1.60 12 18 OD2 A ASP 100 ? ? H A THR 103 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 5 ? ? 67.61 -71.93 2 1 THR A 6 ? ? 51.56 -65.57 3 1 ASN A 11 ? ? 63.67 84.92 4 1 ASN A 13 ? ? 70.58 103.35 5 1 ALA A 22 ? ? 72.15 -55.50 6 1 LEU A 25 ? ? 63.90 174.26 7 1 ASN A 26 ? ? -127.25 -82.51 8 1 SER A 27 ? ? -172.12 134.93 9 1 ALA A 30 ? ? 75.51 -37.49 10 1 GLN A 31 ? ? 44.78 -84.76 11 1 TYR A 34 ? ? 71.90 -25.40 12 1 LYS A 35 ? ? -140.35 31.19 13 1 ASP A 41 ? ? 63.52 105.98 14 1 PHE A 43 ? ? -169.38 19.36 15 1 SER A 49 ? ? -86.07 -80.15 16 1 ASP A 91 ? ? 69.93 -68.18 17 1 LEU A 114 ? ? -106.16 -75.81 18 1 HIS A 122 ? ? 63.95 -168.96 19 2 MET A 5 ? ? 58.50 -167.17 20 2 THR A 6 ? ? -141.53 -78.26 21 2 PHE A 7 ? ? 65.63 114.44 22 2 ASN A 11 ? ? 73.37 155.96 23 2 ASN A 13 ? ? 72.40 154.94 24 2 PHE A 14 ? ? 65.11 -175.00 25 2 ASN A 20 ? ? 44.90 88.57 26 2 ALA A 22 ? ? 75.09 -59.77 27 2 PHE A 23 ? ? 67.65 97.17 28 2 LEU A 25 ? ? 58.63 72.47 29 2 GLN A 31 ? ? 63.11 -167.39 30 2 ASN A 32 ? ? 73.21 168.58 31 2 SER A 38 ? ? 68.07 -74.60 32 2 ASN A 40 ? ? 70.09 90.35 33 2 ASP A 41 ? ? 62.69 93.41 34 2 ASP A 42 ? ? -85.09 30.09 35 2 PRO A 48 ? ? -57.66 98.94 36 2 LEU A 67 ? ? -109.41 -66.69 37 2 ASN A 81 ? ? -64.28 -73.88 38 2 ASP A 91 ? ? 69.05 -67.78 39 3 ALA A 2 ? ? 65.43 -168.97 40 3 PHE A 7 ? ? 68.07 -58.25 41 3 GLN A 8 ? ? 72.51 -64.18 42 3 PHE A 9 ? ? 62.35 -172.14 43 3 ARG A 10 ? ? -147.93 -43.79 44 3 ASN A 11 ? ? 68.94 146.90 45 3 ASN A 13 ? ? 68.03 120.31 46 3 PHE A 14 ? ? 72.11 121.14 47 3 LEU A 25 ? ? 53.50 -179.87 48 3 ASN A 26 ? ? -173.54 121.29 49 3 GLN A 29 ? ? -102.14 77.55 50 3 SER A 33 ? ? 71.56 -47.86 51 3 TYR A 39 ? ? -112.65 55.19 52 3 ASN A 40 ? ? 54.36 79.99 53 3 ASP A 41 ? ? 70.75 102.60 54 3 PHE A 43 ? ? 59.61 0.55 55 3 ILE A 45 ? ? -96.33 -60.15 56 3 GLU A 46 ? ? 68.63 -52.05 57 3 SER A 49 ? ? -127.29 -72.60 58 3 ASN A 81 ? ? -72.59 -75.89 59 3 ASP A 91 ? ? 64.43 -86.05 60 3 LEU A 114 ? ? -99.80 -77.12 61 3 GLN A 115 ? ? 60.64 78.74 62 3 SER A 118 ? ? 66.81 165.83 63 3 PHE A 121 ? ? 72.19 145.85 64 4 ALA A 2 ? ? -160.03 -40.78 65 4 MET A 5 ? ? 72.04 -55.70 66 4 THR A 6 ? ? 43.72 88.14 67 4 ASN A 19 ? ? -176.92 -170.58 68 4 ALA A 22 ? ? -164.15 117.47 69 4 GLN A 31 ? ? 65.74 177.17 70 4 TYR A 34 ? ? 58.93 81.31 71 4 SER A 38 ? ? 174.40 23.63 72 4 ASP A 41 ? ? 50.27 74.29 73 4 ASP A 42 ? ? -158.38 -51.52 74 4 PHE A 43 ? ? 58.19 -0.35 75 4 SER A 49 ? ? -129.39 -62.69 76 4 THR A 72 ? ? 52.15 -168.84 77 4 ASP A 91 ? ? 73.38 -57.97 78 4 ASN A 116 ? ? 67.86 134.39 79 4 PHE A 121 ? ? 64.15 104.72 80 5 MET A 5 ? ? 67.61 -71.93 81 5 THR A 6 ? ? 51.56 -65.57 82 5 ASN A 11 ? ? 63.67 84.92 83 5 ASN A 13 ? ? 70.58 103.35 84 5 ALA A 22 ? ? 72.15 -55.50 85 5 LEU A 25 ? ? 63.90 174.26 86 5 ASN A 26 ? ? -127.25 -82.51 87 5 SER A 27 ? ? -172.12 134.93 88 5 ALA A 30 ? ? 75.51 -37.49 89 5 GLN A 31 ? ? 44.78 -84.76 90 5 TYR A 34 ? ? 71.90 -25.40 91 5 LYS A 35 ? ? -140.35 31.19 92 5 ASP A 41 ? ? 63.52 105.98 93 5 PHE A 43 ? ? -169.38 19.36 94 5 SER A 49 ? ? -86.07 -80.15 95 5 ASP A 91 ? ? 69.93 -68.18 96 5 LEU A 114 ? ? -106.16 -75.81 97 5 HIS A 122 ? ? 63.95 -168.96 98 6 THR A 4 ? ? -73.00 -70.50 99 6 MET A 5 ? ? 59.53 -169.65 100 6 THR A 6 ? ? 52.98 92.76 101 6 ARG A 10 ? ? -108.57 -76.45 102 6 ASN A 13 ? ? 67.70 113.79 103 6 LEU A 25 ? ? 47.49 -167.89 104 6 GLN A 29 ? ? -112.43 -83.79 105 6 TYR A 39 ? ? 69.30 162.52 106 6 ASP A 41 ? ? 46.95 24.62 107 6 SER A 49 ? ? -140.43 -36.90 108 6 LYS A 102 ? ? -105.26 -62.83 109 7 PHE A 7 ? ? 69.21 164.17 110 7 GLN A 8 ? ? -154.74 -46.10 111 7 PHE A 9 ? ? 60.30 85.54 112 7 ASN A 13 ? ? 71.99 153.44 113 7 ASN A 17 ? ? 66.73 156.91 114 7 ASN A 19 ? ? -162.83 101.96 115 7 ASN A 20 ? ? -151.87 -51.60 116 7 ASN A 26 ? ? 57.48 76.17 117 7 ALA A 30 ? ? 67.94 166.32 118 7 GLN A 31 ? ? -112.52 -85.37 119 7 ASN A 32 ? ? 59.71 -174.46 120 7 LYS A 35 ? ? 49.85 12.57 121 7 SER A 38 ? ? -85.33 -80.49 122 7 ASN A 40 ? ? 59.52 89.07 123 7 ASP A 41 ? ? 54.84 83.93 124 7 ASP A 42 ? ? -105.45 -82.82 125 7 SER A 49 ? ? -134.29 -75.61 126 7 THR A 72 ? ? 53.30 -163.61 127 7 VAL A 111 ? ? -55.76 101.40 128 7 LEU A 114 ? ? 66.94 -81.37 129 8 ALA A 2 ? ? 58.81 -161.00 130 8 THR A 4 ? ? 58.55 83.30 131 8 THR A 6 ? ? 68.80 97.03 132 8 ASN A 13 ? ? 64.27 153.96 133 8 ASN A 19 ? ? 72.06 -61.78 134 8 PHE A 23 ? ? 66.11 102.67 135 8 LEU A 25 ? ? 45.47 88.26 136 8 TYR A 39 ? ? 60.80 96.84 137 8 ASP A 41 ? ? 67.03 140.41 138 8 ASP A 42 ? ? -122.63 -68.47 139 8 PHE A 43 ? ? -146.30 23.96 140 8 GLU A 46 ? ? 71.13 -34.36 141 8 SER A 49 ? ? -98.60 -69.77 142 8 THR A 72 ? ? 58.24 9.99 143 8 LYS A 102 ? ? -87.17 -71.92 144 8 SER A 112 ? ? -170.28 -41.58 145 8 ASN A 117 ? ? 64.03 171.25 146 8 SER A 118 ? ? 60.08 -155.94 147 8 THR A 119 ? ? 58.42 105.61 148 8 ASP A 120 ? ? 74.52 120.50 149 8 PHE A 121 ? ? -149.98 36.76 150 8 HIS A 123 ? ? 63.35 -85.79 151 8 HIS A 125 ? ? 57.85 111.69 152 9 ALA A 2 ? ? -152.47 -76.51 153 9 MET A 5 ? ? 47.05 93.29 154 9 THR A 6 ? ? -84.80 -83.53 155 9 PRO A 12 ? ? -69.51 80.17 156 9 ASN A 13 ? ? 66.49 -176.08 157 9 ALA A 22 ? ? 63.63 -166.42 158 9 PHE A 23 ? ? 75.17 -29.82 159 9 GLN A 29 ? ? 71.69 160.54 160 9 ALA A 30 ? ? 63.84 -166.84 161 9 SER A 33 ? ? 73.72 80.42 162 9 SER A 38 ? ? -138.14 -63.39 163 9 TYR A 39 ? ? -175.97 106.58 164 9 ASN A 40 ? ? 75.74 137.27 165 9 GLU A 46 ? ? 64.00 86.61 166 9 SER A 49 ? ? -146.51 -76.18 167 9 PRO A 75 ? ? -73.37 -164.38 168 9 ASN A 117 ? ? -150.06 -69.16 169 9 SER A 118 ? ? 55.19 74.67 170 9 HIS A 122 ? ? -90.49 -73.82 171 9 HIS A 123 ? ? 63.35 104.11 172 9 HIS A 124 ? ? -160.96 -24.04 173 9 HIS A 125 ? ? 67.40 -176.17 174 10 ALA A 2 ? ? 66.76 -68.48 175 10 THR A 6 ? ? -141.70 -43.47 176 10 PHE A 7 ? ? 56.39 112.94 177 10 ARG A 10 ? ? -124.63 -71.55 178 10 ASN A 11 ? ? 71.02 147.84 179 10 ASN A 13 ? ? 62.61 81.64 180 10 ASN A 19 ? ? 71.04 139.80 181 10 LEU A 25 ? ? -123.85 -51.70 182 10 ASN A 26 ? ? 65.70 -85.34 183 10 SER A 27 ? ? -173.74 130.55 184 10 SER A 38 ? ? -159.22 -54.61 185 10 TYR A 39 ? ? -175.81 146.61 186 10 ASN A 40 ? ? 71.37 103.97 187 10 ASP A 41 ? ? 71.51 113.90 188 10 ASN A 116 ? ? 71.05 128.88 189 10 SER A 118 ? ? 62.30 -167.06 190 10 THR A 119 ? ? -114.42 -79.62 191 10 ASP A 120 ? ? 62.38 95.39 192 11 ASN A 11 ? ? 66.32 86.27 193 11 ASN A 13 ? ? 71.34 116.74 194 11 ASN A 19 ? ? 65.33 179.77 195 11 ALA A 28 ? ? 64.61 -82.38 196 11 GLN A 29 ? ? 67.18 -73.59 197 11 ALA A 30 ? ? 66.95 135.39 198 11 ASN A 32 ? ? 69.57 177.53 199 11 PRO A 48 ? ? -63.24 98.23 200 11 SER A 49 ? ? -117.15 -77.79 201 11 ASN A 53 ? ? -77.43 22.34 202 11 PHE A 54 ? ? -132.66 -65.91 203 11 THR A 72 ? ? 57.37 178.41 204 11 ASP A 82 ? ? -105.51 -79.53 205 11 ASP A 91 ? ? 68.59 -71.02 206 11 LEU A 114 ? ? 54.40 70.47 207 11 ASN A 117 ? ? 72.87 96.24 208 11 THR A 119 ? ? 70.56 155.57 209 11 HIS A 124 ? ? -53.46 -75.91 210 11 HIS A 125 ? ? 66.32 134.32 211 12 MET A 5 ? ? -161.87 -38.65 212 12 THR A 6 ? ? 58.95 76.07 213 12 GLN A 8 ? ? -170.58 -66.67 214 12 PHE A 9 ? ? 61.15 85.16 215 12 ASN A 13 ? ? 71.94 121.81 216 12 ALA A 22 ? ? 71.82 155.09 217 12 PHE A 23 ? ? 64.01 86.04 218 12 LEU A 25 ? ? 64.59 153.03 219 12 SER A 27 ? ? 69.34 -67.66 220 12 ALA A 28 ? ? 63.71 -86.35 221 12 ALA A 30 ? ? -172.64 -157.20 222 12 GLN A 31 ? ? 75.32 -17.82 223 12 ASN A 32 ? ? 71.52 112.27 224 12 SER A 38 ? ? -136.14 -71.04 225 12 TYR A 39 ? ? -179.82 140.74 226 12 ASP A 41 ? ? 72.39 85.64 227 12 PHE A 43 ? ? 47.21 25.61 228 12 SER A 49 ? ? -125.20 -51.06 229 12 THR A 72 ? ? 54.28 -169.62 230 12 GLN A 115 ? ? 63.66 107.63 231 12 SER A 118 ? ? -65.80 -71.97 232 12 HIS A 123 ? ? 66.50 -167.48 233 12 HIS A 124 ? ? 59.16 78.54 234 13 ALA A 2 ? ? 64.27 175.42 235 13 MET A 5 ? ? -179.49 -59.91 236 13 THR A 6 ? ? 71.38 148.12 237 13 PHE A 9 ? ? 63.99 -80.28 238 13 ARG A 10 ? ? -158.31 82.53 239 13 ASN A 13 ? ? 68.97 121.59 240 13 ASN A 17 ? ? 66.07 146.42 241 13 ALA A 22 ? ? 64.99 98.95 242 13 ASN A 26 ? ? 66.62 102.13 243 13 ALA A 30 ? ? 71.95 -48.89 244 13 ASN A 32 ? ? 72.19 141.75 245 13 LYS A 35 ? ? -129.00 -164.99 246 13 GLU A 46 ? ? 63.35 -165.45 247 13 SER A 49 ? ? -110.18 -78.65 248 13 ASP A 82 ? ? -170.75 -41.41 249 13 ASP A 91 ? ? 75.15 -45.57 250 13 SER A 112 ? ? 69.24 -155.48 251 14 THR A 4 ? ? 72.91 150.09 252 14 MET A 5 ? ? 74.47 81.69 253 14 ARG A 10 ? ? 68.74 -169.02 254 14 ASN A 11 ? ? 62.18 81.13 255 14 ASN A 13 ? ? 63.73 -175.04 256 14 PHE A 14 ? ? 74.32 134.93 257 14 PHE A 23 ? ? 44.37 79.91 258 14 GLN A 29 ? ? 62.70 -164.54 259 14 LYS A 35 ? ? -161.21 79.18 260 14 ASN A 40 ? ? 65.21 68.80 261 14 ASP A 41 ? ? 71.84 140.42 262 14 THR A 72 ? ? 73.66 -44.49 263 14 LYS A 102 ? ? -107.11 -66.78 264 14 SER A 118 ? ? 58.54 78.35 265 14 HIS A 123 ? ? 72.23 100.55 266 15 ALA A 2 ? ? 62.99 -167.02 267 15 THR A 6 ? ? 74.45 131.92 268 15 PHE A 7 ? ? -109.36 -78.45 269 15 GLN A 8 ? ? 48.86 19.64 270 15 ARG A 10 ? ? 62.27 80.92 271 15 PRO A 12 ? ? -48.42 151.36 272 15 ASN A 13 ? ? 62.21 88.86 273 15 SER A 33 ? ? -55.59 105.56 274 15 SER A 38 ? ? 66.53 -70.09 275 15 ASN A 40 ? ? 63.92 74.32 276 15 ASP A 41 ? ? 65.99 117.90 277 15 SER A 49 ? ? -93.75 -68.00 278 15 LEU A 67 ? ? -79.74 32.28 279 15 SER A 68 ? ? -135.75 -50.94 280 15 ASP A 91 ? ? 69.13 -70.49 281 15 ASN A 116 ? ? 50.34 178.88 282 15 HIS A 125 ? ? 66.71 168.65 283 16 ALA A 2 ? ? 68.90 -65.97 284 16 THR A 4 ? ? -151.11 33.13 285 16 PHE A 7 ? ? -117.64 -70.63 286 16 ASN A 13 ? ? 67.84 123.27 287 16 ASN A 17 ? ? 65.17 166.29 288 16 LEU A 25 ? ? 53.58 -173.19 289 16 ALA A 30 ? ? 67.28 -168.39 290 16 SER A 33 ? ? 61.44 -76.50 291 16 SER A 38 ? ? -149.81 -39.04 292 16 ASP A 42 ? ? -151.67 19.61 293 16 ILE A 45 ? ? -122.66 -65.05 294 16 GLU A 46 ? ? 67.43 -70.51 295 16 SER A 49 ? ? -97.51 -86.15 296 16 ASN A 71 ? ? -62.74 -72.05 297 16 PRO A 75 ? ? -23.11 -55.63 298 16 ASP A 82 ? ? -101.60 -76.52 299 16 ASP A 91 ? ? 69.04 -83.11 300 16 LYS A 102 ? ? -107.62 -67.71 301 16 HIS A 122 ? ? 60.39 83.07 302 17 ALA A 2 ? ? 66.11 107.58 303 17 ASN A 13 ? ? 69.37 114.92 304 17 ASN A 20 ? ? 74.01 113.55 305 17 LEU A 24 ? ? -102.82 -167.43 306 17 LEU A 25 ? ? 58.99 -178.05 307 17 SER A 27 ? ? -69.25 -84.07 308 17 ALA A 28 ? ? -170.43 89.71 309 17 SER A 33 ? ? 60.07 82.91 310 17 LYS A 35 ? ? 72.48 -163.64 311 17 ASP A 42 ? ? -145.61 12.72 312 17 THR A 47 ? ? -151.11 86.02 313 17 ALA A 50 ? ? -144.30 -37.33 314 17 ASN A 71 ? ? -111.08 -88.48 315 17 ASN A 116 ? ? 175.20 131.73 316 17 ASN A 117 ? ? -106.34 -71.46 317 17 SER A 118 ? ? 70.71 145.28 318 17 HIS A 123 ? ? -101.65 -163.30 319 17 HIS A 124 ? ? 56.08 -174.23 320 18 PHE A 7 ? ? -141.44 -71.39 321 18 PHE A 9 ? ? 67.88 157.21 322 18 ASN A 11 ? ? 65.12 86.31 323 18 ASN A 13 ? ? 71.52 172.60 324 18 ASN A 20 ? ? 68.10 105.53 325 18 PHE A 23 ? ? -167.71 100.98 326 18 LEU A 25 ? ? -101.57 -68.27 327 18 ASN A 26 ? ? 66.27 98.83 328 18 GLN A 31 ? ? -99.49 -82.31 329 18 ASN A 32 ? ? 179.02 122.08 330 18 ASP A 42 ? ? -132.43 -85.20 331 18 PHE A 43 ? ? -141.85 31.30 332 18 PRO A 48 ? ? -67.60 93.52 333 18 SER A 49 ? ? -105.61 -69.75 334 18 PHE A 54 ? ? -122.97 -64.80 335 18 ASN A 71 ? ? -61.60 -88.19 336 18 THR A 72 ? ? -170.44 144.00 337 18 LEU A 114 ? ? -144.88 -62.19 338 18 GLN A 115 ? ? 62.45 86.46 339 18 ASN A 116 ? ? -170.52 98.70 340 18 SER A 118 ? ? 62.14 91.77 341 18 ASP A 120 ? ? -101.31 -73.10 342 18 PHE A 121 ? ? 64.72 -82.84 343 18 HIS A 122 ? ? 66.27 102.58 344 18 HIS A 126 ? ? 59.17 170.12 345 19 THR A 6 ? ? -153.65 -48.53 346 19 PHE A 7 ? ? -64.57 -80.90 347 19 ARG A 10 ? ? -164.11 108.87 348 19 ASN A 11 ? ? 65.07 87.87 349 19 ASN A 13 ? ? 73.24 106.48 350 19 ASN A 19 ? ? 47.02 -87.92 351 19 ASN A 20 ? ? -177.59 -179.76 352 19 ALA A 22 ? ? 63.75 -168.51 353 19 LEU A 25 ? ? 48.81 -166.14 354 19 ASN A 26 ? ? -172.42 -85.85 355 19 SER A 27 ? ? 176.09 136.75 356 19 SER A 38 ? ? -146.58 38.34 357 19 TYR A 39 ? ? 73.02 160.54 358 19 ASP A 41 ? ? -174.69 130.29 359 19 PRO A 48 ? ? -66.21 99.22 360 19 SER A 49 ? ? -127.85 -59.46 361 19 PHE A 54 ? ? -109.65 -64.82 362 19 THR A 106 ? ? -58.64 109.94 363 19 PHE A 121 ? ? -92.10 -76.17 364 19 HIS A 122 ? ? 69.20 157.36 365 19 HIS A 124 ? ? -172.22 -60.24 366 19 HIS A 125 ? ? 63.93 169.52 367 20 THR A 6 ? ? -167.21 -64.61 368 20 PHE A 7 ? ? 60.16 113.75 369 20 ASN A 13 ? ? 64.76 102.76 370 20 ASN A 19 ? ? 68.71 126.62 371 20 ALA A 28 ? ? 67.50 -163.14 372 20 ASN A 32 ? ? -174.77 122.73 373 20 LYS A 35 ? ? 70.37 -162.85 374 20 TYR A 39 ? ? 75.10 164.93 375 20 ASN A 40 ? ? 71.84 -175.99 376 20 ASP A 42 ? ? -128.18 -53.24 377 20 ALA A 50 ? ? -165.42 -32.71 378 20 THR A 72 ? ? 67.62 111.54 379 20 ASP A 82 ? ? -139.73 -42.75 380 20 ASP A 91 ? ? 60.10 82.47 381 20 SER A 112 ? ? -151.24 -55.30 382 20 GLN A 115 ? ? 54.61 95.62 383 20 ASN A 116 ? ? -58.53 98.09 384 20 ASN A 117 ? ? -175.71 93.10 385 20 HIS A 122 ? ? 70.72 116.81 386 20 HIS A 125 ? ? -127.19 -67.04 387 20 HIS A 126 ? ? 52.98 72.20 # _pdbx_nmr_ensemble.entry_id 5M1U _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 5M1U _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '400 uM [U-13C; U-15N] CsgF, 93% H2O/7% D2O' _pdbx_nmr_sample_details.solvent_system '93% H2O/7% D2O' _pdbx_nmr_sample_details.label 13C_15N _pdbx_nmr_sample_details.type micelle _pdbx_nmr_sample_details.details ? # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component CsgF _pdbx_nmr_exptl_sample.concentration 400 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units uM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-13C; U-15N]' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.details _pdbx_nmr_exptl_sample_conditions.ionic_strength_err _pdbx_nmr_exptl_sample_conditions.ionic_strength_units _pdbx_nmr_exptl_sample_conditions.label _pdbx_nmr_exptl_sample_conditions.pH_err _pdbx_nmr_exptl_sample_conditions.pH_units _pdbx_nmr_exptl_sample_conditions.pressure_err _pdbx_nmr_exptl_sample_conditions.temperature_err _pdbx_nmr_exptl_sample_conditions.temperature_units 1 310 atm 1 6.5 50 '50 mM Phosphate Buffer pH 6,5; 100 mM DHPC; 0,05 % NaN3' ? mM 1 ? pH ? ? K 2 310 atm 1 6.5 50 '50 mM Phosphate Buffer pH 6,5; 100 mM d22-DHPC; 0,05 % NaN3' ? mM 2 ? pH ? ? K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '3D HNCO' 1 isotropic 3 1 1 '3D HN(CA)CO' 1 isotropic 4 1 1 '3D CBCA(CO)NH' 1 isotropic 5 1 1 '3D HNCACB' 1 isotropic 6 1 1 '3D HCC(CO)NH' 1 isotropic 7 1 1 '3D 1H-13C NOESY aliphatic' 1 isotropic 8 1 1 '3D 1H-15N NOESY' 1 isotropic 9 1 1 '3D 1H-15N TOCSY' 1 isotropic 10 2 1 '2D 1H-15N HSQC' 1 isotropic 11 2 1 '2D 1H-13C HSQC' 1 isotropic 12 2 1 '3D 1H-13C NOESY aliphatic' 1 isotropic 13 2 1 '3D 1H-13C NOESY aromatic' 1 isotropic 14 2 1 '2D 1H-13C HSQC aromatic' 1 isotropic 15 2 1 '3D HCCH-TOCSY' 1 isotropic # _pdbx_nmr_refine.entry_id 5M1U _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 4 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 processing PROSA ? Guntert 2 'chemical shift assignment' CARA ? 'Keller and Wuthrich' 3 'chemical shift assignment' CANDID ? 'Herrmann, Guntert and Wuthrich' 4 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TYR N N N N 304 TYR CA C N S 305 TYR C C N N 306 TYR O O N N 307 TYR CB C N N 308 TYR CG C Y N 309 TYR CD1 C Y N 310 TYR CD2 C Y N 311 TYR CE1 C Y N 312 TYR CE2 C Y N 313 TYR CZ C Y N 314 TYR OH O N N 315 TYR OXT O N N 316 TYR H H N N 317 TYR H2 H N N 318 TYR HA H N N 319 TYR HB2 H N N 320 TYR HB3 H N N 321 TYR HD1 H N N 322 TYR HD2 H N N 323 TYR HE1 H N N 324 TYR HE2 H N N 325 TYR HH H N N 326 TYR HXT H N N 327 VAL N N N N 328 VAL CA C N S 329 VAL C C N N 330 VAL O O N N 331 VAL CB C N N 332 VAL CG1 C N N 333 VAL CG2 C N N 334 VAL OXT O N N 335 VAL H H N N 336 VAL H2 H N N 337 VAL HA H N N 338 VAL HB H N N 339 VAL HG11 H N N 340 VAL HG12 H N N 341 VAL HG13 H N N 342 VAL HG21 H N N 343 VAL HG22 H N N 344 VAL HG23 H N N 345 VAL HXT H N N 346 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TYR N CA sing N N 291 TYR N H sing N N 292 TYR N H2 sing N N 293 TYR CA C sing N N 294 TYR CA CB sing N N 295 TYR CA HA sing N N 296 TYR C O doub N N 297 TYR C OXT sing N N 298 TYR CB CG sing N N 299 TYR CB HB2 sing N N 300 TYR CB HB3 sing N N 301 TYR CG CD1 doub Y N 302 TYR CG CD2 sing Y N 303 TYR CD1 CE1 sing Y N 304 TYR CD1 HD1 sing N N 305 TYR CD2 CE2 doub Y N 306 TYR CD2 HD2 sing N N 307 TYR CE1 CZ doub Y N 308 TYR CE1 HE1 sing N N 309 TYR CE2 CZ sing Y N 310 TYR CE2 HE2 sing N N 311 TYR CZ OH sing N N 312 TYR OH HH sing N N 313 TYR OXT HXT sing N N 314 VAL N CA sing N N 315 VAL N H sing N N 316 VAL N H2 sing N N 317 VAL CA C sing N N 318 VAL CA CB sing N N 319 VAL CA HA sing N N 320 VAL C O doub N N 321 VAL C OXT sing N N 322 VAL CB CG1 sing N N 323 VAL CB CG2 sing N N 324 VAL CB HB sing N N 325 VAL CG1 HG11 sing N N 326 VAL CG1 HG12 sing N N 327 VAL CG1 HG13 sing N N 328 VAL CG2 HG21 sing N N 329 VAL CG2 HG22 sing N N 330 VAL CG2 HG23 sing N N 331 VAL OXT HXT sing N N 332 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 5M1U _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_