data_5N2O # _entry.id 5N2O # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5N2O pdb_00005n2o 10.2210/pdb5n2o/pdb WWPDB D_1200003433 ? ? BMRB 34095 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Structure Of P63 SAM Domain L514F Mutant Causative For AEC Syndrome' _pdbx_database_related.db_id 34095 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5N2O _pdbx_database_status.recvd_initial_deposition_date 2017-02-08 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Rinnenthal, J.' 1 ? 'Wuerz, J.M.' 2 ? 'Osterburg, C.' 3 0000-0002-2144-583X 'Guentert, P.' 4 ? 'Doetsch, V.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Proc. Natl. Acad. Sci. U.S.A.' _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 115 _citation.language ? _citation.page_first E906 _citation.page_last E915 _citation.title 'Protein aggregation of the p63 transcription factor underlies severe skin fragility in AEC syndrome.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.1713773115 _citation.pdbx_database_id_PubMed 29339502 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Russo, C.' 1 ? primary 'Osterburg, C.' 2 ? primary 'Sirico, A.' 3 ? primary 'Antonini, D.' 4 ? primary 'Ambrosio, R.' 5 ? primary 'Wurz, J.M.' 6 ? primary 'Rinnenthal, J.' 7 ? primary 'Ferniani, M.' 8 ? primary 'Kehrloesser, S.' 9 ? primary 'Schafer, B.' 10 ? primary 'Guntert, P.' 11 ? primary 'Sinha, S.' 12 ? primary 'Dotsch, V.' 13 ? primary 'Missero, C.' 14 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5N2O _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.000 _cell.length_a_esd ? _cell.length_b 1.000 _cell.length_b_esd ? _cell.length_c 1.000 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5N2O _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Tumor protein 63' _entity.formula_weight 7957.985 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation L14F _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'p63,Transformation-related protein 63,TP63,Tumor protein p73-like,p73L' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GPLGSTDCSIVSFFARLGCSSCLDYFTTQGLTTIYQIEHYSMDDLASLKIPEQFRHAIWKGILDHRQLHD _entity_poly.pdbx_seq_one_letter_code_can GPLGSTDCSIVSFFARLGCSSCLDYFTTQGLTTIYQIEHYSMDDLASLKIPEQFRHAIWKGILDHRQLHD _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 LEU n 1 4 GLY n 1 5 SER n 1 6 THR n 1 7 ASP n 1 8 CYS n 1 9 SER n 1 10 ILE n 1 11 VAL n 1 12 SER n 1 13 PHE n 1 14 PHE n 1 15 ALA n 1 16 ARG n 1 17 LEU n 1 18 GLY n 1 19 CYS n 1 20 SER n 1 21 SER n 1 22 CYS n 1 23 LEU n 1 24 ASP n 1 25 TYR n 1 26 PHE n 1 27 THR n 1 28 THR n 1 29 GLN n 1 30 GLY n 1 31 LEU n 1 32 THR n 1 33 THR n 1 34 ILE n 1 35 TYR n 1 36 GLN n 1 37 ILE n 1 38 GLU n 1 39 HIS n 1 40 TYR n 1 41 SER n 1 42 MET n 1 43 ASP n 1 44 ASP n 1 45 LEU n 1 46 ALA n 1 47 SER n 1 48 LEU n 1 49 LYS n 1 50 ILE n 1 51 PRO n 1 52 GLU n 1 53 GLN n 1 54 PHE n 1 55 ARG n 1 56 HIS n 1 57 ALA n 1 58 ILE n 1 59 TRP n 1 60 LYS n 1 61 GLY n 1 62 ILE n 1 63 LEU n 1 64 ASP n 1 65 HIS n 1 66 ARG n 1 67 GLN n 1 68 LEU n 1 69 HIS n 1 70 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 70 _entity_src_gen.gene_src_common_name 'House Mouse' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Tp63, P63, P73l, Tp73l, Trp63' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code P63_MOUSE _struct_ref.pdbx_db_accession O88898 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code TDCSIVSFLARLGCSSCLDYFTTQGLTTIYQIEHYSMDDLASLKIPEQFRHAIWKGILDHRQLHD _struct_ref.pdbx_align_begin 545 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5N2O _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 6 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 70 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O88898 _struct_ref_seq.db_align_beg 545 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 609 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 6 _struct_ref_seq.pdbx_auth_seq_align_end 70 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5N2O GLY A 1 ? UNP O88898 ? ? 'expression tag' 1 1 1 5N2O PRO A 2 ? UNP O88898 ? ? 'expression tag' 2 2 1 5N2O LEU A 3 ? UNP O88898 ? ? 'expression tag' 3 3 1 5N2O GLY A 4 ? UNP O88898 ? ? 'expression tag' 4 4 1 5N2O SER A 5 ? UNP O88898 ? ? 'expression tag' 5 5 1 5N2O PHE A 14 ? UNP O88898 LEU 553 'engineered mutation' 14 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '3D HNCACB' 1 isotropic 2 1 1 '3D 1H-15N TOCSY' 2 isotropic 3 1 1 '3D 1H-15N NOESY' 2 isotropic 4 1 2 '2D 1H-1H NOESY' 2 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.pressure_units Pa _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label condition_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '350 uM [U-13C; U-15N] Tumor protein 63, 95% H2O/5% D2O' '95% H2O/5% D2O' 15N_13C_p63SAML514F solution ? 2 '350 uM Tumor protein 63, 100% D2O' '100% D2O' NA_p63SAML514F_D2Oex solution ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 AVANCE ? Bruker 600 ? 2 AVANCE ? Bruker 800 ? # _pdbx_nmr_refine.entry_id 5N2O _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 9 # _pdbx_nmr_ensemble.entry_id 5N2O _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 5N2O _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'target function' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 6 processing XwinNMR ? 'Bruker Biospin' 5 'peak picking' Sparky ? Goddard 4 'chemical shift assignment' Sparky ? Goddard 8 'chemical shift assignment' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 10 'data analysis' TALOS+ ? 'Cornilescu, Delaglio and Bax' 2 'structure calculation' CYANA 3.98 'Guntert, Mumenthaler and Wuthrich' 9 refinement OPALp ? 'Luginbuhl, Guntert, Billeter and Wuthrich' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5N2O _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 5N2O _struct.title 'Structure Of P63 SAM Domain L514F Mutant Causative Of AEC Syndrome' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5N2O _struct_keywords.text 'TRANSCRIPTION FACTOR, PROTEIN, transcription' _struct_keywords.pdbx_keywords TRANSCRIPTION # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 9 ? GLY A 18 ? SER A 9 GLY A 18 1 ? 10 HELX_P HELX_P2 AA2 SER A 20 ? GLY A 30 ? SER A 20 GLY A 30 1 ? 11 HELX_P HELX_P3 AA3 THR A 33 ? GLU A 38 ? THR A 33 GLU A 38 1 ? 6 HELX_P HELX_P4 AA4 SER A 41 ? LEU A 48 ? SER A 41 LEU A 48 1 ? 8 HELX_P HELX_P5 AA5 PRO A 51 ? HIS A 69 ? PRO A 51 HIS A 69 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 5N2O _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 5N2O _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 CYS 8 8 8 CYS CYS A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 PHE 13 13 13 PHE PHE A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 MET 42 42 42 MET MET A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 HIS 56 56 56 HIS HIS A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 TRP 59 59 59 TRP TRP A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 HIS 65 65 65 HIS HIS A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 HIS 69 69 69 HIS HIS A . n A 1 70 ASP 70 70 70 ASP ASP A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 5340 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-02-07 2 'Structure model' 1 1 2019-05-08 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_nmr_software 2 3 'Structure model' database_2 3 3 'Structure model' pdbx_database_status 4 3 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_nmr_software.name' 2 3 'Structure model' '_database_2.pdbx_DOI' 3 3 'Structure model' '_database_2.pdbx_database_accession' 4 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 5 3 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'Tumor protein 63' 350 ? uM '[U-13C; U-15N]' 2 'Tumor protein 63' 350 ? uM 'natural abundance' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 9 O A ASP 24 ? ? HG1 A THR 28 ? ? 1.60 2 18 OD2 A ASP 7 ? ? HG A SER 12 ? ? 1.54 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 11 _pdbx_validate_rmsd_angle.auth_atom_id_1 NE _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ARG _pdbx_validate_rmsd_angle.auth_seq_id_1 55 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CZ _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ARG _pdbx_validate_rmsd_angle.auth_seq_id_2 55 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 NH2 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ARG _pdbx_validate_rmsd_angle.auth_seq_id_3 55 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 117.13 _pdbx_validate_rmsd_angle.angle_target_value 120.30 _pdbx_validate_rmsd_angle.angle_deviation -3.17 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.50 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 6 ? ? -155.99 -37.13 2 1 SER A 20 ? ? -110.66 -85.13 3 2 SER A 5 ? ? -66.32 98.72 4 2 SER A 20 ? ? -110.94 -111.75 5 2 LEU A 31 ? ? -141.90 34.74 6 2 LEU A 48 ? ? -76.55 29.22 7 3 LEU A 3 ? ? -95.71 -91.26 8 3 SER A 20 ? ? -125.50 -105.45 9 3 LEU A 48 ? ? -70.76 23.85 10 4 SER A 20 ? ? -84.13 -82.77 11 5 SER A 20 ? ? -87.57 -71.89 12 6 LEU A 3 ? ? -161.43 117.35 13 6 SER A 20 ? ? -81.00 -100.51 14 7 SER A 5 ? ? 60.28 -0.49 15 7 CYS A 8 ? ? -105.81 77.85 16 7 SER A 20 ? ? -123.25 -93.55 17 8 SER A 20 ? ? -129.05 -110.21 18 8 LEU A 48 ? ? -82.57 35.28 19 9 ASP A 7 ? ? 38.02 56.55 20 9 SER A 20 ? ? -78.54 -93.17 21 9 LEU A 31 ? ? -141.45 29.08 22 9 LEU A 48 ? ? -75.30 27.83 23 10 SER A 20 ? ? -121.83 -65.35 24 10 LEU A 48 ? ? -75.97 23.09 25 11 SER A 20 ? ? -87.93 -92.09 26 11 SER A 41 ? ? -67.82 -177.31 27 11 PHE A 54 ? ? -131.45 -39.66 28 12 LEU A 3 ? ? 23.21 93.78 29 12 SER A 5 ? ? -79.97 -97.30 30 12 CYS A 8 ? ? -69.87 56.68 31 12 SER A 20 ? ? -140.82 -87.11 32 12 LEU A 48 ? ? -69.94 13.40 33 13 SER A 20 ? ? -124.57 -87.69 34 13 HIS A 69 ? ? -134.51 -135.46 35 14 SER A 9 ? ? 176.08 160.13 36 14 SER A 20 ? ? -118.90 -83.06 37 14 LEU A 48 ? ? -74.90 20.98 38 14 HIS A 69 ? ? 47.65 27.98 39 15 SER A 20 ? ? -135.12 -87.05 40 15 HIS A 69 ? ? 38.02 39.66 41 16 SER A 20 ? ? -129.87 -87.34 42 17 ASP A 7 ? ? -99.41 -94.65 43 17 LEU A 48 ? ? -75.91 27.15 44 17 LYS A 49 ? ? 69.13 -2.75 45 18 CYS A 8 ? ? -144.26 -7.39 46 18 SER A 20 ? ? -133.32 -66.64 47 19 SER A 20 ? ? -133.06 -90.10 48 20 SER A 20 ? ? -127.80 -101.38 49 20 HIS A 69 ? ? -160.17 116.78 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 7 ARG A 66 ? ? 0.098 'SIDE CHAIN' 2 8 TYR A 40 ? ? 0.068 'SIDE CHAIN' 3 8 ARG A 66 ? ? 0.083 'SIDE CHAIN' 4 9 TYR A 40 ? ? 0.153 'SIDE CHAIN' 5 11 ARG A 66 ? ? 0.098 'SIDE CHAIN' 6 15 TYR A 35 ? ? 0.093 'SIDE CHAIN' 7 16 TYR A 40 ? ? 0.072 'SIDE CHAIN' 8 17 TYR A 35 ? ? 0.075 'SIDE CHAIN' 9 19 ARG A 66 ? ? 0.085 'SIDE CHAIN' # _pdbx_audit_support.funding_organization 'German Research Foundation' _pdbx_audit_support.country Germany _pdbx_audit_support.grant_number 'DO 545/8-1' _pdbx_audit_support.ordinal 1 #