data_5N9U # _entry.id 5N9U # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.308 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5N9U WWPDB D_1200003209 BMRB 34105 # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Dehydroascorbate reductase 3A from Populus trichocarpa complexed with GSH.' _pdbx_database_related.db_id 34105 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5N9U _pdbx_database_status.recvd_initial_deposition_date 2017-02-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Roret, T.' 1 0000-0003-2528-5789 'Tsan, P.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochem.J. _citation.journal_id_ASTM BIJOAK _citation.journal_id_CSD 0043 _citation.journal_id_ISSN 0264-6021 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 473 _citation.language ? _citation.page_first 717 _citation.page_last 731 _citation.title ;Insights into ascorbate regeneration in plants: investigating the redox and structural properties of dehydroascorbate reductases from Populus trichocarpa. ; _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1042/BJ20151147 _citation.pdbx_database_id_PubMed 26699905 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lallement, P.A.' 1 ? primary 'Roret, T.' 2 ? primary 'Tsan, P.' 3 ? primary 'Gualberto, J.M.' 4 ? primary 'Girardet, J.M.' 5 ? primary 'Didierjean, C.' 6 ? primary 'Rouhier, N.' 7 ? primary 'Hecker, A.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Dehydroascorbate reductase family protein' 24364.195 1 ? ? ? ? 2 non-polymer syn GLUTATHIONE 307.323 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MALEICVKAAVGAPNILGDCPFCQRVLLSLEEKKIPYKSHLINLGDKPQWFLEISPEGKVPVVKIDDKWVADSDVIVGIL EEKNPEPPLATPPEFASVGSKIFPSFVKFLKSKDPNDGTEQALLEELKALDGHLKVHGPFIAGEKITAVDLSLAPKLYHL EVALGHFKNWPIPDNLTHVLNYIKLLFSRESFKKTRAAEEHVIAGWEPKVNAHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MALEICVKAAVGAPNILGDCPFCQRVLLSLEEKKIPYKSHLINLGDKPQWFLEISPEGKVPVVKIDDKWVADSDVIVGIL EEKNPEPPLATPPEFASVGSKIFPSFVKFLKSKDPNDGTEQALLEELKALDGHLKVHGPFIAGEKITAVDLSLAPKLYHL EVALGHFKNWPIPDNLTHVLNYIKLLFSRESFKKTRAAEEHVIAGWEPKVNAHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 LEU n 1 4 GLU n 1 5 ILE n 1 6 CYS n 1 7 VAL n 1 8 LYS n 1 9 ALA n 1 10 ALA n 1 11 VAL n 1 12 GLY n 1 13 ALA n 1 14 PRO n 1 15 ASN n 1 16 ILE n 1 17 LEU n 1 18 GLY n 1 19 ASP n 1 20 CYS n 1 21 PRO n 1 22 PHE n 1 23 CYS n 1 24 GLN n 1 25 ARG n 1 26 VAL n 1 27 LEU n 1 28 LEU n 1 29 SER n 1 30 LEU n 1 31 GLU n 1 32 GLU n 1 33 LYS n 1 34 LYS n 1 35 ILE n 1 36 PRO n 1 37 TYR n 1 38 LYS n 1 39 SER n 1 40 HIS n 1 41 LEU n 1 42 ILE n 1 43 ASN n 1 44 LEU n 1 45 GLY n 1 46 ASP n 1 47 LYS n 1 48 PRO n 1 49 GLN n 1 50 TRP n 1 51 PHE n 1 52 LEU n 1 53 GLU n 1 54 ILE n 1 55 SER n 1 56 PRO n 1 57 GLU n 1 58 GLY n 1 59 LYS n 1 60 VAL n 1 61 PRO n 1 62 VAL n 1 63 VAL n 1 64 LYS n 1 65 ILE n 1 66 ASP n 1 67 ASP n 1 68 LYS n 1 69 TRP n 1 70 VAL n 1 71 ALA n 1 72 ASP n 1 73 SER n 1 74 ASP n 1 75 VAL n 1 76 ILE n 1 77 VAL n 1 78 GLY n 1 79 ILE n 1 80 LEU n 1 81 GLU n 1 82 GLU n 1 83 LYS n 1 84 ASN n 1 85 PRO n 1 86 GLU n 1 87 PRO n 1 88 PRO n 1 89 LEU n 1 90 ALA n 1 91 THR n 1 92 PRO n 1 93 PRO n 1 94 GLU n 1 95 PHE n 1 96 ALA n 1 97 SER n 1 98 VAL n 1 99 GLY n 1 100 SER n 1 101 LYS n 1 102 ILE n 1 103 PHE n 1 104 PRO n 1 105 SER n 1 106 PHE n 1 107 VAL n 1 108 LYS n 1 109 PHE n 1 110 LEU n 1 111 LYS n 1 112 SER n 1 113 LYS n 1 114 ASP n 1 115 PRO n 1 116 ASN n 1 117 ASP n 1 118 GLY n 1 119 THR n 1 120 GLU n 1 121 GLN n 1 122 ALA n 1 123 LEU n 1 124 LEU n 1 125 GLU n 1 126 GLU n 1 127 LEU n 1 128 LYS n 1 129 ALA n 1 130 LEU n 1 131 ASP n 1 132 GLY n 1 133 HIS n 1 134 LEU n 1 135 LYS n 1 136 VAL n 1 137 HIS n 1 138 GLY n 1 139 PRO n 1 140 PHE n 1 141 ILE n 1 142 ALA n 1 143 GLY n 1 144 GLU n 1 145 LYS n 1 146 ILE n 1 147 THR n 1 148 ALA n 1 149 VAL n 1 150 ASP n 1 151 LEU n 1 152 SER n 1 153 LEU n 1 154 ALA n 1 155 PRO n 1 156 LYS n 1 157 LEU n 1 158 TYR n 1 159 HIS n 1 160 LEU n 1 161 GLU n 1 162 VAL n 1 163 ALA n 1 164 LEU n 1 165 GLY n 1 166 HIS n 1 167 PHE n 1 168 LYS n 1 169 ASN n 1 170 TRP n 1 171 PRO n 1 172 ILE n 1 173 PRO n 1 174 ASP n 1 175 ASN n 1 176 LEU n 1 177 THR n 1 178 HIS n 1 179 VAL n 1 180 LEU n 1 181 ASN n 1 182 TYR n 1 183 ILE n 1 184 LYS n 1 185 LEU n 1 186 LEU n 1 187 PHE n 1 188 SER n 1 189 ARG n 1 190 GLU n 1 191 SER n 1 192 PHE n 1 193 LYS n 1 194 LYS n 1 195 THR n 1 196 ARG n 1 197 ALA n 1 198 ALA n 1 199 GLU n 1 200 GLU n 1 201 HIS n 1 202 VAL n 1 203 ILE n 1 204 ALA n 1 205 GLY n 1 206 TRP n 1 207 GLU n 1 208 PRO n 1 209 LYS n 1 210 VAL n 1 211 ASN n 1 212 ALA n 1 213 HIS n 1 214 HIS n 1 215 HIS n 1 216 HIS n 1 217 HIS n 1 218 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 218 _entity_src_gen.gene_src_common_name 'Western balsam poplar' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene POPTR_0008s04920g _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Populus trichocarpa' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3694 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code B9HM36_POPTR _struct_ref.pdbx_db_accession B9HM36 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MALEICVKAAVGAPNILGDCPFCQRVLLSLEEKKIPYKSYLINLGDKPQWFLEISPEGKVPVVKIDDKWVADSDVIVGIL EEKNPEPPLATPPEFASVGSKIFPSFVKFLKSKDPNDGTEQALLEELKALDGHLKVHGPFIAGEKITAVDLSLAPKLYHL EVALGHFKNWTIPDNLTHVLNYIKLLFSRESFKKTRAAEEHVIAGWEPKVNA ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5N9U _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 212 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession B9HM36 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 212 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 212 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5N9U HIS A 40 ? UNP B9HM36 TYR 40 conflict 40 1 1 5N9U PRO A 171 ? UNP B9HM36 THR 171 conflict 171 2 1 5N9U HIS A 213 ? UNP B9HM36 ? ? 'expression tag' 213 3 1 5N9U HIS A 214 ? UNP B9HM36 ? ? 'expression tag' 214 4 1 5N9U HIS A 215 ? UNP B9HM36 ? ? 'expression tag' 215 5 1 5N9U HIS A 216 ? UNP B9HM36 ? ? 'expression tag' 216 6 1 5N9U HIS A 217 ? UNP B9HM36 ? ? 'expression tag' 217 7 1 5N9U HIS A 218 ? UNP B9HM36 ? ? 'expression tag' 218 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GSH non-polymer . GLUTATHIONE ? 'C10 H17 N3 O6 S' 307.323 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl.experiment_id 1 _pdbx_nmr_exptl.conditions_id 1 _pdbx_nmr_exptl.solution_id 1 _pdbx_nmr_exptl.type '2D 1H-15N HSQC' _pdbx_nmr_exptl.spectrometer_id 1 _pdbx_nmr_exptl.sample_state isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 8.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label condition_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '0.37 mM [U-100% 15N] Dehydroascorbate reductase, 90% H2O/10% D2O' '90% H2O/10% D2O' 15N solution ? 2 '0.37 mM [U-100% 15N] Dehydroascorbate reductase, 74.0 mM GLUTATHIONE, 90% H2O/10% D2O' '90% H2O/10% D2O' 15N solution ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model Avance _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 5N9U _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 5N9U _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 5N9U _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'target function' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement YASARA ? YASARA 2 'structure calculation' AutoDock ? AutoDock 3 'chemical shift assignment' 'CcpNmr Analysis' ? CCPN 4 'peak picking' 'CcpNmr Analysis' ? CCPN # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5N9U _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 5N9U _struct.title 'Dehydroascorbate reductase 3A from Populus trichocarpa complexed with GSH.' _struct.pdbx_descriptor 'Dehydroascorbate reductase family protein' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5N9U _struct_keywords.text 'Glutathione transferase, Dehydroascorbate reductase, Plant, Oxidoreductase' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 CYS A 20 ? LYS A 34 ? CYS A 20 LYS A 34 1 ? 15 HELX_P HELX_P2 AA2 PRO A 48 ? ILE A 54 ? PRO A 48 ILE A 54 5 ? 7 HELX_P HELX_P3 AA3 ASP A 72 ? GLU A 81 ? ASP A 72 GLU A 81 1 ? 10 HELX_P HELX_P4 AA4 GLU A 94 ? LEU A 110 ? GLU A 94 LEU A 110 1 ? 17 HELX_P HELX_P5 AA5 PRO A 115 ? GLY A 138 ? PRO A 115 GLY A 138 1 ? 24 HELX_P HELX_P6 AA6 THR A 147 ? HIS A 166 ? THR A 147 HIS A 166 1 ? 20 HELX_P HELX_P7 AA7 HIS A 178 ? PHE A 187 ? HIS A 178 PHE A 187 1 ? 10 HELX_P HELX_P8 AA8 PHE A 192 ? ARG A 196 ? PHE A 192 ARG A 196 5 ? 5 HELX_P HELX_P9 AA9 ALA A 198 ? ALA A 212 ? ALA A 198 ALA A 212 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag one _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 20 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id GSH _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id SG2 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 20 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id GSH _struct_conn.ptnr2_auth_seq_id 301 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.025 _struct_conn.pdbx_value_order ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 VAL 60 A . ? VAL 60 A PRO 61 A ? PRO 61 A 1 -10.91 2 VAL 60 A . ? VAL 60 A PRO 61 A ? PRO 61 A 2 -11.36 3 VAL 60 A . ? VAL 60 A PRO 61 A ? PRO 61 A 3 -6.68 4 VAL 60 A . ? VAL 60 A PRO 61 A ? PRO 61 A 4 -10.00 5 VAL 60 A . ? VAL 60 A PRO 61 A ? PRO 61 A 5 -10.80 6 VAL 60 A . ? VAL 60 A PRO 61 A ? PRO 61 A 6 -9.64 7 VAL 60 A . ? VAL 60 A PRO 61 A ? PRO 61 A 7 -8.01 8 VAL 60 A . ? VAL 60 A PRO 61 A ? PRO 61 A 8 -7.33 9 VAL 60 A . ? VAL 60 A PRO 61 A ? PRO 61 A 9 -12.43 10 VAL 60 A . ? VAL 60 A PRO 61 A ? PRO 61 A 10 -13.90 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 38 ? ILE A 42 ? LYS A 38 ILE A 42 AA1 2 LEU A 3 ? LYS A 8 ? LEU A 3 LYS A 8 AA1 3 VAL A 62 ? ILE A 65 ? VAL A 62 ILE A 65 AA1 4 LYS A 68 ? ALA A 71 ? LYS A 68 ALA A 71 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ILE A 42 ? O ILE A 42 N VAL A 7 ? N VAL A 7 AA1 2 3 N GLU A 4 ? N GLU A 4 O LYS A 64 ? O LYS A 64 AA1 3 4 N ILE A 65 ? N ILE A 65 O LYS A 68 ? O LYS A 68 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id GSH _struct_site.pdbx_auth_seq_id 301 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 9 _struct_site.details 'binding site for residue GSH A 301' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 9 CYS A 20 ? CYS A 20 . ? 1_555 ? 2 AC1 9 PHE A 22 ? PHE A 22 . ? 1_555 ? 3 AC1 9 LEU A 44 ? LEU A 44 . ? 1_555 ? 4 AC1 9 LYS A 47 ? LYS A 47 . ? 1_555 ? 5 AC1 9 LYS A 59 ? LYS A 59 . ? 1_555 ? 6 AC1 9 VAL A 60 ? VAL A 60 . ? 1_555 ? 7 AC1 9 PRO A 61 ? PRO A 61 . ? 1_555 ? 8 AC1 9 ASP A 72 ? ASP A 72 . ? 1_555 ? 9 AC1 9 SER A 73 ? SER A 73 . ? 1_555 ? # _atom_sites.entry_id 5N9U _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 CYS 23 23 23 CYS CYS A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 HIS 40 40 40 HIS HIS A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 TRP 50 50 50 TRP TRP A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 TRP 69 69 69 TRP TRP A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 ASN 84 84 84 ASN ASN A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 PHE 95 95 95 PHE PHE A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 ILE 102 102 102 ILE ILE A . n A 1 103 PHE 103 103 103 PHE PHE A . n A 1 104 PRO 104 104 104 PRO PRO A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 PHE 106 106 106 PHE PHE A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 PHE 109 109 109 PHE PHE A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 SER 112 112 112 SER SER A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 ASP 114 114 114 ASP ASP A . n A 1 115 PRO 115 115 115 PRO PRO A . n A 1 116 ASN 116 116 116 ASN ASN A . n A 1 117 ASP 117 117 117 ASP ASP A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 THR 119 119 119 THR THR A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 GLN 121 121 121 GLN GLN A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 GLU 125 125 125 GLU GLU A . n A 1 126 GLU 126 126 126 GLU GLU A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 LYS 128 128 128 LYS LYS A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 ASP 131 131 131 ASP ASP A . n A 1 132 GLY 132 132 132 GLY GLY A . n A 1 133 HIS 133 133 133 HIS HIS A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 LYS 135 135 135 LYS LYS A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 HIS 137 137 137 HIS HIS A . n A 1 138 GLY 138 138 138 GLY GLY A . n A 1 139 PRO 139 139 139 PRO PRO A . n A 1 140 PHE 140 140 140 PHE PHE A . n A 1 141 ILE 141 141 141 ILE ILE A . n A 1 142 ALA 142 142 142 ALA ALA A . n A 1 143 GLY 143 143 143 GLY GLY A . n A 1 144 GLU 144 144 144 GLU GLU A . n A 1 145 LYS 145 145 145 LYS LYS A . n A 1 146 ILE 146 146 146 ILE ILE A . n A 1 147 THR 147 147 147 THR THR A . n A 1 148 ALA 148 148 148 ALA ALA A . n A 1 149 VAL 149 149 149 VAL VAL A . n A 1 150 ASP 150 150 150 ASP ASP A . n A 1 151 LEU 151 151 151 LEU LEU A . n A 1 152 SER 152 152 152 SER SER A . n A 1 153 LEU 153 153 153 LEU LEU A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 PRO 155 155 155 PRO PRO A . n A 1 156 LYS 156 156 156 LYS LYS A . n A 1 157 LEU 157 157 157 LEU LEU A . n A 1 158 TYR 158 158 158 TYR TYR A . n A 1 159 HIS 159 159 159 HIS HIS A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 GLU 161 161 161 GLU GLU A . n A 1 162 VAL 162 162 162 VAL VAL A . n A 1 163 ALA 163 163 163 ALA ALA A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 GLY 165 165 165 GLY GLY A . n A 1 166 HIS 166 166 166 HIS HIS A . n A 1 167 PHE 167 167 167 PHE PHE A . n A 1 168 LYS 168 168 168 LYS LYS A . n A 1 169 ASN 169 169 169 ASN ASN A . n A 1 170 TRP 170 170 170 TRP TRP A . n A 1 171 PRO 171 171 171 PRO PRO A . n A 1 172 ILE 172 172 172 ILE ILE A . n A 1 173 PRO 173 173 173 PRO PRO A . n A 1 174 ASP 174 174 174 ASP ASP A . n A 1 175 ASN 175 175 175 ASN ASN A . n A 1 176 LEU 176 176 176 LEU LEU A . n A 1 177 THR 177 177 177 THR THR A . n A 1 178 HIS 178 178 178 HIS HIS A . n A 1 179 VAL 179 179 179 VAL VAL A . n A 1 180 LEU 180 180 180 LEU LEU A . n A 1 181 ASN 181 181 181 ASN ASN A . n A 1 182 TYR 182 182 182 TYR TYR A . n A 1 183 ILE 183 183 183 ILE ILE A . n A 1 184 LYS 184 184 184 LYS LYS A . n A 1 185 LEU 185 185 185 LEU LEU A . n A 1 186 LEU 186 186 186 LEU LEU A . n A 1 187 PHE 187 187 187 PHE PHE A . n A 1 188 SER 188 188 188 SER SER A . n A 1 189 ARG 189 189 189 ARG ARG A . n A 1 190 GLU 190 190 190 GLU GLU A . n A 1 191 SER 191 191 191 SER SER A . n A 1 192 PHE 192 192 192 PHE PHE A . n A 1 193 LYS 193 193 193 LYS LYS A . n A 1 194 LYS 194 194 194 LYS LYS A . n A 1 195 THR 195 195 195 THR THR A . n A 1 196 ARG 196 196 196 ARG ARG A . n A 1 197 ALA 197 197 197 ALA ALA A . n A 1 198 ALA 198 198 198 ALA ALA A . n A 1 199 GLU 199 199 199 GLU GLU A . n A 1 200 GLU 200 200 200 GLU GLU A . n A 1 201 HIS 201 201 201 HIS HIS A . n A 1 202 VAL 202 202 202 VAL VAL A . n A 1 203 ILE 203 203 203 ILE ILE A . n A 1 204 ALA 204 204 204 ALA ALA A . n A 1 205 GLY 205 205 205 GLY GLY A . n A 1 206 TRP 206 206 206 TRP TRP A . n A 1 207 GLU 207 207 207 GLU GLU A . n A 1 208 PRO 208 208 208 PRO PRO A . n A 1 209 LYS 209 209 209 LYS LYS A . n A 1 210 VAL 210 210 210 VAL VAL A . n A 1 211 ASN 211 211 211 ASN ASN A . n A 1 212 ALA 212 212 212 ALA ALA A . n A 1 213 HIS 213 213 ? ? ? A . n A 1 214 HIS 214 214 ? ? ? A . n A 1 215 HIS 215 215 ? ? ? A . n A 1 216 HIS 216 216 ? ? ? A . n A 1 217 HIS 217 217 ? ? ? A . n A 1 218 HIS 218 218 ? ? ? A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id GSH _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 301 _pdbx_nonpoly_scheme.auth_seq_num 306 _pdbx_nonpoly_scheme.pdb_mon_id GSH _pdbx_nonpoly_scheme.auth_mon_id GSH _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 590 ? 1 MORE -5 ? 1 'SSA (A^2)' 10420 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-03-08 2 'Structure model' 1 1 2019-05-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Data collection' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 2 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category pdbx_nmr_software # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 2 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_nmr_software.name' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'Dehydroascorbate reductase' 0.37 ? mM '[U-100% 15N]' 2 'Dehydroascorbate reductase' 0.37 ? mM '[U-100% 15N]' 2 GLUTATHIONE 74.0 ? mM 'natural abundance' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE1 A GLU 32 ? ? HG A SER 191 ? ? 1.54 2 1 HG A SER 73 ? ? O11 A GSH 301 ? ? 1.54 3 1 HH A TYR 158 ? ? OE2 A GLU 199 ? ? 1.60 4 2 HG A SER 73 ? ? O11 A GSH 301 ? ? 1.57 5 4 HG A SER 73 ? ? O11 A GSH 301 ? ? 1.54 6 4 HG A SER 29 ? ? OE2 A GLU 81 ? ? 1.56 7 4 OE1 A GLU 32 ? ? HG A SER 191 ? ? 1.58 8 5 HG A SER 73 ? ? O11 A GSH 301 ? ? 1.53 9 5 OE1 A GLU 32 ? ? HG A SER 191 ? ? 1.60 10 6 HG A SER 73 ? ? O11 A GSH 301 ? ? 1.51 11 6 HG A SER 55 ? ? OE2 A GLU 57 ? ? 1.57 12 6 OE1 A GLU 32 ? ? HG A SER 191 ? ? 1.58 13 7 HG A SER 73 ? ? O11 A GSH 301 ? ? 1.54 14 7 OE1 A GLU 32 ? ? HG A SER 191 ? ? 1.59 15 8 HG A SER 55 ? ? OE2 A GLU 57 ? ? 1.54 16 8 HG A SER 73 ? ? O11 A GSH 301 ? ? 1.56 17 8 OE1 A GLU 32 ? ? HG A SER 191 ? ? 1.59 18 9 HG A SER 73 ? ? O11 A GSH 301 ? ? 1.55 19 9 OE1 A GLU 32 ? ? HG A SER 191 ? ? 1.59 20 10 HG A SER 73 ? ? O11 A GSH 301 ? ? 1.51 21 10 OE1 A GLU 32 ? ? HG A SER 191 ? ? 1.58 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 6 NE A ARG 25 ? ? CZ A ARG 25 ? ? NH2 A ARG 25 ? ? 123.83 120.30 3.53 0.50 N 2 7 NE A ARG 25 ? ? CZ A ARG 25 ? ? NH2 A ARG 25 ? ? 123.43 120.30 3.13 0.50 N 3 9 NE A ARG 25 ? ? CZ A ARG 25 ? ? NH2 A ARG 25 ? ? 123.51 120.30 3.21 0.50 N 4 10 NE A ARG 25 ? ? CZ A ARG 25 ? ? NH2 A ARG 25 ? ? 123.51 120.30 3.21 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 2 ? ? 59.64 -177.53 2 1 ASP A 19 ? ? -59.11 98.22 3 1 LYS A 34 ? ? 59.64 19.56 4 1 ASP A 67 ? ? 66.89 -7.97 5 1 ASP A 72 ? ? 67.01 114.07 6 1 ALA A 90 ? ? -72.88 41.89 7 1 PHE A 167 ? ? -141.50 -27.18 8 1 ASN A 169 ? ? -65.90 75.85 9 1 ARG A 189 ? ? 59.74 171.88 10 2 ALA A 2 ? ? 58.63 -161.51 11 2 ALA A 13 ? ? -119.96 67.85 12 2 ASP A 19 ? ? -56.61 107.96 13 2 ASP A 46 ? ? -105.58 47.77 14 2 ASP A 67 ? ? 67.19 -8.74 15 2 ASP A 72 ? ? 66.44 108.79 16 2 LYS A 83 ? ? -93.71 59.22 17 2 LYS A 111 ? ? -146.78 38.56 18 2 VAL A 162 ? ? -94.21 -72.24 19 2 ASN A 169 ? ? -68.35 80.68 20 2 ARG A 189 ? ? 57.11 -166.31 21 3 ALA A 2 ? ? 60.22 -174.71 22 3 CYS A 20 ? ? -163.18 95.07 23 3 LYS A 34 ? ? 46.85 22.30 24 3 LEU A 44 ? ? -58.86 0.83 25 3 ASP A 67 ? ? 71.65 -0.31 26 3 ASP A 72 ? ? 58.77 122.65 27 3 ASN A 169 ? ? -66.91 85.24 28 3 ARG A 189 ? ? 60.66 177.12 29 3 ARG A 196 ? ? -64.43 86.21 30 4 ALA A 2 ? ? 63.62 -178.25 31 4 ASN A 43 ? ? -75.99 49.87 32 4 LEU A 44 ? ? -60.40 3.07 33 4 ASP A 46 ? ? -101.98 67.46 34 4 ASP A 72 ? ? 65.54 115.65 35 4 LYS A 111 ? ? -142.56 36.58 36 4 ASN A 169 ? ? -64.19 89.27 37 4 ARG A 189 ? ? 54.88 -169.15 38 4 ARG A 196 ? ? -68.91 75.93 39 5 ALA A 2 ? ? 63.57 178.40 40 5 CYS A 20 ? ? -165.07 97.86 41 5 LEU A 44 ? ? -59.14 4.59 42 5 ASP A 72 ? ? 65.11 113.62 43 5 ALA A 90 ? ? -69.55 46.33 44 5 SER A 112 ? ? -68.46 56.47 45 5 ASN A 169 ? ? -61.38 90.02 46 5 ARG A 189 ? ? 53.97 -162.27 47 5 ARG A 196 ? ? -65.45 89.49 48 6 ALA A 2 ? ? 64.03 177.91 49 6 ALA A 13 ? ? -119.13 69.03 50 6 LEU A 44 ? ? -65.05 0.70 51 6 ASP A 72 ? ? 67.57 113.45 52 6 ALA A 90 ? ? -70.49 49.17 53 6 LYS A 111 ? ? -142.31 41.03 54 6 SER A 112 ? ? -68.60 59.73 55 6 LYS A 135 ? ? -68.50 0.93 56 6 ASN A 169 ? ? -61.58 86.03 57 6 ILE A 172 ? ? -59.36 108.34 58 6 LEU A 176 ? ? -87.25 49.68 59 6 ARG A 189 ? ? 54.12 -159.72 60 6 ARG A 196 ? ? -67.24 83.31 61 7 ALA A 2 ? ? 62.45 -178.63 62 7 ALA A 13 ? ? -117.61 69.03 63 7 ASP A 19 ? ? -59.61 108.20 64 7 LYS A 34 ? ? 59.81 16.54 65 7 LEU A 44 ? ? -62.01 8.33 66 7 ASP A 46 ? ? -102.74 72.47 67 7 LYS A 64 ? ? -105.74 78.72 68 7 ASP A 72 ? ? 66.55 113.19 69 7 LYS A 111 ? ? -142.63 38.55 70 7 VAL A 162 ? ? -90.56 -62.82 71 7 ASN A 169 ? ? -65.30 83.78 72 7 ILE A 172 ? ? -55.39 109.32 73 7 LEU A 176 ? ? -87.06 47.88 74 7 ARG A 189 ? ? 55.09 -161.95 75 7 ARG A 196 ? ? -67.32 86.23 76 8 ALA A 2 ? ? 60.52 -168.49 77 8 ASP A 19 ? ? -56.96 105.40 78 8 LYS A 34 ? ? 58.03 18.80 79 8 ASP A 46 ? ? -116.42 54.15 80 8 LYS A 64 ? ? -119.85 73.47 81 8 ASP A 72 ? ? 65.69 111.48 82 8 VAL A 162 ? ? -96.87 -62.66 83 8 ASN A 169 ? ? -67.99 78.74 84 8 ARG A 189 ? ? 56.46 -164.33 85 9 ALA A 2 ? ? 59.02 -173.64 86 9 ASP A 19 ? ? -57.78 104.28 87 9 LEU A 44 ? ? -61.42 1.79 88 9 ASP A 67 ? ? 67.54 -5.84 89 9 ASP A 72 ? ? 66.08 111.17 90 9 LYS A 83 ? ? -97.06 58.98 91 9 LYS A 111 ? ? -141.78 42.50 92 9 VAL A 162 ? ? -87.64 -75.51 93 9 ASN A 169 ? ? -67.96 78.15 94 9 ARG A 189 ? ? 56.77 -167.62 95 10 ALA A 2 ? ? 60.23 -175.90 96 10 ASP A 19 ? ? -59.06 105.29 97 10 LYS A 34 ? ? 58.65 19.58 98 10 LEU A 44 ? ? -63.51 1.77 99 10 ASP A 67 ? ? 68.65 -6.75 100 10 ASP A 72 ? ? 67.04 110.58 101 10 LYS A 83 ? ? -104.92 64.45 102 10 ALA A 90 ? ? -72.80 49.53 103 10 LYS A 111 ? ? -144.64 39.53 104 10 LYS A 135 ? ? -65.36 0.59 105 10 VAL A 162 ? ? -89.64 -70.72 106 10 ASN A 169 ? ? -68.34 78.93 107 10 ARG A 189 ? ? 57.17 -163.67 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 ASP A 19 ? ? CYS A 20 ? ? 142.41 2 2 ASP A 19 ? ? CYS A 20 ? ? 139.84 3 3 GLY A 138 ? ? PRO A 139 ? ? -146.99 4 4 ASP A 19 ? ? CYS A 20 ? ? 141.48 5 4 ASN A 43 ? ? LEU A 44 ? ? -148.08 6 4 GLY A 138 ? ? PRO A 139 ? ? -119.09 7 5 GLY A 138 ? ? PRO A 139 ? ? -114.94 8 5 PRO A 171 ? ? ILE A 172 ? ? 149.80 9 6 ASP A 19 ? ? CYS A 20 ? ? 139.30 10 6 ASP A 114 ? ? PRO A 115 ? ? -148.84 11 6 GLY A 138 ? ? PRO A 139 ? ? -119.56 12 6 PRO A 171 ? ? ILE A 172 ? ? 142.57 13 7 ASP A 19 ? ? CYS A 20 ? ? 144.76 14 7 ASP A 114 ? ? PRO A 115 ? ? -144.84 15 7 GLY A 138 ? ? PRO A 139 ? ? -108.65 16 8 ASP A 19 ? ? CYS A 20 ? ? 140.51 17 8 ASP A 114 ? ? PRO A 115 ? ? -143.39 18 8 GLY A 138 ? ? PRO A 139 ? ? -119.99 19 9 ASP A 19 ? ? CYS A 20 ? ? 136.71 20 9 ASP A 114 ? ? PRO A 115 ? ? -147.52 21 10 ASP A 19 ? ? CYS A 20 ? ? 135.88 # loop_ _pdbx_validate_main_chain_plane.id _pdbx_validate_main_chain_plane.PDB_model_num _pdbx_validate_main_chain_plane.auth_comp_id _pdbx_validate_main_chain_plane.auth_asym_id _pdbx_validate_main_chain_plane.auth_seq_id _pdbx_validate_main_chain_plane.PDB_ins_code _pdbx_validate_main_chain_plane.label_alt_id _pdbx_validate_main_chain_plane.improper_torsion_angle 1 1 SER A 105 ? ? -10.12 2 1 ASN A 116 ? ? -11.22 3 2 GLN A 49 ? ? -10.77 4 2 SER A 105 ? ? -10.87 5 3 GLY A 138 ? ? 10.67 6 4 ASP A 46 ? ? 10.12 7 4 GLN A 49 ? ? -11.19 8 4 SER A 105 ? ? -10.46 9 4 GLY A 138 ? ? 10.74 10 4 LYS A 184 ? ? -10.36 11 5 PRO A 173 ? ? -10.65 12 6 SER A 105 ? ? -10.63 13 6 GLY A 138 ? ? 10.36 14 6 PRO A 173 ? ? -10.28 15 7 SER A 105 ? ? -10.68 16 7 GLY A 138 ? ? 10.23 17 8 ASP A 46 ? ? 10.83 18 8 SER A 105 ? ? -10.48 19 8 ASP A 114 ? ? 10.35 20 8 GLY A 138 ? ? 13.06 21 8 PRO A 173 ? ? -10.85 22 9 ASP A 46 ? ? 10.16 23 9 SER A 105 ? ? -10.54 24 9 PRO A 173 ? ? -10.85 25 10 ASP A 46 ? ? 10.47 26 10 SER A 105 ? ? -10.80 27 10 PRO A 173 ? ? -10.29 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 GLU A 4 ? ? 0.095 'SIDE CHAIN' 2 1 ASP A 19 ? ? 0.099 'SIDE CHAIN' 3 1 ARG A 25 ? ? 0.097 'SIDE CHAIN' 4 1 GLU A 57 ? ? 0.101 'SIDE CHAIN' 5 1 ASP A 66 ? ? 0.108 'SIDE CHAIN' 6 1 ASP A 72 ? ? 0.082 'SIDE CHAIN' 7 1 GLU A 82 ? ? 0.093 'SIDE CHAIN' 8 1 GLU A 94 ? ? 0.095 'SIDE CHAIN' 9 1 ASP A 114 ? ? 0.103 'SIDE CHAIN' 10 1 ASP A 117 ? ? 0.075 'SIDE CHAIN' 11 1 GLU A 126 ? ? 0.077 'SIDE CHAIN' 12 1 GLU A 199 ? ? 0.109 'SIDE CHAIN' 13 2 GLU A 31 ? ? 0.088 'SIDE CHAIN' 14 2 ASP A 72 ? ? 0.092 'SIDE CHAIN' 15 2 ASP A 74 ? ? 0.096 'SIDE CHAIN' 16 2 GLU A 82 ? ? 0.082 'SIDE CHAIN' 17 2 ASP A 114 ? ? 0.110 'SIDE CHAIN' 18 2 ASP A 117 ? ? 0.100 'SIDE CHAIN' 19 2 GLU A 126 ? ? 0.072 'SIDE CHAIN' 20 3 ASP A 19 ? ? 0.085 'SIDE CHAIN' 21 3 GLU A 31 ? ? 0.081 'SIDE CHAIN' 22 3 GLU A 57 ? ? 0.075 'SIDE CHAIN' 23 3 ASP A 66 ? ? 0.078 'SIDE CHAIN' 24 3 ASP A 72 ? ? 0.098 'SIDE CHAIN' 25 3 ASP A 74 ? ? 0.097 'SIDE CHAIN' 26 3 ASP A 114 ? ? 0.105 'SIDE CHAIN' 27 3 GLU A 126 ? ? 0.082 'SIDE CHAIN' 28 3 GLU A 190 ? ? 0.111 'SIDE CHAIN' 29 4 ASP A 19 ? ? 0.081 'SIDE CHAIN' 30 4 GLU A 31 ? ? 0.088 'SIDE CHAIN' 31 4 GLU A 57 ? ? 0.099 'SIDE CHAIN' 32 4 ASP A 66 ? ? 0.104 'SIDE CHAIN' 33 4 ASP A 72 ? ? 0.094 'SIDE CHAIN' 34 4 ASP A 74 ? ? 0.089 'SIDE CHAIN' 35 4 GLU A 82 ? ? 0.072 'SIDE CHAIN' 36 4 ASP A 114 ? ? 0.107 'SIDE CHAIN' 37 4 ASP A 117 ? ? 0.076 'SIDE CHAIN' 38 4 GLU A 126 ? ? 0.088 'SIDE CHAIN' 39 5 GLU A 31 ? ? 0.091 'SIDE CHAIN' 40 5 GLU A 57 ? ? 0.096 'SIDE CHAIN' 41 5 ASP A 66 ? ? 0.103 'SIDE CHAIN' 42 5 ASP A 72 ? ? 0.090 'SIDE CHAIN' 43 5 ASP A 74 ? ? 0.096 'SIDE CHAIN' 44 5 GLU A 82 ? ? 0.076 'SIDE CHAIN' 45 5 ASP A 114 ? ? 0.102 'SIDE CHAIN' 46 5 GLU A 126 ? ? 0.084 'SIDE CHAIN' 47 5 GLU A 190 ? ? 0.078 'SIDE CHAIN' 48 5 GLU A 200 ? ? 0.072 'SIDE CHAIN' 49 6 GLU A 4 ? ? 0.118 'SIDE CHAIN' 50 6 ASP A 19 ? ? 0.078 'SIDE CHAIN' 51 6 GLU A 31 ? ? 0.097 'SIDE CHAIN' 52 6 ASP A 66 ? ? 0.110 'SIDE CHAIN' 53 6 ASP A 72 ? ? 0.075 'SIDE CHAIN' 54 6 ASP A 74 ? ? 0.095 'SIDE CHAIN' 55 6 GLU A 81 ? ? 0.088 'SIDE CHAIN' 56 6 GLU A 82 ? ? 0.108 'SIDE CHAIN' 57 6 ASP A 114 ? ? 0.108 'SIDE CHAIN' 58 6 GLU A 190 ? ? 0.078 'SIDE CHAIN' 59 7 GLU A 4 ? ? 0.075 'SIDE CHAIN' 60 7 ASP A 19 ? ? 0.083 'SIDE CHAIN' 61 7 GLU A 31 ? ? 0.095 'SIDE CHAIN' 62 7 GLU A 57 ? ? 0.101 'SIDE CHAIN' 63 7 ASP A 66 ? ? 0.098 'SIDE CHAIN' 64 7 ASP A 72 ? ? 0.085 'SIDE CHAIN' 65 7 ASP A 74 ? ? 0.094 'SIDE CHAIN' 66 7 GLU A 82 ? ? 0.078 'SIDE CHAIN' 67 7 ASP A 114 ? ? 0.104 'SIDE CHAIN' 68 7 ASP A 117 ? ? 0.091 'SIDE CHAIN' 69 7 GLU A 190 ? ? 0.080 'SIDE CHAIN' 70 8 ASP A 19 ? ? 0.075 'SIDE CHAIN' 71 8 GLU A 31 ? ? 0.094 'SIDE CHAIN' 72 8 GLU A 57 ? ? 0.077 'SIDE CHAIN' 73 8 ASP A 67 ? ? 0.082 'SIDE CHAIN' 74 8 ASP A 72 ? ? 0.095 'SIDE CHAIN' 75 8 ASP A 74 ? ? 0.100 'SIDE CHAIN' 76 8 GLU A 82 ? ? 0.071 'SIDE CHAIN' 77 8 ASP A 114 ? ? 0.107 'SIDE CHAIN' 78 8 GLU A 190 ? ? 0.075 'SIDE CHAIN' 79 9 ASP A 19 ? ? 0.090 'SIDE CHAIN' 80 9 GLU A 57 ? ? 0.103 'SIDE CHAIN' 81 9 ASP A 72 ? ? 0.092 'SIDE CHAIN' 82 9 ASP A 74 ? ? 0.097 'SIDE CHAIN' 83 9 ASP A 114 ? ? 0.113 'SIDE CHAIN' 84 9 ASP A 117 ? ? 0.095 'SIDE CHAIN' 85 9 GLU A 126 ? ? 0.072 'SIDE CHAIN' 86 10 ASP A 19 ? ? 0.105 'SIDE CHAIN' 87 10 GLU A 57 ? ? 0.102 'SIDE CHAIN' 88 10 ASP A 72 ? ? 0.096 'SIDE CHAIN' 89 10 ASP A 74 ? ? 0.096 'SIDE CHAIN' 90 10 GLU A 94 ? ? 0.081 'SIDE CHAIN' 91 10 ASP A 114 ? ? 0.112 'SIDE CHAIN' 92 10 ASP A 117 ? ? 0.095 'SIDE CHAIN' 93 10 GLU A 126 ? ? 0.070 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 213 ? A HIS 213 2 1 Y 1 A HIS 214 ? A HIS 214 3 1 Y 1 A HIS 215 ? A HIS 215 4 1 Y 1 A HIS 216 ? A HIS 216 5 1 Y 1 A HIS 217 ? A HIS 217 6 1 Y 1 A HIS 218 ? A HIS 218 7 2 Y 1 A HIS 213 ? A HIS 213 8 2 Y 1 A HIS 214 ? A HIS 214 9 2 Y 1 A HIS 215 ? A HIS 215 10 2 Y 1 A HIS 216 ? A HIS 216 11 2 Y 1 A HIS 217 ? A HIS 217 12 2 Y 1 A HIS 218 ? A HIS 218 13 3 Y 1 A HIS 213 ? A HIS 213 14 3 Y 1 A HIS 214 ? A HIS 214 15 3 Y 1 A HIS 215 ? A HIS 215 16 3 Y 1 A HIS 216 ? A HIS 216 17 3 Y 1 A HIS 217 ? A HIS 217 18 3 Y 1 A HIS 218 ? A HIS 218 19 4 Y 1 A HIS 213 ? A HIS 213 20 4 Y 1 A HIS 214 ? A HIS 214 21 4 Y 1 A HIS 215 ? A HIS 215 22 4 Y 1 A HIS 216 ? A HIS 216 23 4 Y 1 A HIS 217 ? A HIS 217 24 4 Y 1 A HIS 218 ? A HIS 218 25 5 Y 1 A HIS 213 ? A HIS 213 26 5 Y 1 A HIS 214 ? A HIS 214 27 5 Y 1 A HIS 215 ? A HIS 215 28 5 Y 1 A HIS 216 ? A HIS 216 29 5 Y 1 A HIS 217 ? A HIS 217 30 5 Y 1 A HIS 218 ? A HIS 218 31 6 Y 1 A HIS 213 ? A HIS 213 32 6 Y 1 A HIS 214 ? A HIS 214 33 6 Y 1 A HIS 215 ? A HIS 215 34 6 Y 1 A HIS 216 ? A HIS 216 35 6 Y 1 A HIS 217 ? A HIS 217 36 6 Y 1 A HIS 218 ? A HIS 218 37 7 Y 1 A HIS 213 ? A HIS 213 38 7 Y 1 A HIS 214 ? A HIS 214 39 7 Y 1 A HIS 215 ? A HIS 215 40 7 Y 1 A HIS 216 ? A HIS 216 41 7 Y 1 A HIS 217 ? A HIS 217 42 7 Y 1 A HIS 218 ? A HIS 218 43 8 Y 1 A HIS 213 ? A HIS 213 44 8 Y 1 A HIS 214 ? A HIS 214 45 8 Y 1 A HIS 215 ? A HIS 215 46 8 Y 1 A HIS 216 ? A HIS 216 47 8 Y 1 A HIS 217 ? A HIS 217 48 8 Y 1 A HIS 218 ? A HIS 218 49 9 Y 1 A HIS 213 ? A HIS 213 50 9 Y 1 A HIS 214 ? A HIS 214 51 9 Y 1 A HIS 215 ? A HIS 215 52 9 Y 1 A HIS 216 ? A HIS 216 53 9 Y 1 A HIS 217 ? A HIS 217 54 9 Y 1 A HIS 218 ? A HIS 218 55 10 Y 1 A HIS 213 ? A HIS 213 56 10 Y 1 A HIS 214 ? A HIS 214 57 10 Y 1 A HIS 215 ? A HIS 215 58 10 Y 1 A HIS 216 ? A HIS 216 59 10 Y 1 A HIS 217 ? A HIS 217 60 10 Y 1 A HIS 218 ? A HIS 218 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name GLUTATHIONE _pdbx_entity_nonpoly.comp_id GSH # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 'mass spectrometry' Monomeric 2 1 'gel filtration' Monomeric #