data_5NBB # _entry.id 5NBB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.394 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5NBB pdb_00005nbb 10.2210/pdb5nbb/pdb WWPDB D_1200003822 ? ? BMRB 34111 ? 10.13018/BMR34111 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-05-03 2 'Structure model' 1 1 2017-05-31 3 'Structure model' 1 2 2017-08-30 4 'Structure model' 1 3 2019-05-08 5 'Structure model' 1 4 2024-06-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Structure summary' 2 3 'Structure model' 'Author supporting evidence' 3 4 'Structure model' 'Data collection' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' pdbx_audit_support 2 4 'Structure model' pdbx_nmr_software 3 5 'Structure model' chem_comp_atom 4 5 'Structure model' chem_comp_bond 5 5 'Structure model' database_2 6 5 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_audit_support.funding_organization' 2 4 'Structure model' '_pdbx_nmr_software.name' 3 5 'Structure model' '_database_2.pdbx_DOI' 4 5 'Structure model' '_database_2.pdbx_database_accession' 5 5 'Structure model' '_pdbx_nmr_spectrometer.model' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5NBB _pdbx_database_status.recvd_initial_deposition_date 2017-03-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Structure of the N-terminal domain of the Escherichia Coli ProQ RNA binding protein' _pdbx_database_related.db_id 34111 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Gonzales, G.' 1 ? 'Hardwick, S.' 2 ? 'Maslen, S.' 3 ? 'Skehel, M.' 4 ? 'Holmqvist, E.' 5 ? 'Vogel, J.' 6 ? 'Bateman, A.' 7 ? 'Luisi, B.' 8 ? 'Broadhurst, R.' 9 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev RNA _citation.journal_id_ASTM RNARFU _citation.journal_id_CSD 2122 _citation.journal_id_ISSN 1469-9001 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 23 _citation.language ? _citation.page_first 696 _citation.page_last 711 _citation.title 'Structure of the Escherichia coli ProQ RNA-binding protein.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1261/rna.060343.116 _citation.pdbx_database_id_PubMed 28193673 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gonzalez, G.M.' 1 ? primary 'Hardwick, S.W.' 2 ? primary 'Maslen, S.L.' 3 ? primary 'Skehel, J.M.' 4 ? primary 'Holmqvist, E.' 5 ? primary 'Vogel, J.' 6 ? primary 'Bateman, A.' 7 ? primary 'Luisi, B.F.' 8 ? primary 'Broadhurst, R.W.' 9 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'RNA chaperone ProQ' _entity.formula_weight 5601.499 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 180-232' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code VSDISALTVGQALKVKAGQNAMDATVLEITKDGVRVQLNSGMSLIVRAEHLVF _entity_poly.pdbx_seq_one_letter_code_can VSDISALTVGQALKVKAGQNAMDATVLEITKDGVRVQLNSGMSLIVRAEHLVF _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 SER n 1 3 ASP n 1 4 ILE n 1 5 SER n 1 6 ALA n 1 7 LEU n 1 8 THR n 1 9 VAL n 1 10 GLY n 1 11 GLN n 1 12 ALA n 1 13 LEU n 1 14 LYS n 1 15 VAL n 1 16 LYS n 1 17 ALA n 1 18 GLY n 1 19 GLN n 1 20 ASN n 1 21 ALA n 1 22 MET n 1 23 ASP n 1 24 ALA n 1 25 THR n 1 26 VAL n 1 27 LEU n 1 28 GLU n 1 29 ILE n 1 30 THR n 1 31 LYS n 1 32 ASP n 1 33 GLY n 1 34 VAL n 1 35 ARG n 1 36 VAL n 1 37 GLN n 1 38 LEU n 1 39 ASN n 1 40 SER n 1 41 GLY n 1 42 MET n 1 43 SER n 1 44 LEU n 1 45 ILE n 1 46 VAL n 1 47 ARG n 1 48 ALA n 1 49 GLU n 1 50 HIS n 1 51 LEU n 1 52 VAL n 1 53 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 53 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'proQ, yebJ, yobE, yoeC, b1831, JW5300' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli (strain K12)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83333 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ProQ-pET-DUET _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 180 180 VAL VAL A . n A 1 2 SER 2 181 181 SER SER A . n A 1 3 ASP 3 182 182 ASP ASP A . n A 1 4 ILE 4 183 183 ILE ILE A . n A 1 5 SER 5 184 184 SER SER A . n A 1 6 ALA 6 185 185 ALA ALA A . n A 1 7 LEU 7 186 186 LEU LEU A . n A 1 8 THR 8 187 187 THR THR A . n A 1 9 VAL 9 188 188 VAL VAL A . n A 1 10 GLY 10 189 189 GLY GLY A . n A 1 11 GLN 11 190 190 GLN GLN A . n A 1 12 ALA 12 191 191 ALA ALA A . n A 1 13 LEU 13 192 192 LEU LEU A . n A 1 14 LYS 14 193 193 LYS LYS A . n A 1 15 VAL 15 194 194 VAL VAL A . n A 1 16 LYS 16 195 195 LYS LYS A . n A 1 17 ALA 17 196 196 ALA ALA A . n A 1 18 GLY 18 197 197 GLY GLY A . n A 1 19 GLN 19 198 198 GLN GLN A . n A 1 20 ASN 20 199 199 ASN ASN A . n A 1 21 ALA 21 200 200 ALA ALA A . n A 1 22 MET 22 201 201 MET MET A . n A 1 23 ASP 23 202 202 ASP ASP A . n A 1 24 ALA 24 203 203 ALA ALA A . n A 1 25 THR 25 204 204 THR THR A . n A 1 26 VAL 26 205 205 VAL VAL A . n A 1 27 LEU 27 206 206 LEU LEU A . n A 1 28 GLU 28 207 207 GLU GLU A . n A 1 29 ILE 29 208 208 ILE ILE A . n A 1 30 THR 30 209 209 THR THR A . n A 1 31 LYS 31 210 210 LYS LYS A . n A 1 32 ASP 32 211 211 ASP ASP A . n A 1 33 GLY 33 212 212 GLY GLY A . n A 1 34 VAL 34 213 213 VAL VAL A . n A 1 35 ARG 35 214 214 ARG ARG A . n A 1 36 VAL 36 215 215 VAL VAL A . n A 1 37 GLN 37 216 216 GLN GLN A . n A 1 38 LEU 38 217 217 LEU LEU A . n A 1 39 ASN 39 218 218 ASN ASN A . n A 1 40 SER 40 219 219 SER SER A . n A 1 41 GLY 41 220 220 GLY GLY A . n A 1 42 MET 42 221 221 MET MET A . n A 1 43 SER 43 222 222 SER SER A . n A 1 44 LEU 44 223 223 LEU LEU A . n A 1 45 ILE 45 224 224 ILE ILE A . n A 1 46 VAL 46 225 225 VAL VAL A . n A 1 47 ARG 47 226 226 ARG ARG A . n A 1 48 ALA 48 227 227 ALA ALA A . n A 1 49 GLU 49 228 228 GLU GLU A . n A 1 50 HIS 50 229 229 HIS HIS A . n A 1 51 LEU 51 230 230 LEU LEU A . n A 1 52 VAL 52 231 231 VAL VAL A . n A 1 53 PHE 53 232 232 PHE PHE A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5NBB _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 5NBB _struct.title 'Structure of the C-terminal domain of the Escherichia Coli ProQ RNA binding protein' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5NBB _struct_keywords.text 'FinO, ProQ, RNA chaperone, chaperone' _struct_keywords.pdbx_keywords CHAPERONE # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PROQ_ECOLI _struct_ref.pdbx_db_accession P45577 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code VSDISALTVGQALKVKAGQNAMDATVLEITKDGVRVQLNSGMSLIVRAEHLVF _struct_ref.pdbx_align_begin 180 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5NBB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 53 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P45577 _struct_ref_seq.db_align_beg 180 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 232 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 180 _struct_ref_seq.pdbx_auth_seq_align_end 232 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 3420 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support SAXS _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ALA A 24 ? ILE A 29 ? ALA A 203 ILE A 208 AA1 2 VAL A 34 ? LEU A 38 ? VAL A 213 LEU A 217 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id GLU _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 28 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id GLU _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 207 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ARG _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 35 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ARG _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 214 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 O A THR 204 ? ? H A GLN 216 ? ? 1.58 2 3 O A THR 204 ? ? H A GLN 216 ? ? 1.59 3 4 O A THR 204 ? ? H A GLN 216 ? ? 1.59 4 4 OG A SER 184 ? ? H A ALA 185 ? ? 1.60 5 4 OD2 A ASP 211 ? ? H A ALA 227 ? ? 1.60 6 5 O A THR 204 ? ? H A GLN 216 ? ? 1.59 7 6 O A MET 221 ? ? HG A SER 222 ? ? 1.56 8 6 O A THR 204 ? ? H A GLN 216 ? ? 1.60 9 9 OG A SER 184 ? ? H A ALA 185 ? ? 1.59 10 9 O A THR 204 ? ? H A GLN 216 ? ? 1.59 11 10 O A MET 221 ? ? HG A SER 222 ? ? 1.59 12 10 OG A SER 184 ? ? H A ALA 185 ? ? 1.59 13 11 O A THR 204 ? ? H A GLN 216 ? ? 1.58 14 12 O A THR 204 ? ? H A GLN 216 ? ? 1.60 15 13 O A THR 204 ? ? H A GLN 216 ? ? 1.59 16 14 O A THR 204 ? ? H A GLN 216 ? ? 1.57 17 15 O A THR 204 ? ? H A GLN 216 ? ? 1.58 18 16 O A THR 204 ? ? H A GLN 216 ? ? 1.59 19 17 O A THR 204 ? ? H A GLN 216 ? ? 1.58 20 17 HG A SER 184 ? ? O A THR 209 ? ? 1.60 21 18 O A THR 204 ? ? H A GLN 216 ? ? 1.59 22 18 HZ3 A LYS 193 ? ? OD1 A ASP 202 ? ? 1.59 23 19 O A THR 204 ? ? H A GLN 216 ? ? 1.59 24 19 OG A SER 184 ? ? H A ALA 185 ? ? 1.60 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 10 _pdbx_validate_rmsd_bond.auth_atom_id_1 CE1 _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 PHE _pdbx_validate_rmsd_bond.auth_seq_id_1 232 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 CZ _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 PHE _pdbx_validate_rmsd_bond.auth_seq_id_2 232 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.497 _pdbx_validate_rmsd_bond.bond_target_value 1.369 _pdbx_validate_rmsd_bond.bond_deviation 0.128 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.019 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 182 ? ? 69.25 147.71 2 1 SER A 184 ? ? -108.17 -72.35 3 1 LEU A 186 ? ? -171.21 -179.18 4 1 ALA A 191 ? ? 75.30 126.11 5 1 LEU A 192 ? ? -159.33 -149.02 6 1 LYS A 195 ? ? 60.37 99.21 7 1 GLN A 198 ? ? 73.76 -27.88 8 1 MET A 201 ? ? -146.91 -57.79 9 1 ASP A 202 ? ? 108.39 136.22 10 1 THR A 209 ? ? -108.14 -160.78 11 1 ASP A 211 ? ? -161.17 -19.75 12 1 MET A 221 ? ? -115.12 -163.12 13 1 LEU A 223 ? ? 176.20 -44.99 14 1 ILE A 224 ? ? 34.28 -97.89 15 1 VAL A 225 ? ? 160.42 -158.01 16 2 ASP A 182 ? ? 72.58 142.83 17 2 SER A 184 ? ? -125.44 -78.23 18 2 ALA A 191 ? ? 75.47 128.71 19 2 LEU A 192 ? ? -150.42 -151.03 20 2 GLN A 198 ? ? 77.89 -23.92 21 2 MET A 201 ? ? -91.67 -85.16 22 2 ASP A 202 ? ? 146.75 110.21 23 2 THR A 209 ? ? -111.86 -160.78 24 2 ASP A 211 ? ? -163.57 -25.84 25 2 SER A 222 ? ? 70.89 117.75 26 2 LEU A 223 ? ? 162.77 -40.32 27 2 ILE A 224 ? ? 32.99 -92.51 28 2 VAL A 225 ? ? 160.71 -158.86 29 2 HIS A 229 ? ? -140.59 -25.02 30 3 ASP A 182 ? ? 73.10 143.70 31 3 SER A 184 ? ? -124.36 -74.44 32 3 ALA A 191 ? ? 71.99 124.94 33 3 LEU A 192 ? ? -145.86 -149.99 34 3 GLN A 198 ? ? 73.82 -18.30 35 3 MET A 201 ? ? -107.02 -76.99 36 3 ASP A 202 ? ? 162.04 149.71 37 3 THR A 209 ? ? -115.39 -160.86 38 3 ASP A 211 ? ? -164.61 -22.04 39 3 MET A 221 ? ? -111.39 -159.25 40 3 LEU A 223 ? ? 162.97 -38.66 41 3 ILE A 224 ? ? 34.22 -91.35 42 3 VAL A 225 ? ? 160.09 -156.41 43 3 HIS A 229 ? ? -140.02 -22.24 44 4 ASP A 182 ? ? 69.43 157.47 45 4 SER A 184 ? ? -94.94 -79.48 46 4 ALA A 191 ? ? 77.68 128.46 47 4 LEU A 192 ? ? -156.22 -150.02 48 4 LYS A 195 ? ? 62.20 97.45 49 4 GLN A 198 ? ? 73.88 -31.58 50 4 MET A 201 ? ? -154.03 -66.12 51 4 ASP A 202 ? ? 122.79 141.37 52 4 THR A 209 ? ? -112.41 -161.49 53 4 ASP A 211 ? ? -151.01 -33.70 54 4 MET A 221 ? ? -108.63 -161.20 55 4 LEU A 223 ? ? 167.36 -42.18 56 4 ILE A 224 ? ? 35.25 -93.05 57 4 VAL A 225 ? ? 160.91 -158.29 58 5 SER A 184 ? ? -112.75 -80.97 59 5 ALA A 191 ? ? 69.94 125.86 60 5 LEU A 192 ? ? -146.80 -149.51 61 5 MET A 201 ? ? -102.30 -79.15 62 5 ASP A 202 ? ? 158.29 142.46 63 5 THR A 209 ? ? -111.43 -158.51 64 5 ASP A 211 ? ? -163.20 -29.44 65 5 MET A 221 ? ? -94.87 -62.69 66 5 SER A 222 ? ? 76.72 123.15 67 5 LEU A 223 ? ? 157.01 -38.61 68 5 ILE A 224 ? ? 33.47 -93.12 69 5 VAL A 225 ? ? 160.51 -156.06 70 6 ASP A 182 ? ? 72.40 141.88 71 6 SER A 184 ? ? -124.95 -77.04 72 6 ALA A 191 ? ? 72.83 125.82 73 6 LEU A 192 ? ? -152.40 -146.98 74 6 MET A 201 ? ? -117.28 -79.03 75 6 ASP A 202 ? ? 162.95 151.32 76 6 THR A 209 ? ? -111.05 -160.95 77 6 ASP A 211 ? ? -162.10 -24.19 78 6 MET A 221 ? ? -103.59 -146.24 79 6 SER A 222 ? ? 176.61 123.40 80 6 LEU A 223 ? ? 160.89 -40.93 81 6 ILE A 224 ? ? 32.54 -91.06 82 6 VAL A 225 ? ? 159.03 -153.71 83 6 HIS A 229 ? ? -143.85 -25.41 84 7 ASP A 182 ? ? -111.19 -159.46 85 7 SER A 184 ? ? -118.37 -73.66 86 7 LEU A 186 ? ? -170.35 -179.91 87 7 ALA A 191 ? ? 74.76 125.28 88 7 LEU A 192 ? ? -161.24 -150.97 89 7 LYS A 195 ? ? 54.52 99.86 90 7 MET A 201 ? ? -129.15 -58.01 91 7 ASP A 202 ? ? 101.16 126.35 92 7 THR A 209 ? ? -112.57 -164.34 93 7 ASP A 211 ? ? -166.23 -26.00 94 7 MET A 221 ? ? -104.84 -166.10 95 7 LEU A 223 ? ? 170.39 -44.25 96 7 ILE A 224 ? ? 33.67 -98.68 97 7 VAL A 225 ? ? 178.94 -164.32 98 8 ASP A 182 ? ? 73.95 153.11 99 8 SER A 184 ? ? -95.27 -80.34 100 8 ALA A 191 ? ? 72.63 131.25 101 8 LEU A 192 ? ? -152.08 -148.87 102 8 LYS A 195 ? ? -74.28 48.19 103 8 MET A 201 ? ? -104.60 -77.59 104 8 ASP A 202 ? ? 151.52 140.79 105 8 THR A 209 ? ? -112.65 -163.07 106 8 ASP A 211 ? ? -156.70 -24.63 107 8 MET A 221 ? ? -90.04 -63.63 108 8 SER A 222 ? ? 78.29 122.46 109 8 LEU A 223 ? ? 159.06 -41.99 110 8 ILE A 224 ? ? 31.64 -92.65 111 8 VAL A 225 ? ? 157.25 -158.41 112 9 SER A 184 ? ? -105.29 -78.29 113 9 ALA A 191 ? ? 70.97 123.44 114 9 LEU A 192 ? ? -156.62 -157.52 115 9 LYS A 195 ? ? 59.19 95.36 116 9 GLN A 198 ? ? 74.01 -35.44 117 9 MET A 201 ? ? -146.29 -55.65 118 9 ASP A 202 ? ? 97.03 105.27 119 9 THR A 209 ? ? -112.11 -161.66 120 9 ASP A 211 ? ? -161.88 -24.35 121 9 SER A 222 ? ? 77.04 125.39 122 9 LEU A 223 ? ? 158.98 -37.90 123 9 ILE A 224 ? ? 34.53 -93.98 124 9 VAL A 225 ? ? 162.12 -153.87 125 9 HIS A 229 ? ? -137.19 -31.79 126 10 ILE A 183 ? ? -84.76 -73.24 127 10 SER A 184 ? ? -97.78 -80.23 128 10 ALA A 191 ? ? 75.15 127.10 129 10 LEU A 192 ? ? -154.95 -149.75 130 10 ASP A 202 ? ? 95.24 109.54 131 10 THR A 209 ? ? -112.45 -163.34 132 10 ASP A 211 ? ? -159.75 -27.77 133 10 SER A 222 ? ? 71.19 120.88 134 10 LEU A 223 ? ? 166.10 -42.45 135 10 ILE A 224 ? ? 31.75 -99.57 136 10 VAL A 225 ? ? 162.51 -154.91 137 11 SER A 184 ? ? -108.34 -78.78 138 11 ALA A 191 ? ? 73.32 127.66 139 11 LEU A 192 ? ? -148.30 -151.58 140 11 LYS A 195 ? ? 60.50 96.43 141 11 GLN A 198 ? ? 75.30 -26.16 142 11 MET A 201 ? ? -127.01 -80.63 143 11 ASP A 202 ? ? 151.75 146.99 144 11 ASP A 211 ? ? -149.66 -33.21 145 11 SER A 222 ? ? 75.93 122.19 146 11 LEU A 223 ? ? 156.32 -37.88 147 11 ILE A 224 ? ? 32.92 -94.26 148 11 VAL A 225 ? ? 159.94 -152.10 149 11 HIS A 229 ? ? -137.03 -34.37 150 12 SER A 184 ? ? -101.81 -82.76 151 12 ALA A 191 ? ? 71.71 124.12 152 12 LEU A 192 ? ? -150.13 -152.30 153 12 LYS A 195 ? ? 62.42 108.36 154 12 MET A 201 ? ? -147.88 -59.19 155 12 ASP A 202 ? ? 104.59 115.90 156 12 THR A 209 ? ? -113.27 -167.07 157 12 ASP A 211 ? ? -150.51 -35.39 158 12 MET A 221 ? ? -108.71 -163.37 159 12 LEU A 223 ? ? 178.22 -55.56 160 12 ILE A 224 ? ? 49.08 -99.32 161 12 VAL A 225 ? ? 156.84 -159.92 162 13 ASP A 182 ? ? -121.26 -161.17 163 13 SER A 184 ? ? -117.08 -77.21 164 13 ALA A 191 ? ? 73.71 127.27 165 13 LEU A 192 ? ? -148.97 -149.42 166 13 GLN A 198 ? ? 75.19 -19.85 167 13 MET A 201 ? ? -106.16 -79.16 168 13 ASP A 202 ? ? 161.73 149.54 169 13 THR A 209 ? ? -111.98 -161.00 170 13 ASP A 211 ? ? -162.84 -25.71 171 13 MET A 221 ? ? -107.73 -63.61 172 13 SER A 222 ? ? 79.73 122.07 173 13 LEU A 223 ? ? 161.98 -41.32 174 13 ILE A 224 ? ? 33.85 -97.81 175 13 VAL A 225 ? ? 159.61 -156.78 176 14 ILE A 183 ? ? -79.22 -80.12 177 14 SER A 184 ? ? -95.95 -68.78 178 14 ALA A 191 ? ? 67.86 120.86 179 14 LEU A 192 ? ? -149.98 -147.80 180 14 MET A 201 ? ? -108.06 -76.33 181 14 ASP A 202 ? ? 160.89 149.81 182 14 THR A 209 ? ? -113.83 -164.09 183 14 ASP A 211 ? ? -159.82 -25.82 184 14 MET A 221 ? ? -109.08 -162.06 185 14 LEU A 223 ? ? 166.38 -41.91 186 14 ILE A 224 ? ? 33.74 -89.58 187 14 VAL A 225 ? ? 159.70 -156.08 188 15 SER A 184 ? ? -92.89 -79.31 189 15 ALA A 191 ? ? 71.85 127.78 190 15 LEU A 192 ? ? -149.40 -150.87 191 15 MET A 201 ? ? -107.10 -75.24 192 15 ASP A 202 ? ? 159.39 150.29 193 15 THR A 209 ? ? -111.72 -164.40 194 15 ASP A 211 ? ? -158.35 -27.24 195 15 MET A 221 ? ? -105.95 -167.01 196 15 LEU A 223 ? ? 172.18 -43.18 197 15 ILE A 224 ? ? 36.09 -93.57 198 15 VAL A 225 ? ? 158.89 -152.01 199 16 ASP A 182 ? ? -113.15 -168.01 200 16 ILE A 183 ? ? -87.04 -75.46 201 16 SER A 184 ? ? -100.54 -73.85 202 16 ALA A 191 ? ? 72.57 127.43 203 16 LEU A 192 ? ? -149.42 -149.53 204 16 GLN A 198 ? ? 77.95 -18.15 205 16 MET A 201 ? ? -115.28 -83.70 206 16 ASP A 202 ? ? 142.73 122.58 207 16 THR A 209 ? ? -112.59 -166.99 208 16 ASP A 211 ? ? -158.42 -28.60 209 16 MET A 221 ? ? -110.55 -164.90 210 16 LEU A 223 ? ? 167.47 -44.48 211 16 ILE A 224 ? ? 35.07 -93.96 212 16 VAL A 225 ? ? 159.70 -156.88 213 17 ILE A 183 ? ? -78.49 -72.67 214 17 SER A 184 ? ? -102.79 -74.44 215 17 LEU A 186 ? ? -170.85 -176.82 216 17 ALA A 191 ? ? 73.46 128.69 217 17 LEU A 192 ? ? -152.35 -147.20 218 17 LYS A 195 ? ? 57.28 89.10 219 17 MET A 201 ? ? -141.86 -91.66 220 17 ASP A 202 ? ? 162.54 141.26 221 17 THR A 209 ? ? -110.82 -162.29 222 17 ASP A 211 ? ? -151.27 -35.08 223 17 MET A 221 ? ? -118.32 -162.15 224 17 LEU A 223 ? ? 166.77 -38.07 225 17 ILE A 224 ? ? 36.29 -89.52 226 17 VAL A 225 ? ? 159.07 -155.49 227 18 ASP A 182 ? ? 71.78 137.12 228 18 SER A 184 ? ? -118.89 -73.21 229 18 ALA A 191 ? ? 75.53 128.49 230 18 LEU A 192 ? ? -151.45 -149.08 231 18 LYS A 195 ? ? 55.59 87.93 232 18 GLN A 198 ? ? 72.28 -38.10 233 18 MET A 201 ? ? -136.04 -82.19 234 18 ASP A 202 ? ? 159.60 153.99 235 18 THR A 209 ? ? -114.62 -164.08 236 18 ASP A 211 ? ? -168.35 -22.54 237 18 MET A 221 ? ? -126.34 -159.22 238 18 LEU A 223 ? ? 164.40 -43.61 239 18 ILE A 224 ? ? 33.29 -90.99 240 18 VAL A 225 ? ? 158.52 -156.81 241 19 ASP A 182 ? ? -125.71 -168.42 242 19 ILE A 183 ? ? -92.06 -72.61 243 19 SER A 184 ? ? -90.79 -82.67 244 19 ALA A 191 ? ? 77.09 129.64 245 19 LEU A 192 ? ? -153.56 -149.71 246 19 ASN A 199 ? ? 59.96 132.17 247 19 ALA A 200 ? ? 46.69 111.74 248 19 MET A 201 ? ? -107.08 -73.24 249 19 ASP A 202 ? ? 147.84 145.16 250 19 THR A 209 ? ? -110.98 -160.13 251 19 ASP A 211 ? ? -153.89 -31.43 252 19 SER A 222 ? ? 76.94 123.30 253 19 LEU A 223 ? ? 159.31 -42.12 254 19 ILE A 224 ? ? 31.75 -96.63 255 19 VAL A 225 ? ? 158.63 -157.08 256 19 HIS A 229 ? ? -144.99 -25.77 257 20 SER A 181 ? ? -141.39 17.20 258 20 ASP A 182 ? ? 74.15 159.62 259 20 ILE A 183 ? ? -73.98 -72.42 260 20 SER A 184 ? ? -95.38 -76.27 261 20 ALA A 191 ? ? 72.58 128.74 262 20 LEU A 192 ? ? -151.55 -149.23 263 20 GLN A 198 ? ? 74.76 -20.25 264 20 MET A 201 ? ? -101.88 -76.00 265 20 ASP A 202 ? ? 155.84 147.38 266 20 THR A 209 ? ? -112.65 -162.95 267 20 ASP A 211 ? ? -168.22 -13.71 268 20 MET A 221 ? ? -116.25 -162.95 269 20 LEU A 223 ? ? 165.64 -40.16 270 20 ILE A 224 ? ? 34.48 -89.03 271 20 VAL A 225 ? ? 157.85 -155.12 272 20 HIS A 229 ? ? -146.73 -18.86 # _pdbx_nmr_ensemble.entry_id 5NBB _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 5NBB _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '20 mM sodium phosphate, 100 mM sodium chloride, 1 mM TCEP, 0.0025 % 3,3,3-trimethylsilylpropionate, 90% H2O/10% D2O' '90% H2O/10% D2O' 15N_ProQ solution 'The sample was uniformly 15N-labelled full length ProQ, but the structure deposited is for residues 180 to 232 only' 2 '20 mM sodium chloride, 100 mM sodium phosphate, 1 mM TCEP, 0.0025 % 3,3,3-trimethylsilylpropionate, 90% H2O/10% D2O' '90% H2O/10% D2O' 13C_15N_ProQ solution 'The sample was uniformly `13C/15N-labelled full length ProQ, but the structure deposited is for residues 180 to 232 only' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'sodium phosphate' 20 ? mM 'natural abundance' 1 'sodium chloride' 100 ? mM 'natural abundance' 1 TCEP 1 ? mM 'natural abundance' 1 3,3,3-trimethylsilylpropionate 0.0025 ? % 'natural abundance' 2 'sodium chloride' 20 ? mM 'natural abundance' 2 'sodium phosphate' 100 ? mM 'natural abundance' 2 TCEP 1 ? mM 'natural abundance' 2 3,3,3-trimethylsilylpropionate 0.0025 ? % 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 150 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err 5 _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label ProQ _pdbx_nmr_exptl_sample_conditions.pH_err 0.05 _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err 0.05 _pdbx_nmr_exptl_sample_conditions.temperature_err 0.1 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 2 '2D 1H-13C HSQC' 1 isotropic 3 1 2 '3D HNCA' 1 isotropic 4 1 2 '3D HN(CO)CA' 1 isotropic 9 1 2 '3D CBCA(CO)NH' 1 isotropic 8 1 2 '3D HBHA(CO)NH' 1 isotropic 7 1 2 '3D HCCH-TOCSY' 1 isotropic 6 1 1 '3D 1H-15N TOCSY' 1 isotropic 11 1 1 '3D 1H-15N NOESY' 2 isotropic 10 1 2 '3D 1H-13C NOESY' 3 isotropic # _pdbx_nmr_refine.entry_id 5NBB _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 2 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'data analysis' 'CcpNmr Analysis' 2.4 CCPN 2 'structure calculation' ARIA 2.3 ;Linge, O'Donoghue and Nilges ; # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 SER N N N N 256 SER CA C N S 257 SER C C N N 258 SER O O N N 259 SER CB C N N 260 SER OG O N N 261 SER OXT O N N 262 SER H H N N 263 SER H2 H N N 264 SER HA H N N 265 SER HB2 H N N 266 SER HB3 H N N 267 SER HG H N N 268 SER HXT H N N 269 THR N N N N 270 THR CA C N S 271 THR C C N N 272 THR O O N N 273 THR CB C N R 274 THR OG1 O N N 275 THR CG2 C N N 276 THR OXT O N N 277 THR H H N N 278 THR H2 H N N 279 THR HA H N N 280 THR HB H N N 281 THR HG1 H N N 282 THR HG21 H N N 283 THR HG22 H N N 284 THR HG23 H N N 285 THR HXT H N N 286 VAL N N N N 287 VAL CA C N S 288 VAL C C N N 289 VAL O O N N 290 VAL CB C N N 291 VAL CG1 C N N 292 VAL CG2 C N N 293 VAL OXT O N N 294 VAL H H N N 295 VAL H2 H N N 296 VAL HA H N N 297 VAL HB H N N 298 VAL HG11 H N N 299 VAL HG12 H N N 300 VAL HG13 H N N 301 VAL HG21 H N N 302 VAL HG22 H N N 303 VAL HG23 H N N 304 VAL HXT H N N 305 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 SER N CA sing N N 245 SER N H sing N N 246 SER N H2 sing N N 247 SER CA C sing N N 248 SER CA CB sing N N 249 SER CA HA sing N N 250 SER C O doub N N 251 SER C OXT sing N N 252 SER CB OG sing N N 253 SER CB HB2 sing N N 254 SER CB HB3 sing N N 255 SER OG HG sing N N 256 SER OXT HXT sing N N 257 THR N CA sing N N 258 THR N H sing N N 259 THR N H2 sing N N 260 THR CA C sing N N 261 THR CA CB sing N N 262 THR CA HA sing N N 263 THR C O doub N N 264 THR C OXT sing N N 265 THR CB OG1 sing N N 266 THR CB CG2 sing N N 267 THR CB HB sing N N 268 THR OG1 HG1 sing N N 269 THR CG2 HG21 sing N N 270 THR CG2 HG22 sing N N 271 THR CG2 HG23 sing N N 272 THR OXT HXT sing N N 273 VAL N CA sing N N 274 VAL N H sing N N 275 VAL N H2 sing N N 276 VAL CA C sing N N 277 VAL CA CB sing N N 278 VAL CA HA sing N N 279 VAL C O doub N N 280 VAL C OXT sing N N 281 VAL CB CG1 sing N N 282 VAL CB CG2 sing N N 283 VAL CB HB sing N N 284 VAL CG1 HG11 sing N N 285 VAL CG1 HG12 sing N N 286 VAL CG1 HG13 sing N N 287 VAL CG2 HG21 sing N N 288 VAL CG2 HG22 sing N N 289 VAL CG2 HG23 sing N N 290 VAL OXT HXT sing N N 291 # _pdbx_audit_support.funding_organization 'Wellcome Trust' _pdbx_audit_support.country 'United Kingdom' _pdbx_audit_support.grant_number 094229/Z/10/Z _pdbx_audit_support.ordinal 1 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 DRX ? Bruker 500 ? 2 AVANCE ? Bruker 600 ? 3 AVANCE ? Bruker 800 ? # _atom_sites.entry_id 5NBB _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_