data_5NQY # _entry.id 5NQY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5NQY pdb_00005nqy 10.2210/pdb5nqy/pdb WWPDB D_1200004559 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-02-28 2 'Structure model' 1 1 2018-03-28 3 'Structure model' 1 2 2024-01-17 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.pdbx_database_id_PubMed' 5 2 'Structure model' '_citation.title' 6 3 'Structure model' '_database_2.pdbx_DOI' 7 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5NQY _pdbx_database_status.recvd_initial_deposition_date 2017-04-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Johnson, S.' 1 0000-0002-7877-3543 'Hollingshead, S.' 2 ? 'Lea, S.M.' 3 0000-0001-9287-8053 'Tang, C.M.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 9 _citation.language ? _citation.page_first 1051 _citation.page_last 1051 _citation.title 'Structure-based design of chimeric antigens for multivalent protein vaccines.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-018-03146-7 _citation.pdbx_database_id_PubMed 29535307 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hollingshead, S.' 1 ? primary 'Jongerius, I.' 2 ? primary 'Exley, R.M.' 3 ? primary 'Johnson, S.' 4 ? primary 'Lea, S.M.' 5 ? primary 'Tang, C.M.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Factor H binding protein variant B16_001,Major outer membrane protein P.IA,Factor H binding protein variant B16_001' 29319.635 1 ? ? ? ? 2 water nat water 18.015 4 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Factor H binding protein variant B16_002,Factor H binding protein variant B16_003,Factor H binding protein variant B16_004,Factor H binding protein variant B16_005,Factor H binding protein variant B16_006,Putative lipoprotein,Protein IA,Class 1 protein,Factor H binding protein variant B16_002,Factor H binding protein variant B16_003,Factor H binding protein variant B16_004,Factor H binding protein variant B16_005,Factor H binding protein variant B16_006,Putative lipoprotein ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MVAADIGAGLADALTAPLDHKDKSLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDG QLITLESGEFQVYKQSHSALTALQTEQVQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDASGKL TYTIDFAAKQGHGKIEHLKSPELNVDLAASDIKPDKKRHAVISGSVLYNQAEKGSYSLGIFGGQAQEVAGSAEVETAYYT KDTNNNLTLVPGIRHIGLAAKQLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MVAADIGAGLADALTAPLDHKDKSLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDG QLITLESGEFQVYKQSHSALTALQTEQVQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDASGKL TYTIDFAAKQGHGKIEHLKSPELNVDLAASDIKPDKKRHAVISGSVLYNQAEKGSYSLGIFGGQAQEVAGSAEVETAYYT KDTNNNLTLVPGIRHIGLAAKQLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 ALA n 1 4 ALA n 1 5 ASP n 1 6 ILE n 1 7 GLY n 1 8 ALA n 1 9 GLY n 1 10 LEU n 1 11 ALA n 1 12 ASP n 1 13 ALA n 1 14 LEU n 1 15 THR n 1 16 ALA n 1 17 PRO n 1 18 LEU n 1 19 ASP n 1 20 HIS n 1 21 LYS n 1 22 ASP n 1 23 LYS n 1 24 SER n 1 25 LEU n 1 26 GLN n 1 27 SER n 1 28 LEU n 1 29 THR n 1 30 LEU n 1 31 ASP n 1 32 GLN n 1 33 SER n 1 34 VAL n 1 35 ARG n 1 36 LYS n 1 37 ASN n 1 38 GLU n 1 39 LYS n 1 40 LEU n 1 41 LYS n 1 42 LEU n 1 43 ALA n 1 44 ALA n 1 45 GLN n 1 46 GLY n 1 47 ALA n 1 48 GLU n 1 49 LYS n 1 50 THR n 1 51 TYR n 1 52 GLY n 1 53 ASN n 1 54 GLY n 1 55 ASP n 1 56 SER n 1 57 LEU n 1 58 ASN n 1 59 THR n 1 60 GLY n 1 61 LYS n 1 62 LEU n 1 63 LYS n 1 64 ASN n 1 65 ASP n 1 66 LYS n 1 67 VAL n 1 68 SER n 1 69 ARG n 1 70 PHE n 1 71 ASP n 1 72 PHE n 1 73 ILE n 1 74 ARG n 1 75 GLN n 1 76 ILE n 1 77 GLU n 1 78 VAL n 1 79 ASP n 1 80 GLY n 1 81 GLN n 1 82 LEU n 1 83 ILE n 1 84 THR n 1 85 LEU n 1 86 GLU n 1 87 SER n 1 88 GLY n 1 89 GLU n 1 90 PHE n 1 91 GLN n 1 92 VAL n 1 93 TYR n 1 94 LYS n 1 95 GLN n 1 96 SER n 1 97 HIS n 1 98 SER n 1 99 ALA n 1 100 LEU n 1 101 THR n 1 102 ALA n 1 103 LEU n 1 104 GLN n 1 105 THR n 1 106 GLU n 1 107 GLN n 1 108 VAL n 1 109 GLN n 1 110 ASP n 1 111 SER n 1 112 GLU n 1 113 HIS n 1 114 SER n 1 115 GLY n 1 116 LYS n 1 117 MET n 1 118 VAL n 1 119 ALA n 1 120 LYS n 1 121 ARG n 1 122 GLN n 1 123 PHE n 1 124 ARG n 1 125 ILE n 1 126 GLY n 1 127 ASP n 1 128 ILE n 1 129 ALA n 1 130 GLY n 1 131 GLU n 1 132 HIS n 1 133 THR n 1 134 SER n 1 135 PHE n 1 136 ASP n 1 137 LYS n 1 138 LEU n 1 139 PRO n 1 140 GLU n 1 141 GLY n 1 142 GLY n 1 143 ARG n 1 144 ALA n 1 145 THR n 1 146 TYR n 1 147 ARG n 1 148 GLY n 1 149 THR n 1 150 ALA n 1 151 PHE n 1 152 GLY n 1 153 SER n 1 154 ASP n 1 155 ASP n 1 156 ALA n 1 157 SER n 1 158 GLY n 1 159 LYS n 1 160 LEU n 1 161 THR n 1 162 TYR n 1 163 THR n 1 164 ILE n 1 165 ASP n 1 166 PHE n 1 167 ALA n 1 168 ALA n 1 169 LYS n 1 170 GLN n 1 171 GLY n 1 172 HIS n 1 173 GLY n 1 174 LYS n 1 175 ILE n 1 176 GLU n 1 177 HIS n 1 178 LEU n 1 179 LYS n 1 180 SER n 1 181 PRO n 1 182 GLU n 1 183 LEU n 1 184 ASN n 1 185 VAL n 1 186 ASP n 1 187 LEU n 1 188 ALA n 1 189 ALA n 1 190 SER n 1 191 ASP n 1 192 ILE n 1 193 LYS n 1 194 PRO n 1 195 ASP n 1 196 LYS n 1 197 LYS n 1 198 ARG n 1 199 HIS n 1 200 ALA n 1 201 VAL n 1 202 ILE n 1 203 SER n 1 204 GLY n 1 205 SER n 1 206 VAL n 1 207 LEU n 1 208 TYR n 1 209 ASN n 1 210 GLN n 1 211 ALA n 1 212 GLU n 1 213 LYS n 1 214 GLY n 1 215 SER n 1 216 TYR n 1 217 SER n 1 218 LEU n 1 219 GLY n 1 220 ILE n 1 221 PHE n 1 222 GLY n 1 223 GLY n 1 224 GLN n 1 225 ALA n 1 226 GLN n 1 227 GLU n 1 228 VAL n 1 229 ALA n 1 230 GLY n 1 231 SER n 1 232 ALA n 1 233 GLU n 1 234 VAL n 1 235 GLU n 1 236 THR n 1 237 ALA n 1 238 TYR n 1 239 TYR n 1 240 THR n 1 241 LYS n 1 242 ASP n 1 243 THR n 1 244 ASN n 1 245 ASN n 1 246 ASN n 1 247 LEU n 1 248 THR n 1 249 LEU n 1 250 VAL n 1 251 PRO n 1 252 GLY n 1 253 ILE n 1 254 ARG n 1 255 HIS n 1 256 ILE n 1 257 GLY n 1 258 LEU n 1 259 ALA n 1 260 ALA n 1 261 LYS n 1 262 GLN n 1 263 LEU n 1 264 GLU n 1 265 HIS n 1 266 HIS n 1 267 HIS n 1 268 HIS n 1 269 HIS n 1 270 HIS n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 237 ? ? fhbp ? ? ? ? ? ? 'Neisseria meningitidis' 487 V1.4 ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? B834 ? ? ? ? ? ? ? ? ? ? pET21b ? ? 1 2 sample 'Biological sequence' 238 251 ? ? porA ? ? ? ? ? ? 'Neisseria meningitidis serogroup C' 135720 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? B834 ? ? ? ? ? ? ? ? ? ? pET21b ? ? 1 3 sample 'Biological sequence' 252 270 ? ? fhbp ? ? ? ? ? ? 'Neisseria meningitidis' 487 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? B834 ? ? ? ? ? ? ? ? ? ? pET21b ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 72 ? ? ? A . n A 1 2 VAL 2 73 ? ? ? A . n A 1 3 ALA 3 74 ? ? ? A . n A 1 4 ALA 4 75 ? ? ? A . n A 1 5 ASP 5 76 ? ? ? A . n A 1 6 ILE 6 77 ? ? ? A . n A 1 7 GLY 7 78 78 GLY GLY A . n A 1 8 ALA 8 79 79 ALA ALA A . n A 1 9 GLY 9 80 80 GLY GLY A . n A 1 10 LEU 10 81 81 LEU LEU A . n A 1 11 ALA 11 82 82 ALA ALA A . n A 1 12 ASP 12 83 83 ASP ASP A . n A 1 13 ALA 13 84 84 ALA ALA A . n A 1 14 LEU 14 85 85 LEU LEU A . n A 1 15 THR 15 86 86 THR THR A . n A 1 16 ALA 16 87 87 ALA ALA A . n A 1 17 PRO 17 88 88 PRO PRO A . n A 1 18 LEU 18 89 89 LEU LEU A . n A 1 19 ASP 19 90 90 ASP ASP A . n A 1 20 HIS 20 91 91 HIS HIS A . n A 1 21 LYS 21 92 92 LYS LYS A . n A 1 22 ASP 22 93 93 ASP ASP A . n A 1 23 LYS 23 94 94 LYS LYS A . n A 1 24 SER 24 95 95 SER SER A . n A 1 25 LEU 25 96 96 LEU LEU A . n A 1 26 GLN 26 97 97 GLN GLN A . n A 1 27 SER 27 98 98 SER SER A . n A 1 28 LEU 28 99 99 LEU LEU A . n A 1 29 THR 29 100 100 THR THR A . n A 1 30 LEU 30 101 101 LEU LEU A . n A 1 31 ASP 31 102 102 ASP ASP A . n A 1 32 GLN 32 103 103 GLN GLN A . n A 1 33 SER 33 104 104 SER SER A . n A 1 34 VAL 34 105 105 VAL VAL A . n A 1 35 ARG 35 106 106 ARG ARG A . n A 1 36 LYS 36 107 107 LYS LYS A . n A 1 37 ASN 37 108 108 ASN ASN A . n A 1 38 GLU 38 109 109 GLU GLU A . n A 1 39 LYS 39 110 110 LYS LYS A . n A 1 40 LEU 40 111 111 LEU LEU A . n A 1 41 LYS 41 112 112 LYS LYS A . n A 1 42 LEU 42 113 113 LEU LEU A . n A 1 43 ALA 43 114 114 ALA ALA A . n A 1 44 ALA 44 115 115 ALA ALA A . n A 1 45 GLN 45 116 116 GLN GLN A . n A 1 46 GLY 46 117 117 GLY GLY A . n A 1 47 ALA 47 118 118 ALA ALA A . n A 1 48 GLU 48 119 119 GLU GLU A . n A 1 49 LYS 49 120 120 LYS LYS A . n A 1 50 THR 50 121 121 THR THR A . n A 1 51 TYR 51 122 122 TYR TYR A . n A 1 52 GLY 52 123 123 GLY GLY A . n A 1 53 ASN 53 124 124 ASN ASN A . n A 1 54 GLY 54 125 125 GLY GLY A . n A 1 55 ASP 55 126 126 ASP ASP A . n A 1 56 SER 56 127 127 SER SER A . n A 1 57 LEU 57 128 128 LEU LEU A . n A 1 58 ASN 58 129 129 ASN ASN A . n A 1 59 THR 59 130 130 THR THR A . n A 1 60 GLY 60 131 131 GLY GLY A . n A 1 61 LYS 61 132 132 LYS LYS A . n A 1 62 LEU 62 133 133 LEU LEU A . n A 1 63 LYS 63 134 134 LYS LYS A . n A 1 64 ASN 64 135 135 ASN ASN A . n A 1 65 ASP 65 136 136 ASP ASP A . n A 1 66 LYS 66 137 137 LYS LYS A . n A 1 67 VAL 67 138 138 VAL VAL A . n A 1 68 SER 68 139 139 SER SER A . n A 1 69 ARG 69 140 140 ARG ARG A . n A 1 70 PHE 70 141 141 PHE PHE A . n A 1 71 ASP 71 142 142 ASP ASP A . n A 1 72 PHE 72 143 143 PHE PHE A . n A 1 73 ILE 73 144 144 ILE ILE A . n A 1 74 ARG 74 145 145 ARG ARG A . n A 1 75 GLN 75 146 146 GLN GLN A . n A 1 76 ILE 76 147 147 ILE ILE A . n A 1 77 GLU 77 148 148 GLU GLU A . n A 1 78 VAL 78 149 149 VAL VAL A . n A 1 79 ASP 79 150 150 ASP ASP A . n A 1 80 GLY 80 151 151 GLY GLY A . n A 1 81 GLN 81 152 152 GLN GLN A . n A 1 82 LEU 82 153 153 LEU LEU A . n A 1 83 ILE 83 154 154 ILE ILE A . n A 1 84 THR 84 155 155 THR THR A . n A 1 85 LEU 85 156 156 LEU LEU A . n A 1 86 GLU 86 157 157 GLU GLU A . n A 1 87 SER 87 158 158 SER SER A . n A 1 88 GLY 88 159 159 GLY GLY A . n A 1 89 GLU 89 160 160 GLU GLU A . n A 1 90 PHE 90 161 161 PHE PHE A . n A 1 91 GLN 91 162 162 GLN GLN A . n A 1 92 VAL 92 163 163 VAL VAL A . n A 1 93 TYR 93 164 164 TYR TYR A . n A 1 94 LYS 94 165 165 LYS LYS A . n A 1 95 GLN 95 166 166 GLN GLN A . n A 1 96 SER 96 167 167 SER SER A . n A 1 97 HIS 97 168 168 HIS HIS A . n A 1 98 SER 98 169 169 SER SER A . n A 1 99 ALA 99 170 170 ALA ALA A . n A 1 100 LEU 100 171 171 LEU LEU A . n A 1 101 THR 101 172 172 THR THR A . n A 1 102 ALA 102 173 173 ALA ALA A . n A 1 103 LEU 103 174 174 LEU LEU A . n A 1 104 GLN 104 175 175 GLN GLN A . n A 1 105 THR 105 176 176 THR THR A . n A 1 106 GLU 106 177 177 GLU GLU A . n A 1 107 GLN 107 178 178 GLN GLN A . n A 1 108 VAL 108 179 179 VAL VAL A . n A 1 109 GLN 109 180 180 GLN GLN A . n A 1 110 ASP 110 181 181 ASP ASP A . n A 1 111 SER 111 182 ? ? ? A . n A 1 112 GLU 112 183 ? ? ? A . n A 1 113 HIS 113 184 ? ? ? A . n A 1 114 SER 114 185 185 SER SER A . n A 1 115 GLY 115 186 186 GLY GLY A . n A 1 116 LYS 116 187 187 LYS LYS A . n A 1 117 MET 117 188 188 MET MET A . n A 1 118 VAL 118 189 189 VAL VAL A . n A 1 119 ALA 119 190 190 ALA ALA A . n A 1 120 LYS 120 191 191 LYS LYS A . n A 1 121 ARG 121 192 192 ARG ARG A . n A 1 122 GLN 122 193 193 GLN GLN A . n A 1 123 PHE 123 194 194 PHE PHE A . n A 1 124 ARG 124 195 195 ARG ARG A . n A 1 125 ILE 125 196 196 ILE ILE A . n A 1 126 GLY 126 197 197 GLY GLY A . n A 1 127 ASP 127 198 198 ASP ASP A . n A 1 128 ILE 128 199 199 ILE ILE A . n A 1 129 ALA 129 200 200 ALA ALA A . n A 1 130 GLY 130 201 201 GLY GLY A . n A 1 131 GLU 131 202 202 GLU GLU A . n A 1 132 HIS 132 203 203 HIS HIS A . n A 1 133 THR 133 204 204 THR THR A . n A 1 134 SER 134 205 205 SER SER A . n A 1 135 PHE 135 206 206 PHE PHE A . n A 1 136 ASP 136 207 207 ASP ASP A . n A 1 137 LYS 137 208 208 LYS LYS A . n A 1 138 LEU 138 209 209 LEU LEU A . n A 1 139 PRO 139 210 210 PRO PRO A . n A 1 140 GLU 140 211 211 GLU GLU A . n A 1 141 GLY 141 212 212 GLY GLY A . n A 1 142 GLY 142 213 213 GLY GLY A . n A 1 143 ARG 143 214 214 ARG ARG A . n A 1 144 ALA 144 215 215 ALA ALA A . n A 1 145 THR 145 216 216 THR THR A . n A 1 146 TYR 146 217 217 TYR TYR A . n A 1 147 ARG 147 218 218 ARG ARG A . n A 1 148 GLY 148 219 219 GLY GLY A . n A 1 149 THR 149 220 220 THR THR A . n A 1 150 ALA 150 221 221 ALA ALA A . n A 1 151 PHE 151 222 222 PHE PHE A . n A 1 152 GLY 152 223 223 GLY GLY A . n A 1 153 SER 153 224 224 SER SER A . n A 1 154 ASP 154 225 225 ASP ASP A . n A 1 155 ASP 155 226 226 ASP ASP A . n A 1 156 ALA 156 227 227 ALA ALA A . n A 1 157 SER 157 228 228 SER SER A . n A 1 158 GLY 158 229 229 GLY GLY A . n A 1 159 LYS 159 230 230 LYS LYS A . n A 1 160 LEU 160 231 231 LEU LEU A . n A 1 161 THR 161 232 232 THR THR A . n A 1 162 TYR 162 233 233 TYR TYR A . n A 1 163 THR 163 234 234 THR THR A . n A 1 164 ILE 164 235 235 ILE ILE A . n A 1 165 ASP 165 236 236 ASP ASP A . n A 1 166 PHE 166 237 237 PHE PHE A . n A 1 167 ALA 167 238 238 ALA ALA A . n A 1 168 ALA 168 239 239 ALA ALA A . n A 1 169 LYS 169 240 240 LYS LYS A . n A 1 170 GLN 170 241 241 GLN GLN A . n A 1 171 GLY 171 242 242 GLY GLY A . n A 1 172 HIS 172 243 243 HIS HIS A . n A 1 173 GLY 173 244 244 GLY GLY A . n A 1 174 LYS 174 245 245 LYS LYS A . n A 1 175 ILE 175 246 246 ILE ILE A . n A 1 176 GLU 176 247 247 GLU GLU A . n A 1 177 HIS 177 248 248 HIS HIS A . n A 1 178 LEU 178 249 249 LEU LEU A . n A 1 179 LYS 179 250 250 LYS LYS A . n A 1 180 SER 180 251 251 SER SER A . n A 1 181 PRO 181 252 252 PRO PRO A . n A 1 182 GLU 182 253 253 GLU GLU A . n A 1 183 LEU 183 254 254 LEU LEU A . n A 1 184 ASN 184 255 255 ASN ASN A . n A 1 185 VAL 185 256 256 VAL VAL A . n A 1 186 ASP 186 257 257 ASP ASP A . n A 1 187 LEU 187 258 258 LEU LEU A . n A 1 188 ALA 188 259 259 ALA ALA A . n A 1 189 ALA 189 260 260 ALA ALA A . n A 1 190 SER 190 261 261 SER SER A . n A 1 191 ASP 191 262 262 ASP ASP A . n A 1 192 ILE 192 263 263 ILE ILE A . n A 1 193 LYS 193 264 264 LYS LYS A . n A 1 194 PRO 194 265 265 PRO PRO A . n A 1 195 ASP 195 266 266 ASP ASP A . n A 1 196 LYS 196 267 267 LYS LYS A . n A 1 197 LYS 197 268 268 LYS LYS A . n A 1 198 ARG 198 269 269 ARG ARG A . n A 1 199 HIS 199 270 270 HIS HIS A . n A 1 200 ALA 200 271 271 ALA ALA A . n A 1 201 VAL 201 272 272 VAL VAL A . n A 1 202 ILE 202 273 273 ILE ILE A . n A 1 203 SER 203 274 274 SER SER A . n A 1 204 GLY 204 275 275 GLY GLY A . n A 1 205 SER 205 276 276 SER SER A . n A 1 206 VAL 206 277 277 VAL VAL A . n A 1 207 LEU 207 278 278 LEU LEU A . n A 1 208 TYR 208 279 279 TYR TYR A . n A 1 209 ASN 209 280 280 ASN ASN A . n A 1 210 GLN 210 281 281 GLN GLN A . n A 1 211 ALA 211 282 282 ALA ALA A . n A 1 212 GLU 212 283 283 GLU GLU A . n A 1 213 LYS 213 284 284 LYS LYS A . n A 1 214 GLY 214 285 285 GLY GLY A . n A 1 215 SER 215 286 286 SER SER A . n A 1 216 TYR 216 287 287 TYR TYR A . n A 1 217 SER 217 288 288 SER SER A . n A 1 218 LEU 218 289 289 LEU LEU A . n A 1 219 GLY 219 290 290 GLY GLY A . n A 1 220 ILE 220 291 291 ILE ILE A . n A 1 221 PHE 221 292 292 PHE PHE A . n A 1 222 GLY 222 293 293 GLY GLY A . n A 1 223 GLY 223 294 294 GLY GLY A . n A 1 224 GLN 224 295 295 GLN GLN A . n A 1 225 ALA 225 296 296 ALA ALA A . n A 1 226 GLN 226 297 297 GLN GLN A . n A 1 227 GLU 227 298 298 GLU GLU A . n A 1 228 VAL 228 299 299 VAL VAL A . n A 1 229 ALA 229 300 300 ALA ALA A . n A 1 230 GLY 230 301 301 GLY GLY A . n A 1 231 SER 231 302 302 SER SER A . n A 1 232 ALA 232 303 303 ALA ALA A . n A 1 233 GLU 233 304 304 GLU GLU A . n A 1 234 VAL 234 305 305 VAL VAL A . n A 1 235 GLU 235 306 306 GLU GLU A . n A 1 236 THR 236 307 307 THR THR A . n A 1 237 ALA 237 308 308 ALA ALA A . n A 1 238 TYR 238 308 308 TYR TYR A A n A 1 239 TYR 239 308 308 TYR TYR A B n A 1 240 THR 240 308 308 THR THR A C n A 1 241 LYS 241 308 308 LYS LYS A D n A 1 242 ASP 242 308 308 ASP ASP A E n A 1 243 THR 243 308 308 THR THR A F n A 1 244 ASN 244 308 308 ASN ASN A G n A 1 245 ASN 245 308 308 ASN ASN A H n A 1 246 ASN 246 308 308 ASN ASN A I n A 1 247 LEU 247 308 308 LEU LEU A J n A 1 248 THR 248 308 308 THR THR A K n A 1 249 LEU 249 308 308 LEU LEU A L n A 1 250 VAL 250 308 308 VAL VAL A M n A 1 251 PRO 251 309 309 PRO PRO A . n A 1 252 GLY 252 310 310 GLY GLY A . n A 1 253 ILE 253 311 311 ILE ILE A . n A 1 254 ARG 254 312 312 ARG ARG A . n A 1 255 HIS 255 313 313 HIS HIS A . n A 1 256 ILE 256 314 314 ILE ILE A . n A 1 257 GLY 257 315 315 GLY GLY A . n A 1 258 LEU 258 316 316 LEU LEU A . n A 1 259 ALA 259 317 317 ALA ALA A . n A 1 260 ALA 260 318 318 ALA ALA A . n A 1 261 LYS 261 319 319 LYS LYS A . n A 1 262 GLN 262 320 320 GLN GLN A . n A 1 263 LEU 263 321 321 LEU LEU A . n A 1 264 GLU 264 322 322 GLU GLU A . n A 1 265 HIS 265 323 323 HIS HIS A . n A 1 266 HIS 266 324 324 HIS HIS A . n A 1 267 HIS 267 325 325 HIS HIS A . n A 1 268 HIS 268 326 326 HIS HIS A . n A 1 269 HIS 269 327 327 HIS HIS A . n A 1 270 HIS 270 328 328 HIS HIS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 401 3 HOH HOH A . B 2 HOH 2 402 1 HOH HOH A . B 2 HOH 3 403 4 HOH HOH A . B 2 HOH 4 404 2 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.10_2155: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5NQY _cell.details ? _cell.formula_units_Z ? _cell.length_a 56.850 _cell.length_a_esd ? _cell.length_b 62.640 _cell.length_b_esd ? _cell.length_c 88.690 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5NQY _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5NQY _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.69 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 54 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 294 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2M potassium formate, 20%(w/v) PEG3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-09-30 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97623 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID29' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97623 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID29 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5NQY _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.60 _reflns.d_resolution_low 51.17 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10208 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.6 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.4 _reflns.pdbx_Rmerge_I_obs 0.073 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 16.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.032 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.60 _reflns_shell.d_res_low 2.67 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.3 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 743 _reflns_shell.percent_possible_all 99.4 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.845 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 6.6 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.356 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5NQY _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.600 _refine.ls_d_res_low 51.165 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10163 _refine.ls_number_reflns_R_free 498 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.47 _refine.ls_percent_reflns_R_free 4.90 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2285 _refine.ls_R_factor_R_free 0.2708 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2264 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4ayd _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 31.78 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.30 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1998 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 4 _refine_hist.number_atoms_total 2002 _refine_hist.d_res_high 2.600 _refine_hist.d_res_low 51.165 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.002 ? 2030 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.449 ? 2730 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 9.408 ? 1218 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.042 ? 300 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 360 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.6002 2.8618 . . 120 2369 99.00 . . . 0.4200 . 0.3510 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8618 3.2759 . . 115 2377 99.00 . . . 0.3393 . 0.3025 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2759 4.1270 . . 128 2387 100.00 . . . 0.2779 . 0.2314 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.1270 51.1752 . . 135 2532 100.00 . . . 0.2188 . 0.1795 . . . . . . . . . . # _struct.entry_id 5NQY _struct.title 'Structure of a fHbp(V1.4):PorA(P1.16) chimera. Fusion at fHbp position 309.' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5NQY _struct_keywords.text 'Meningitis, Vaccine, Complement, Chimeric, Immune system' _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP Q6VS06_NEIME Q6VS06 ? 1 ;VAADIGAGLADALTAPLDHKDKSLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQ LITLESGEFQVYKQSHSALTALQTEQVQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDASGKLT YTIDFAAKQGHGKIEHLKSPELNVDLAASDIKPDKKRHAVISGSVLYNQAEKGSYSLGIFGGQAQEVAGSAEVETA ; 8 2 UNP OMPA1_NEIMC P13415 ? 1 YYTKDTNNNLTLVP 195 3 UNP Q6VS06_NEIME Q6VS06 ? 1 GIRHIGLAAKQ 245 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5NQY A 2 ? 237 ? Q6VS06 8 ? 243 ? 73 308 2 2 5NQY A 238 A 251 ? P13415 195 ? 208 ? 308 309 3 3 5NQY A 252 ? 262 ? Q6VS06 245 ? 255 ? 310 320 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5NQY MET A 1 ? UNP Q6VS06 ? ? 'initiating methionine' 72 1 3 5NQY LEU A 263 ? UNP Q6VS06 ? ? 'expression tag' 321 2 3 5NQY GLU A 264 ? UNP Q6VS06 ? ? 'expression tag' 322 3 3 5NQY HIS A 265 ? UNP Q6VS06 ? ? 'expression tag' 323 4 3 5NQY HIS A 266 ? UNP Q6VS06 ? ? 'expression tag' 324 5 3 5NQY HIS A 267 ? UNP Q6VS06 ? ? 'expression tag' 325 6 3 5NQY HIS A 268 ? UNP Q6VS06 ? ? 'expression tag' 326 7 3 5NQY HIS A 269 ? UNP Q6VS06 ? ? 'expression tag' 327 8 3 5NQY HIS A 270 ? UNP Q6VS06 ? ? 'expression tag' 328 9 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 13870 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support homology _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 11 ? ALA A 16 ? ALA A 82 ALA A 87 1 ? 6 HELX_P HELX_P2 AA2 ASN A 58 ? LEU A 62 ? ASN A 129 LEU A 133 5 ? 5 HELX_P HELX_P3 AA3 SER A 134 ? LEU A 138 ? SER A 205 LEU A 209 5 ? 5 HELX_P HELX_P4 AA4 SER A 180 ? ASN A 184 ? SER A 251 ASN A 255 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 6 ? AA3 ? 9 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel AA3 5 6 ? anti-parallel AA3 6 7 ? anti-parallel AA3 7 8 ? anti-parallel AA3 8 9 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 28 ? THR A 29 ? LEU A 99 THR A 100 AA1 2 SER A 56 ? LEU A 57 ? SER A 127 LEU A 128 AA2 1 GLU A 48 ? GLY A 52 ? GLU A 119 GLY A 123 AA2 2 LYS A 39 ? ALA A 43 ? LYS A 110 ALA A 114 AA2 3 VAL A 67 ? GLU A 77 ? VAL A 138 GLU A 148 AA2 4 LEU A 82 ? LYS A 94 ? LEU A 153 LYS A 165 AA2 5 SER A 98 ? GLN A 107 ? SER A 169 GLN A 178 AA2 6 GLN A 122 ? GLY A 130 ? GLN A 193 GLY A 201 AA3 1 ARG A 143 ? GLY A 152 ? ARG A 214 GLY A 223 AA3 2 ASP A 155 ? ASP A 165 ? ASP A 226 ASP A 236 AA3 3 GLN A 170 ? GLU A 176 ? GLN A 241 GLU A 247 AA3 4 ASP A 186 ? PRO A 194 ? ASP A 257 PRO A 265 AA3 5 ALA A 200 ? LEU A 207 ? ALA A 271 LEU A 278 AA3 6 GLU A 212 ? PHE A 221 ? GLU A 283 PHE A 292 AA3 7 GLU A 227 ? LYS A 241 D GLU A 298 LYS A 308 AA3 8 LEU A 247 J GLN A 262 ? LEU A 308 GLN A 320 AA3 9 ARG A 143 ? GLY A 152 ? ARG A 214 GLY A 223 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 28 ? N LEU A 99 O LEU A 57 ? O LEU A 128 AA2 1 2 O TYR A 51 ? O TYR A 122 N LEU A 40 ? N LEU A 111 AA2 2 3 N LYS A 39 ? N LYS A 110 O GLN A 75 ? O GLN A 146 AA2 3 4 N ILE A 76 ? N ILE A 147 O ILE A 83 ? O ILE A 154 AA2 4 5 N SER A 87 ? N SER A 158 O GLU A 106 ? O GLU A 177 AA2 5 6 N LEU A 103 ? N LEU A 174 O ARG A 124 ? O ARG A 195 AA3 1 2 N TYR A 146 ? N TYR A 217 O TYR A 162 ? O TYR A 233 AA3 2 3 N LYS A 159 ? N LYS A 230 O GLU A 176 ? O GLU A 247 AA3 3 4 N GLY A 173 ? N GLY A 244 O LEU A 187 ? O LEU A 258 AA3 4 5 N LYS A 193 ? N LYS A 264 O VAL A 201 ? O VAL A 272 AA3 5 6 N ILE A 202 ? N ILE A 273 O LEU A 218 ? O LEU A 289 AA3 6 7 N LYS A 213 ? N LYS A 284 O GLU A 235 ? O GLU A 306 AA3 7 8 N VAL A 228 ? N VAL A 299 O ALA A 260 ? O ALA A 318 AA3 8 9 O GLY A 257 ? O GLY A 315 N PHE A 151 ? N PHE A 222 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OE2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLU _pdbx_validate_close_contact.auth_seq_id_1 157 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 OG1 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 THR _pdbx_validate_close_contact.auth_seq_id_2 176 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.19 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 95 ? ? 63.80 -128.55 2 1 ASP A 102 ? ? -122.33 -69.31 3 1 LYS A 107 ? ? 61.13 -132.48 4 1 GLN A 116 ? ? 53.23 -118.49 5 1 ALA A 118 ? ? -109.50 -156.51 6 1 GLN A 166 ? ? -116.23 -167.17 7 1 GLN A 180 ? ? -82.03 -70.98 8 1 ASP A 266 ? ? -77.22 -160.25 # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 34.4842 -3.0794 50.6213 0.7126 0.5450 0.6240 0.0550 0.0790 0.0613 3.9940 1.6729 2.0880 0.2537 0.1600 0.5800 0.1548 0.1711 -0.0978 -0.1313 -0.0673 -0.3198 0.1815 0.3547 -0.1043 'X-RAY DIFFRACTION' 2 ? refined 13.8198 1.8722 54.9717 0.5918 0.4747 0.4970 0.0317 0.0949 0.0296 2.8976 1.6123 6.3984 -0.0471 1.2047 1.3617 0.0398 -0.2888 0.0397 -0.2019 -0.0847 0.0794 -0.1694 -0.5949 0.0107 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 79 through 201 ) ; 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 202 through 328 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 72 ? A MET 1 2 1 Y 1 A VAL 73 ? A VAL 2 3 1 Y 1 A ALA 74 ? A ALA 3 4 1 Y 1 A ALA 75 ? A ALA 4 5 1 Y 1 A ASP 76 ? A ASP 5 6 1 Y 1 A ILE 77 ? A ILE 6 7 1 Y 1 A SER 182 ? A SER 111 8 1 Y 1 A GLU 183 ? A GLU 112 9 1 Y 1 A HIS 184 ? A HIS 113 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 PHE N N N N 236 PHE CA C N S 237 PHE C C N N 238 PHE O O N N 239 PHE CB C N N 240 PHE CG C Y N 241 PHE CD1 C Y N 242 PHE CD2 C Y N 243 PHE CE1 C Y N 244 PHE CE2 C Y N 245 PHE CZ C Y N 246 PHE OXT O N N 247 PHE H H N N 248 PHE H2 H N N 249 PHE HA H N N 250 PHE HB2 H N N 251 PHE HB3 H N N 252 PHE HD1 H N N 253 PHE HD2 H N N 254 PHE HE1 H N N 255 PHE HE2 H N N 256 PHE HZ H N N 257 PHE HXT H N N 258 PRO N N N N 259 PRO CA C N S 260 PRO C C N N 261 PRO O O N N 262 PRO CB C N N 263 PRO CG C N N 264 PRO CD C N N 265 PRO OXT O N N 266 PRO H H N N 267 PRO HA H N N 268 PRO HB2 H N N 269 PRO HB3 H N N 270 PRO HG2 H N N 271 PRO HG3 H N N 272 PRO HD2 H N N 273 PRO HD3 H N N 274 PRO HXT H N N 275 SER N N N N 276 SER CA C N S 277 SER C C N N 278 SER O O N N 279 SER CB C N N 280 SER OG O N N 281 SER OXT O N N 282 SER H H N N 283 SER H2 H N N 284 SER HA H N N 285 SER HB2 H N N 286 SER HB3 H N N 287 SER HG H N N 288 SER HXT H N N 289 THR N N N N 290 THR CA C N S 291 THR C C N N 292 THR O O N N 293 THR CB C N R 294 THR OG1 O N N 295 THR CG2 C N N 296 THR OXT O N N 297 THR H H N N 298 THR H2 H N N 299 THR HA H N N 300 THR HB H N N 301 THR HG1 H N N 302 THR HG21 H N N 303 THR HG22 H N N 304 THR HG23 H N N 305 THR HXT H N N 306 TYR N N N N 307 TYR CA C N S 308 TYR C C N N 309 TYR O O N N 310 TYR CB C N N 311 TYR CG C Y N 312 TYR CD1 C Y N 313 TYR CD2 C Y N 314 TYR CE1 C Y N 315 TYR CE2 C Y N 316 TYR CZ C Y N 317 TYR OH O N N 318 TYR OXT O N N 319 TYR H H N N 320 TYR H2 H N N 321 TYR HA H N N 322 TYR HB2 H N N 323 TYR HB3 H N N 324 TYR HD1 H N N 325 TYR HD2 H N N 326 TYR HE1 H N N 327 TYR HE2 H N N 328 TYR HH H N N 329 TYR HXT H N N 330 VAL N N N N 331 VAL CA C N S 332 VAL C C N N 333 VAL O O N N 334 VAL CB C N N 335 VAL CG1 C N N 336 VAL CG2 C N N 337 VAL OXT O N N 338 VAL H H N N 339 VAL H2 H N N 340 VAL HA H N N 341 VAL HB H N N 342 VAL HG11 H N N 343 VAL HG12 H N N 344 VAL HG13 H N N 345 VAL HG21 H N N 346 VAL HG22 H N N 347 VAL HG23 H N N 348 VAL HXT H N N 349 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 THR N CA sing N N 277 THR N H sing N N 278 THR N H2 sing N N 279 THR CA C sing N N 280 THR CA CB sing N N 281 THR CA HA sing N N 282 THR C O doub N N 283 THR C OXT sing N N 284 THR CB OG1 sing N N 285 THR CB CG2 sing N N 286 THR CB HB sing N N 287 THR OG1 HG1 sing N N 288 THR CG2 HG21 sing N N 289 THR CG2 HG22 sing N N 290 THR CG2 HG23 sing N N 291 THR OXT HXT sing N N 292 TYR N CA sing N N 293 TYR N H sing N N 294 TYR N H2 sing N N 295 TYR CA C sing N N 296 TYR CA CB sing N N 297 TYR CA HA sing N N 298 TYR C O doub N N 299 TYR C OXT sing N N 300 TYR CB CG sing N N 301 TYR CB HB2 sing N N 302 TYR CB HB3 sing N N 303 TYR CG CD1 doub Y N 304 TYR CG CD2 sing Y N 305 TYR CD1 CE1 sing Y N 306 TYR CD1 HD1 sing N N 307 TYR CD2 CE2 doub Y N 308 TYR CD2 HD2 sing N N 309 TYR CE1 CZ doub Y N 310 TYR CE1 HE1 sing N N 311 TYR CE2 CZ sing Y N 312 TYR CE2 HE2 sing N N 313 TYR CZ OH sing N N 314 TYR OH HH sing N N 315 TYR OXT HXT sing N N 316 VAL N CA sing N N 317 VAL N H sing N N 318 VAL N H2 sing N N 319 VAL CA C sing N N 320 VAL CA CB sing N N 321 VAL CA HA sing N N 322 VAL C O doub N N 323 VAL C OXT sing N N 324 VAL CB CG1 sing N N 325 VAL CB CG2 sing N N 326 VAL CB HB sing N N 327 VAL CG1 HG11 sing N N 328 VAL CG1 HG12 sing N N 329 VAL CG1 HG13 sing N N 330 VAL CG2 HG21 sing N N 331 VAL CG2 HG22 sing N N 332 VAL CG2 HG23 sing N N 333 VAL OXT HXT sing N N 334 # _pdbx_audit_support.funding_organization 'Medical Research Council (United Kingdom)' _pdbx_audit_support.country 'United Kingdom' _pdbx_audit_support.grant_number G0900888 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4AYD _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 5NQY _atom_sites.fract_transf_matrix[1][1] 0.017590 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015964 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011275 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_