data_5NIQ # _entry.id 5NIQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5NIQ pdb_00005niq 10.2210/pdb5niq/pdb WWPDB D_1200003326 ? ? BMRB 34119 ? 10.13018/BMR34119 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-02-28 2 'Structure model' 1 1 2019-03-27 3 'Structure model' 1 2 2019-05-08 4 'Structure model' 2 0 2019-09-11 5 'Structure model' 2 1 2024-10-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 4 'Structure model' Advisory 5 4 'Structure model' 'Atomic model' 6 4 'Structure model' 'Data collection' 7 4 'Structure model' 'Derived calculations' 8 5 'Structure model' 'Data collection' 9 5 'Structure model' 'Database references' 10 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' pdbx_database_proc 4 3 'Structure model' pdbx_nmr_software 5 4 'Structure model' atom_site 6 4 'Structure model' pdbx_nmr_representative 7 4 'Structure model' pdbx_validate_close_contact 8 4 'Structure model' pdbx_validate_rmsd_angle 9 4 'Structure model' pdbx_validate_torsion 10 4 'Structure model' struct_conf 11 4 'Structure model' struct_conn 12 4 'Structure model' struct_site 13 4 'Structure model' struct_site_gen 14 5 'Structure model' chem_comp_atom 15 5 'Structure model' chem_comp_bond 16 5 'Structure model' database_2 17 5 'Structure model' pdbx_entry_details 18 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 3 'Structure model' '_pdbx_nmr_software.name' 14 4 'Structure model' '_atom_site.Cartn_x' 15 4 'Structure model' '_atom_site.Cartn_y' 16 4 'Structure model' '_atom_site.Cartn_z' 17 4 'Structure model' '_pdbx_nmr_representative.conformer_id' 18 4 'Structure model' '_pdbx_validate_close_contact.PDB_model_num' 19 4 'Structure model' '_pdbx_validate_close_contact.auth_atom_id_1' 20 4 'Structure model' '_pdbx_validate_close_contact.auth_atom_id_2' 21 4 'Structure model' '_pdbx_validate_close_contact.auth_comp_id_1' 22 4 'Structure model' '_pdbx_validate_close_contact.auth_seq_id_1' 23 4 'Structure model' '_pdbx_validate_close_contact.auth_seq_id_2' 24 4 'Structure model' '_pdbx_validate_close_contact.dist' 25 4 'Structure model' '_pdbx_validate_rmsd_angle.PDB_model_num' 26 4 'Structure model' '_pdbx_validate_rmsd_angle.angle_deviation' 27 4 'Structure model' '_pdbx_validate_rmsd_angle.angle_standard_deviation' 28 4 'Structure model' '_pdbx_validate_rmsd_angle.angle_target_value' 29 4 'Structure model' '_pdbx_validate_rmsd_angle.angle_value' 30 4 'Structure model' '_pdbx_validate_rmsd_angle.auth_atom_id_1' 31 4 'Structure model' '_pdbx_validate_rmsd_angle.auth_atom_id_2' 32 4 'Structure model' '_pdbx_validate_rmsd_angle.auth_atom_id_3' 33 4 'Structure model' '_pdbx_validate_rmsd_angle.auth_comp_id_1' 34 4 'Structure model' '_pdbx_validate_rmsd_angle.auth_comp_id_2' 35 4 'Structure model' '_pdbx_validate_rmsd_angle.auth_comp_id_3' 36 4 'Structure model' '_pdbx_validate_rmsd_angle.auth_seq_id_1' 37 4 'Structure model' '_pdbx_validate_rmsd_angle.auth_seq_id_2' 38 4 'Structure model' '_pdbx_validate_rmsd_angle.auth_seq_id_3' 39 4 'Structure model' '_pdbx_validate_torsion.PDB_model_num' 40 4 'Structure model' '_pdbx_validate_torsion.auth_comp_id' 41 4 'Structure model' '_pdbx_validate_torsion.auth_seq_id' 42 4 'Structure model' '_pdbx_validate_torsion.phi' 43 4 'Structure model' '_pdbx_validate_torsion.psi' 44 4 'Structure model' '_struct_conf.beg_auth_seq_id' 45 4 'Structure model' '_struct_conf.beg_label_seq_id' 46 4 'Structure model' '_struct_conf.end_auth_comp_id' 47 4 'Structure model' '_struct_conf.end_auth_seq_id' 48 4 'Structure model' '_struct_conf.end_label_comp_id' 49 4 'Structure model' '_struct_conf.end_label_seq_id' 50 4 'Structure model' '_struct_conf.pdbx_PDB_helix_length' 51 4 'Structure model' '_struct_conn.pdbx_dist_value' 52 4 'Structure model' '_struct_site.pdbx_num_residues' 53 5 'Structure model' '_database_2.pdbx_DOI' 54 5 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5NIQ _pdbx_database_status.recvd_initial_deposition_date 2017-03-24 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'exendin-4 variant with dual GLP-1 / glucagon receptor activity' _pdbx_database_related.db_id 34119 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Evers, A.' 1 ? 'Kurz, M.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 60 _citation.language ? _citation.page_first 4293 _citation.page_last 4303 _citation.title 'Design of Novel Exendin-Based Dual Glucagon-like Peptide 1 (GLP-1)/Glucagon Receptor Agonists.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.7b00174 _citation.pdbx_database_id_PubMed 28448133 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Evers, A.' 1 0000-0003-4643-1941 primary 'Haack, T.' 2 ? primary 'Lorenz, M.' 3 ? primary 'Bossart, M.' 4 ? primary 'Elvert, R.' 5 ? primary 'Henkel, B.' 6 ? primary 'Stengelin, S.' 7 ? primary 'Kurz, M.' 8 ? primary 'Glien, M.' 9 ? primary 'Dudda, A.' 10 ? primary 'Lorenz, K.' 11 ? primary 'Kadereit, D.' 12 ? primary 'Wagner, M.' 13 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer syn Exendin-4 4219.567 1 ? ? ? ? 2 non-polymer syn 'N-hexadecanoyl-L-glutamic acid' 385.538 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'H(DSN)QGTFTSDLSKQKDSRRAQDFIEWLKNGGPSSGAPPPS(NH2)' _entity_poly.pdbx_seq_one_letter_code_can HSQGTFTSDLSKQKDSRRAQDFIEWLKNGGPSSGAPPPSX _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'N-hexadecanoyl-L-glutamic acid' _pdbx_entity_nonpoly.comp_id D6M # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 HIS n 1 2 DSN n 1 3 GLN n 1 4 GLY n 1 5 THR n 1 6 PHE n 1 7 THR n 1 8 SER n 1 9 ASP n 1 10 LEU n 1 11 SER n 1 12 LYS n 1 13 GLN n 1 14 LYS n 1 15 ASP n 1 16 SER n 1 17 ARG n 1 18 ARG n 1 19 ALA n 1 20 GLN n 1 21 ASP n 1 22 PHE n 1 23 ILE n 1 24 GLU n 1 25 TRP n 1 26 LEU n 1 27 LYS n 1 28 ASN n 1 29 GLY n 1 30 GLY n 1 31 PRO n 1 32 SER n 1 33 SER n 1 34 GLY n 1 35 ALA n 1 36 PRO n 1 37 PRO n 1 38 PRO n 1 39 SER n 1 40 NH2 n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 39 _pdbx_entity_src_syn.organism_scientific 'Heloderma suspectum' _pdbx_entity_src_syn.organism_common_name 'Gila monster' _pdbx_entity_src_syn.ncbi_taxonomy_id 8554 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 D6M non-polymer . 'N-hexadecanoyl-L-glutamic acid' ? 'C21 H39 N O5' 385.538 DSN 'D-peptide linking' . D-SERINE ? 'C3 H7 N O3' 105.093 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 HIS 1 1 1 HIS HIS A . n A 1 2 DSN 2 2 2 DSN DSN A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 TRP 25 25 25 TRP TRP A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 NH2 40 40 39 NH2 SER A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id D6M _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 101 _pdbx_nonpoly_scheme.auth_seq_num 14 _pdbx_nonpoly_scheme.pdb_mon_id D6M _pdbx_nonpoly_scheme.auth_mon_id LYS _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5NIQ _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 5NIQ _struct.title 'exendin-4 variant with dual GLP-1 / glucagon receptor activity' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5NIQ _struct_keywords.text 'exendin-4 analogue, dual GLP-1 / glucagon agonist, hormone' _struct_keywords.pdbx_keywords HORMONE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 5NIQ _struct_ref.pdbx_db_accession 5NIQ _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5NIQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 39 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 5NIQ _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 39 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 39 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 3870 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 5 ? GLY A 29 ? THR A 5 GLY A 29 1 ? 25 HELX_P HELX_P2 AA2 GLY A 30 ? GLY A 34 ? GLY A 30 GLY A 34 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A HIS 1 C ? ? ? 1_555 A DSN 2 N ? ? A HIS 1 A DSN 2 1_555 ? ? ? ? ? ? ? 1.349 ? ? covale2 covale both ? A DSN 2 C ? ? ? 1_555 A GLN 3 N ? ? A DSN 2 A GLN 3 1_555 ? ? ? ? ? ? ? 1.355 ? ? covale3 covale one ? A LYS 14 NZ ? ? ? 1_555 B D6M . C07 ? ? A LYS 14 A D6M 101 1_555 ? ? ? ? ? ? ? 1.355 ? ? covale4 covale both ? A SER 39 C ? ? ? 1_555 A NH2 40 N ? ? A SER 39 A NH2 40 1_555 ? ? ? ? ? ? ? 1.348 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 NH2 A 40 ? SER A 39 ? NH2 A 40 ? 1_555 SER A 39 ? 1_555 . . SER 6 NH2 None 'Terminal amidation' 2 D6M B . ? LYS A 14 ? D6M A 101 ? 1_555 LYS A 14 ? 1_555 C07 NZ LYS 1 D6M None Lipid/lipid-like # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A D6M 101 ? 3 'binding site for residue D6M A 101' AC2 Software A NH2 40 ? 1 'binding site for Ligand NH2 A 40 bound to SER A 39' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 LYS A 14 ? LYS A 14 . ? 1_555 ? 2 AC1 3 ARG A 17 ? ARG A 17 . ? 1_555 ? 3 AC1 3 ARG A 18 ? ARG A 18 . ? 1_555 ? 4 AC2 1 SER A 39 ? SER A 39 . ? 1_555 ? # _pdbx_entry_details.entry_id 5NIQ _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD2 A ASP 9 ? ? HZ3 A LYS 12 ? ? 1.59 2 4 OD2 A ASP 9 ? ? HZ2 A LYS 12 ? ? 1.60 3 5 OE1 A GLU 24 ? ? HZ3 A LYS 27 ? ? 1.60 4 7 OE2 A GLU 24 ? ? HZ1 A LYS 27 ? ? 1.58 5 8 OD2 A ASP 9 ? ? HZ2 A LYS 12 ? ? 1.59 6 9 OE2 A GLU 24 ? ? HZ1 A LYS 27 ? ? 1.58 7 9 HH21 A ARG 18 ? ? OD1 A ASP 21 ? ? 1.59 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 18 ? ? CZ A ARG 18 ? ? NH2 A ARG 18 ? ? 123.64 120.30 3.34 0.50 N 2 1 CE2 A TRP 25 ? ? CD2 A TRP 25 ? ? CG A TRP 25 ? ? 102.29 107.30 -5.01 0.80 N 3 2 CE2 A TRP 25 ? ? CD2 A TRP 25 ? ? CG A TRP 25 ? ? 101.99 107.30 -5.31 0.80 N 4 3 NE A ARG 17 ? ? CZ A ARG 17 ? ? NH2 A ARG 17 ? ? 123.51 120.30 3.21 0.50 N 5 3 CE2 A TRP 25 ? ? CD2 A TRP 25 ? ? CG A TRP 25 ? ? 102.35 107.30 -4.95 0.80 N 6 4 NE A ARG 18 ? ? CZ A ARG 18 ? ? NH2 A ARG 18 ? ? 123.73 120.30 3.43 0.50 N 7 4 CE2 A TRP 25 ? ? CD2 A TRP 25 ? ? CG A TRP 25 ? ? 102.45 107.30 -4.85 0.80 N 8 5 NE A ARG 17 ? ? CZ A ARG 17 ? ? NH2 A ARG 17 ? ? 123.33 120.30 3.03 0.50 N 9 5 NE A ARG 18 ? ? CZ A ARG 18 ? ? NH2 A ARG 18 ? ? 123.40 120.30 3.10 0.50 N 10 5 CE2 A TRP 25 ? ? CD2 A TRP 25 ? ? CG A TRP 25 ? ? 101.35 107.30 -5.95 0.80 N 11 6 NE A ARG 18 ? ? CZ A ARG 18 ? ? NH2 A ARG 18 ? ? 124.04 120.30 3.74 0.50 N 12 6 CE2 A TRP 25 ? ? CD2 A TRP 25 ? ? CG A TRP 25 ? ? 102.47 107.30 -4.83 0.80 N 13 8 NE A ARG 18 ? ? CZ A ARG 18 ? ? NH2 A ARG 18 ? ? 123.39 120.30 3.09 0.50 N 14 8 CE2 A TRP 25 ? ? CD2 A TRP 25 ? ? CG A TRP 25 ? ? 102.41 107.30 -4.89 0.80 N 15 9 NE A ARG 17 ? ? CZ A ARG 17 ? ? NH2 A ARG 17 ? ? 123.52 120.30 3.22 0.50 N 16 9 CE2 A TRP 25 ? ? CD2 A TRP 25 ? ? CG A TRP 25 ? ? 102.03 107.30 -5.27 0.80 N 17 10 CE2 A TRP 25 ? ? CD2 A TRP 25 ? ? CG A TRP 25 ? ? 101.99 107.30 -5.31 0.80 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 3 ? ? 62.36 172.89 2 2 THR A 5 ? ? 38.71 39.90 3 4 THR A 5 ? ? 48.31 26.97 4 6 GLN A 3 ? ? 66.04 98.99 5 7 THR A 5 ? ? 70.08 -57.81 6 7 PHE A 6 ? ? 65.25 -62.68 7 8 DSN A 2 ? ? 75.61 169.96 8 8 GLN A 3 ? ? 65.65 -65.97 9 8 PHE A 6 ? ? 65.45 -62.10 10 8 PRO A 38 ? ? -68.37 91.93 11 9 GLN A 3 ? ? 65.86 -69.48 12 9 PHE A 6 ? ? 87.73 -51.58 13 9 PRO A 38 ? ? -50.73 88.27 14 10 THR A 5 ? ? 38.71 39.90 # _pdbx_nmr_ensemble.entry_id 5NIQ _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 5NIQ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'fewest violations' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '5 mg/mL Peptid 14, trifluoroethanol/water' _pdbx_nmr_sample_details.solvent_system trifluoroethanol/water _pdbx_nmr_sample_details.label 'Model 1' _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component 'Peptid 14' _pdbx_nmr_exptl_sample.concentration 5 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mg/mL _pdbx_nmr_exptl_sample.isotopic_labeling none # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.pressure_units Pa _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 5.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength '35mM sodium phosphate' _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err 0.2 _pdbx_nmr_exptl_sample_conditions.ionic_strength_units M _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err 0.05 _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err 0.01 _pdbx_nmr_exptl_sample_conditions.temperature_err 0.2 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-1H COSY' 1 isotropic 2 1 1 '2D 1H-1H TOCSY' 1 isotropic 3 1 1 '2D 1H-1H NOESY' 1 isotropic 4 1 1 '2D 1H-13C HSQC' 2 isotropic # _pdbx_nmr_refine.entry_id 5NIQ _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 2 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'chemical shift assignment' TopSpin 3.2 'Bruker Biospin' 2 'structure calculation' SYBYL 2.1.1 Tripos 3 'chemical shift assignment' CARA 'Release: 1.8.4.2' 'Keller and Wuthrich' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 D6M O01 O N N 74 D6M C02 C N N 75 D6M N03 N N N 76 D6M C04 C N S 77 D6M C05 C N N 78 D6M C06 C N N 79 D6M C07 C N N 80 D6M O08 O N N 81 D6M C09 C N N 82 D6M O10 O N N 83 D6M O11 O N N 84 D6M C12 C N N 85 D6M C13 C N N 86 D6M C14 C N N 87 D6M C15 C N N 88 D6M C16 C N N 89 D6M C17 C N N 90 D6M C18 C N N 91 D6M C19 C N N 92 D6M C20 C N N 93 D6M C21 C N N 94 D6M C22 C N N 95 D6M C23 C N N 96 D6M C24 C N N 97 D6M C25 C N N 98 D6M C26 C N N 99 D6M OXT O N N 100 D6M H03 H N N 101 D6M H121 H N N 102 D6M H122 H N N 103 D6M H04 H N N 104 D6M H051 H N N 105 D6M H052 H N N 106 D6M H061 H N N 107 D6M H062 H N N 108 D6M HX0 H N N 109 D6M H11 H N N 110 D6M H131 H N N 111 D6M H132 H N N 112 D6M H141 H N N 113 D6M H142 H N N 114 D6M H151 H N N 115 D6M H152 H N N 116 D6M H161 H N N 117 D6M H162 H N N 118 D6M H171 H N N 119 D6M H172 H N N 120 D6M H181 H N N 121 D6M H182 H N N 122 D6M H191 H N N 123 D6M H192 H N N 124 D6M H201 H N N 125 D6M H202 H N N 126 D6M H211 H N N 127 D6M H212 H N N 128 D6M H221 H N N 129 D6M H222 H N N 130 D6M H231 H N N 131 D6M H232 H N N 132 D6M H241 H N N 133 D6M H242 H N N 134 D6M H251 H N N 135 D6M H252 H N N 136 D6M H261 H N N 137 D6M H262 H N N 138 D6M H263 H N N 139 DSN N N N N 140 DSN CA C N R 141 DSN C C N N 142 DSN O O N N 143 DSN OXT O N N 144 DSN CB C N N 145 DSN OG O N N 146 DSN H H N N 147 DSN H2 H N N 148 DSN HA H N N 149 DSN HXT H N N 150 DSN HB2 H N N 151 DSN HB3 H N N 152 DSN HG H N N 153 GLN N N N N 154 GLN CA C N S 155 GLN C C N N 156 GLN O O N N 157 GLN CB C N N 158 GLN CG C N N 159 GLN CD C N N 160 GLN OE1 O N N 161 GLN NE2 N N N 162 GLN OXT O N N 163 GLN H H N N 164 GLN H2 H N N 165 GLN HA H N N 166 GLN HB2 H N N 167 GLN HB3 H N N 168 GLN HG2 H N N 169 GLN HG3 H N N 170 GLN HE21 H N N 171 GLN HE22 H N N 172 GLN HXT H N N 173 GLU N N N N 174 GLU CA C N S 175 GLU C C N N 176 GLU O O N N 177 GLU CB C N N 178 GLU CG C N N 179 GLU CD C N N 180 GLU OE1 O N N 181 GLU OE2 O N N 182 GLU OXT O N N 183 GLU H H N N 184 GLU H2 H N N 185 GLU HA H N N 186 GLU HB2 H N N 187 GLU HB3 H N N 188 GLU HG2 H N N 189 GLU HG3 H N N 190 GLU HE2 H N N 191 GLU HXT H N N 192 GLY N N N N 193 GLY CA C N N 194 GLY C C N N 195 GLY O O N N 196 GLY OXT O N N 197 GLY H H N N 198 GLY H2 H N N 199 GLY HA2 H N N 200 GLY HA3 H N N 201 GLY HXT H N N 202 HIS N N N N 203 HIS CA C N S 204 HIS C C N N 205 HIS O O N N 206 HIS CB C N N 207 HIS CG C Y N 208 HIS ND1 N Y N 209 HIS CD2 C Y N 210 HIS CE1 C Y N 211 HIS NE2 N Y N 212 HIS OXT O N N 213 HIS H H N N 214 HIS H2 H N N 215 HIS HA H N N 216 HIS HB2 H N N 217 HIS HB3 H N N 218 HIS HD1 H N N 219 HIS HD2 H N N 220 HIS HE1 H N N 221 HIS HE2 H N N 222 HIS HXT H N N 223 ILE N N N N 224 ILE CA C N S 225 ILE C C N N 226 ILE O O N N 227 ILE CB C N S 228 ILE CG1 C N N 229 ILE CG2 C N N 230 ILE CD1 C N N 231 ILE OXT O N N 232 ILE H H N N 233 ILE H2 H N N 234 ILE HA H N N 235 ILE HB H N N 236 ILE HG12 H N N 237 ILE HG13 H N N 238 ILE HG21 H N N 239 ILE HG22 H N N 240 ILE HG23 H N N 241 ILE HD11 H N N 242 ILE HD12 H N N 243 ILE HD13 H N N 244 ILE HXT H N N 245 LEU N N N N 246 LEU CA C N S 247 LEU C C N N 248 LEU O O N N 249 LEU CB C N N 250 LEU CG C N N 251 LEU CD1 C N N 252 LEU CD2 C N N 253 LEU OXT O N N 254 LEU H H N N 255 LEU H2 H N N 256 LEU HA H N N 257 LEU HB2 H N N 258 LEU HB3 H N N 259 LEU HG H N N 260 LEU HD11 H N N 261 LEU HD12 H N N 262 LEU HD13 H N N 263 LEU HD21 H N N 264 LEU HD22 H N N 265 LEU HD23 H N N 266 LEU HXT H N N 267 LYS N N N N 268 LYS CA C N S 269 LYS C C N N 270 LYS O O N N 271 LYS CB C N N 272 LYS CG C N N 273 LYS CD C N N 274 LYS CE C N N 275 LYS NZ N N N 276 LYS OXT O N N 277 LYS H H N N 278 LYS H2 H N N 279 LYS HA H N N 280 LYS HB2 H N N 281 LYS HB3 H N N 282 LYS HG2 H N N 283 LYS HG3 H N N 284 LYS HD2 H N N 285 LYS HD3 H N N 286 LYS HE2 H N N 287 LYS HE3 H N N 288 LYS HZ1 H N N 289 LYS HZ2 H N N 290 LYS HZ3 H N N 291 LYS HXT H N N 292 NH2 N N N N 293 NH2 HN1 H N N 294 NH2 HN2 H N N 295 PHE N N N N 296 PHE CA C N S 297 PHE C C N N 298 PHE O O N N 299 PHE CB C N N 300 PHE CG C Y N 301 PHE CD1 C Y N 302 PHE CD2 C Y N 303 PHE CE1 C Y N 304 PHE CE2 C Y N 305 PHE CZ C Y N 306 PHE OXT O N N 307 PHE H H N N 308 PHE H2 H N N 309 PHE HA H N N 310 PHE HB2 H N N 311 PHE HB3 H N N 312 PHE HD1 H N N 313 PHE HD2 H N N 314 PHE HE1 H N N 315 PHE HE2 H N N 316 PHE HZ H N N 317 PHE HXT H N N 318 PRO N N N N 319 PRO CA C N S 320 PRO C C N N 321 PRO O O N N 322 PRO CB C N N 323 PRO CG C N N 324 PRO CD C N N 325 PRO OXT O N N 326 PRO H H N N 327 PRO HA H N N 328 PRO HB2 H N N 329 PRO HB3 H N N 330 PRO HG2 H N N 331 PRO HG3 H N N 332 PRO HD2 H N N 333 PRO HD3 H N N 334 PRO HXT H N N 335 SER N N N N 336 SER CA C N S 337 SER C C N N 338 SER O O N N 339 SER CB C N N 340 SER OG O N N 341 SER OXT O N N 342 SER H H N N 343 SER H2 H N N 344 SER HA H N N 345 SER HB2 H N N 346 SER HB3 H N N 347 SER HG H N N 348 SER HXT H N N 349 THR N N N N 350 THR CA C N S 351 THR C C N N 352 THR O O N N 353 THR CB C N R 354 THR OG1 O N N 355 THR CG2 C N N 356 THR OXT O N N 357 THR H H N N 358 THR H2 H N N 359 THR HA H N N 360 THR HB H N N 361 THR HG1 H N N 362 THR HG21 H N N 363 THR HG22 H N N 364 THR HG23 H N N 365 THR HXT H N N 366 TRP N N N N 367 TRP CA C N S 368 TRP C C N N 369 TRP O O N N 370 TRP CB C N N 371 TRP CG C Y N 372 TRP CD1 C Y N 373 TRP CD2 C Y N 374 TRP NE1 N Y N 375 TRP CE2 C Y N 376 TRP CE3 C Y N 377 TRP CZ2 C Y N 378 TRP CZ3 C Y N 379 TRP CH2 C Y N 380 TRP OXT O N N 381 TRP H H N N 382 TRP H2 H N N 383 TRP HA H N N 384 TRP HB2 H N N 385 TRP HB3 H N N 386 TRP HD1 H N N 387 TRP HE1 H N N 388 TRP HE3 H N N 389 TRP HZ2 H N N 390 TRP HZ3 H N N 391 TRP HH2 H N N 392 TRP HXT H N N 393 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 D6M O01 C02 doub N N 70 D6M C02 N03 sing N N 71 D6M C02 C12 sing N N 72 D6M N03 C04 sing N N 73 D6M C04 C05 sing N N 74 D6M C04 C09 sing N N 75 D6M C05 C06 sing N N 76 D6M C06 C07 sing N N 77 D6M C07 O08 doub N N 78 D6M C07 OXT sing N N 79 D6M C09 O10 doub N N 80 D6M C09 O11 sing N N 81 D6M C12 C13 sing N N 82 D6M C13 C14 sing N N 83 D6M C14 C15 sing N N 84 D6M C15 C16 sing N N 85 D6M C16 C17 sing N N 86 D6M C17 C18 sing N N 87 D6M C18 C19 sing N N 88 D6M C19 C20 sing N N 89 D6M C20 C21 sing N N 90 D6M C21 C22 sing N N 91 D6M C22 C23 sing N N 92 D6M C23 C24 sing N N 93 D6M C24 C25 sing N N 94 D6M C25 C26 sing N N 95 D6M N03 H03 sing N N 96 D6M C12 H121 sing N N 97 D6M C12 H122 sing N N 98 D6M C04 H04 sing N N 99 D6M C05 H051 sing N N 100 D6M C05 H052 sing N N 101 D6M C06 H061 sing N N 102 D6M C06 H062 sing N N 103 D6M OXT HX0 sing N N 104 D6M O11 H11 sing N N 105 D6M C13 H131 sing N N 106 D6M C13 H132 sing N N 107 D6M C14 H141 sing N N 108 D6M C14 H142 sing N N 109 D6M C15 H151 sing N N 110 D6M C15 H152 sing N N 111 D6M C16 H161 sing N N 112 D6M C16 H162 sing N N 113 D6M C17 H171 sing N N 114 D6M C17 H172 sing N N 115 D6M C18 H181 sing N N 116 D6M C18 H182 sing N N 117 D6M C19 H191 sing N N 118 D6M C19 H192 sing N N 119 D6M C20 H201 sing N N 120 D6M C20 H202 sing N N 121 D6M C21 H211 sing N N 122 D6M C21 H212 sing N N 123 D6M C22 H221 sing N N 124 D6M C22 H222 sing N N 125 D6M C23 H231 sing N N 126 D6M C23 H232 sing N N 127 D6M C24 H241 sing N N 128 D6M C24 H242 sing N N 129 D6M C25 H251 sing N N 130 D6M C25 H252 sing N N 131 D6M C26 H261 sing N N 132 D6M C26 H262 sing N N 133 D6M C26 H263 sing N N 134 DSN N CA sing N N 135 DSN N H sing N N 136 DSN N H2 sing N N 137 DSN CA C sing N N 138 DSN CA CB sing N N 139 DSN CA HA sing N N 140 DSN C O doub N N 141 DSN C OXT sing N N 142 DSN OXT HXT sing N N 143 DSN CB OG sing N N 144 DSN CB HB2 sing N N 145 DSN CB HB3 sing N N 146 DSN OG HG sing N N 147 GLN N CA sing N N 148 GLN N H sing N N 149 GLN N H2 sing N N 150 GLN CA C sing N N 151 GLN CA CB sing N N 152 GLN CA HA sing N N 153 GLN C O doub N N 154 GLN C OXT sing N N 155 GLN CB CG sing N N 156 GLN CB HB2 sing N N 157 GLN CB HB3 sing N N 158 GLN CG CD sing N N 159 GLN CG HG2 sing N N 160 GLN CG HG3 sing N N 161 GLN CD OE1 doub N N 162 GLN CD NE2 sing N N 163 GLN NE2 HE21 sing N N 164 GLN NE2 HE22 sing N N 165 GLN OXT HXT sing N N 166 GLU N CA sing N N 167 GLU N H sing N N 168 GLU N H2 sing N N 169 GLU CA C sing N N 170 GLU CA CB sing N N 171 GLU CA HA sing N N 172 GLU C O doub N N 173 GLU C OXT sing N N 174 GLU CB CG sing N N 175 GLU CB HB2 sing N N 176 GLU CB HB3 sing N N 177 GLU CG CD sing N N 178 GLU CG HG2 sing N N 179 GLU CG HG3 sing N N 180 GLU CD OE1 doub N N 181 GLU CD OE2 sing N N 182 GLU OE2 HE2 sing N N 183 GLU OXT HXT sing N N 184 GLY N CA sing N N 185 GLY N H sing N N 186 GLY N H2 sing N N 187 GLY CA C sing N N 188 GLY CA HA2 sing N N 189 GLY CA HA3 sing N N 190 GLY C O doub N N 191 GLY C OXT sing N N 192 GLY OXT HXT sing N N 193 HIS N CA sing N N 194 HIS N H sing N N 195 HIS N H2 sing N N 196 HIS CA C sing N N 197 HIS CA CB sing N N 198 HIS CA HA sing N N 199 HIS C O doub N N 200 HIS C OXT sing N N 201 HIS CB CG sing N N 202 HIS CB HB2 sing N N 203 HIS CB HB3 sing N N 204 HIS CG ND1 sing Y N 205 HIS CG CD2 doub Y N 206 HIS ND1 CE1 doub Y N 207 HIS ND1 HD1 sing N N 208 HIS CD2 NE2 sing Y N 209 HIS CD2 HD2 sing N N 210 HIS CE1 NE2 sing Y N 211 HIS CE1 HE1 sing N N 212 HIS NE2 HE2 sing N N 213 HIS OXT HXT sing N N 214 ILE N CA sing N N 215 ILE N H sing N N 216 ILE N H2 sing N N 217 ILE CA C sing N N 218 ILE CA CB sing N N 219 ILE CA HA sing N N 220 ILE C O doub N N 221 ILE C OXT sing N N 222 ILE CB CG1 sing N N 223 ILE CB CG2 sing N N 224 ILE CB HB sing N N 225 ILE CG1 CD1 sing N N 226 ILE CG1 HG12 sing N N 227 ILE CG1 HG13 sing N N 228 ILE CG2 HG21 sing N N 229 ILE CG2 HG22 sing N N 230 ILE CG2 HG23 sing N N 231 ILE CD1 HD11 sing N N 232 ILE CD1 HD12 sing N N 233 ILE CD1 HD13 sing N N 234 ILE OXT HXT sing N N 235 LEU N CA sing N N 236 LEU N H sing N N 237 LEU N H2 sing N N 238 LEU CA C sing N N 239 LEU CA CB sing N N 240 LEU CA HA sing N N 241 LEU C O doub N N 242 LEU C OXT sing N N 243 LEU CB CG sing N N 244 LEU CB HB2 sing N N 245 LEU CB HB3 sing N N 246 LEU CG CD1 sing N N 247 LEU CG CD2 sing N N 248 LEU CG HG sing N N 249 LEU CD1 HD11 sing N N 250 LEU CD1 HD12 sing N N 251 LEU CD1 HD13 sing N N 252 LEU CD2 HD21 sing N N 253 LEU CD2 HD22 sing N N 254 LEU CD2 HD23 sing N N 255 LEU OXT HXT sing N N 256 LYS N CA sing N N 257 LYS N H sing N N 258 LYS N H2 sing N N 259 LYS CA C sing N N 260 LYS CA CB sing N N 261 LYS CA HA sing N N 262 LYS C O doub N N 263 LYS C OXT sing N N 264 LYS CB CG sing N N 265 LYS CB HB2 sing N N 266 LYS CB HB3 sing N N 267 LYS CG CD sing N N 268 LYS CG HG2 sing N N 269 LYS CG HG3 sing N N 270 LYS CD CE sing N N 271 LYS CD HD2 sing N N 272 LYS CD HD3 sing N N 273 LYS CE NZ sing N N 274 LYS CE HE2 sing N N 275 LYS CE HE3 sing N N 276 LYS NZ HZ1 sing N N 277 LYS NZ HZ2 sing N N 278 LYS NZ HZ3 sing N N 279 LYS OXT HXT sing N N 280 NH2 N HN1 sing N N 281 NH2 N HN2 sing N N 282 PHE N CA sing N N 283 PHE N H sing N N 284 PHE N H2 sing N N 285 PHE CA C sing N N 286 PHE CA CB sing N N 287 PHE CA HA sing N N 288 PHE C O doub N N 289 PHE C OXT sing N N 290 PHE CB CG sing N N 291 PHE CB HB2 sing N N 292 PHE CB HB3 sing N N 293 PHE CG CD1 doub Y N 294 PHE CG CD2 sing Y N 295 PHE CD1 CE1 sing Y N 296 PHE CD1 HD1 sing N N 297 PHE CD2 CE2 doub Y N 298 PHE CD2 HD2 sing N N 299 PHE CE1 CZ doub Y N 300 PHE CE1 HE1 sing N N 301 PHE CE2 CZ sing Y N 302 PHE CE2 HE2 sing N N 303 PHE CZ HZ sing N N 304 PHE OXT HXT sing N N 305 PRO N CA sing N N 306 PRO N CD sing N N 307 PRO N H sing N N 308 PRO CA C sing N N 309 PRO CA CB sing N N 310 PRO CA HA sing N N 311 PRO C O doub N N 312 PRO C OXT sing N N 313 PRO CB CG sing N N 314 PRO CB HB2 sing N N 315 PRO CB HB3 sing N N 316 PRO CG CD sing N N 317 PRO CG HG2 sing N N 318 PRO CG HG3 sing N N 319 PRO CD HD2 sing N N 320 PRO CD HD3 sing N N 321 PRO OXT HXT sing N N 322 SER N CA sing N N 323 SER N H sing N N 324 SER N H2 sing N N 325 SER CA C sing N N 326 SER CA CB sing N N 327 SER CA HA sing N N 328 SER C O doub N N 329 SER C OXT sing N N 330 SER CB OG sing N N 331 SER CB HB2 sing N N 332 SER CB HB3 sing N N 333 SER OG HG sing N N 334 SER OXT HXT sing N N 335 THR N CA sing N N 336 THR N H sing N N 337 THR N H2 sing N N 338 THR CA C sing N N 339 THR CA CB sing N N 340 THR CA HA sing N N 341 THR C O doub N N 342 THR C OXT sing N N 343 THR CB OG1 sing N N 344 THR CB CG2 sing N N 345 THR CB HB sing N N 346 THR OG1 HG1 sing N N 347 THR CG2 HG21 sing N N 348 THR CG2 HG22 sing N N 349 THR CG2 HG23 sing N N 350 THR OXT HXT sing N N 351 TRP N CA sing N N 352 TRP N H sing N N 353 TRP N H2 sing N N 354 TRP CA C sing N N 355 TRP CA CB sing N N 356 TRP CA HA sing N N 357 TRP C O doub N N 358 TRP C OXT sing N N 359 TRP CB CG sing N N 360 TRP CB HB2 sing N N 361 TRP CB HB3 sing N N 362 TRP CG CD1 doub Y N 363 TRP CG CD2 sing Y N 364 TRP CD1 NE1 sing Y N 365 TRP CD1 HD1 sing N N 366 TRP CD2 CE2 doub Y N 367 TRP CD2 CE3 sing Y N 368 TRP NE1 CE2 sing Y N 369 TRP NE1 HE1 sing N N 370 TRP CE2 CZ2 sing Y N 371 TRP CE3 CZ3 doub Y N 372 TRP CE3 HE3 sing N N 373 TRP CZ2 CH2 doub Y N 374 TRP CZ2 HZ2 sing N N 375 TRP CZ3 CH2 sing Y N 376 TRP CZ3 HZ3 sing N N 377 TRP CH2 HH2 sing N N 378 TRP OXT HXT sing N N 379 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 1 ? Bruker 700 'AVANCE I' 2 2 ? Bruker 500 'AVANCE II' # _atom_sites.entry_id 5NIQ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_