data_5NUE # _entry.id 5NUE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.295 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5NUE WWPDB D_1200004749 # _pdbx_database_related.db_name PDB _pdbx_database_related.details 'Reduced form of the same protein' _pdbx_database_related.db_id 5NUF _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5NUE _pdbx_database_status.recvd_initial_deposition_date 2017-04-29 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Young, D.' 1 ? 'Messens, J.' 2 ? 'Huang, J.' 3 ? 'Reichheld, J.-P.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Exp. Bot.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1460-2431 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 69 _citation.language ? _citation.page_first 3491 _citation.page_last 3505 _citation.title 'Self-protection of cytosolic malate dehydrogenase against oxidative stress in Arabidopsis.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1093/jxb/erx396 _citation.pdbx_database_id_PubMed 29194485 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Huang, J.' 1 primary 'Niazi, A.K.' 2 primary 'Young, D.' 3 primary 'Rosado, L.A.' 4 primary 'Vertommen, D.' 5 primary 'Bodra, N.' 6 primary 'Abdelgawwad, M.R.' 7 primary 'Vignols, F.' 8 primary 'Wei, B.' 9 primary 'Wahni, K.' 10 primary 'Bashandy, T.' 11 primary 'Bariat, L.' 12 primary 'Van Breusegem, F.' 13 primary 'Messens, J.' 14 primary 'Reichheld, J.P.' 15 # _cell.volume 1135454.348 _cell.length_a 64.598 _cell.length_b 118.374 _cell.length_c 148.489 _cell.angle_beta 90.000 _cell.angle_gamma 90.000 _cell.angle_alpha 90.000 _cell.entry_id 5NUE _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.Int_Tables_number 18 _symmetry.space_group_name_H-M 'P 2 21 21' _symmetry.space_group_name_Hall 'P 2 2ab (z,x,y)' _symmetry.entry_id 5NUE _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Malate dehydrogenase 1, cytoplasmic' 35610.918 1 1.1.1.37 ? ? 'Residue 56 oxidized to methionine sulfoxide' 2 polymer man 'Malate dehydrogenase 1, cytoplasmic' 35674.914 1 1.1.1.37 ? ? ? 3 polymer man 'Malate dehydrogenase 1, cytoplasmic' 35642.918 1 1.1.1.37 ? ? ? 4 non-polymer syn NICOTINAMIDE-ADENINE-DINUCLEOTIDE 663.425 3 ? ? ? ? 5 non-polymer syn 'SULFATE ION' 96.063 8 ? ? ? ? 6 non-polymer syn GLYCEROL 92.094 6 ? ? ? ? 7 non-polymer syn 'HYDROGEN PEROXIDE' 34.015 11 ? ? ? ? 8 non-polymer syn 'FORMIC ACID' 46.025 5 ? ? ? ? 9 non-polymer syn 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL 122.143 1 ? ? ? ? 10 non-polymer syn 2-ETHOXYETHANOL 90.121 1 ? ? ? ? 11 non-polymer syn 'ACETATE ION' 59.044 3 ? ? ? ? 12 non-polymer syn 1,2-ETHANEDIOL 62.068 3 ? ? ? ? 13 water nat water 18.015 999 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'Cytosolic NAD-dependent malate dehydrogenase 1,cNAD-MDH1,Cytosolic malate dehydrogenase 1,Cytosolic MDH1' 2 'Cytosolic NAD-dependent malate dehydrogenase 1,cNAD-MDH1,Cytosolic malate dehydrogenase 1,Cytosolic MDH1' 3 'Cytosolic NAD-dependent malate dehydrogenase 1,cNAD-MDH1,Cytosolic malate dehydrogenase 1,Cytosolic MDH1' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MAKEPVRVLVTGAAGQIGYALVPMIARGIMLGADQPVILHMLDIPPAAEALNGVKMELIDAAFPLLKGVVATTDAVEGCT GVNVAVMVGGFPRKEGMERKDVMSKNVSIYKSQAAALEKHAAPNCKVLVVANPANTNALILKEFAPSIPEKNISCLTRLD HNRALGQISERLSVPVSDVKNVIIWGNHSSSQYPDVNHAKVQTSSGEKPVRELVKDDAWLDGEFISTVQQRGAAIIKARK LSSALSAASSACDHIRDWVLGTPEGTFVSMGVYSDGSYSVPSGLIYSFPVTCRNGDWSIVQGLPIDEVSRKKMDLTAEEL KEEKDLAYSCLS ; ;MAKEPVRVLVTGAAGQIGYALVPMIARGIMLGADQPVILHMLDIPPAAEALNGVKMELIDAAFPLLKGVVATTDAVEGCT GVNVAVMVGGFPRKEGMERKDVMSKNVSIYKSQAAALEKHAAPNCKVLVVANPANTNALILKEFAPSIPEKNISCLTRLD HNRALGQISERLSVPVSDVKNVIIWGNHSSSQYPDVNHAKVQTSSGEKPVRELVKDDAWLDGEFISTVQQRGAAIIKARK LSSALSAASSACDHIRDWVLGTPEGTFVSMGVYSDGSYSVPSGLIYSFPVTCRNGDWSIVQGLPIDEVSRKKMDLTAEEL KEEKDLAYSCLS ; A ? 2 'polypeptide(L)' no yes ;MAKEPVRVLVTGAAGQIGYALVPMIARGIMLGADQPVILHMLDIPPAAEALNGVK(SME)ELIDAAFPLLKGVVATTDAV EGCTGVNVAVMVGGFPRKEG(SME)ERKDVMSKNVSIYKSQAAALEKHAAPNCKVLVVANPANTNALILKEFAPSIPEKN ISCLTRLDHNRALGQISERLSVPVSDVKNVIIWGNHSSSQYPDVNHAKVQTSSGEKPVRELVKDDAWLDGEFISTVQQRG AAIIKARKLSSALSAASSACDHIRDWVLGTPEGTFVSMGVYSDGSYSVPSGLIYSFPVTCRNGDWSIVQGLPIDEVSRKK MDLTAEELKEEKDLAYS(CSD)LS ; ;MAKEPVRVLVTGAAGQIGYALVPMIARGIMLGADQPVILHMLDIPPAAEALNGVKMELIDAAFPLLKGVVATTDAVEGCT GVNVAVMVGGFPRKEGMERKDVMSKNVSIYKSQAAALEKHAAPNCKVLVVANPANTNALILKEFAPSIPEKNISCLTRLD HNRALGQISERLSVPVSDVKNVIIWGNHSSSQYPDVNHAKVQTSSGEKPVRELVKDDAWLDGEFISTVQQRGAAIIKARK LSSALSAASSACDHIRDWVLGTPEGTFVSMGVYSDGSYSVPSGLIYSFPVTCRNGDWSIVQGLPIDEVSRKKMDLTAEEL KEEKDLAYSCLS ; B ? 3 'polypeptide(L)' no yes ;MAKEPVRVLVTGAAGQIGYALVPMIARGIMLGADQPVILHMLDIPPAAEALNGVK(SME)ELIDAAFPLLKGVVATTDAV EGCTGVNVAVMVGGFPRKEGMERKDVMSKNVSIYKSQAAALEKHAAPNCKVLVVANPANTNALILKEFAPSIPEKNISCL TRLDHNRALGQISERLSVPVSDVKNVIIWGNHSSSQYPDVNHAKVQTSSGEKPVRELVKDDAWLDGEFISTVQQRGAAII KARKLSSALSAASSACDHIRDWVLGTPEGTFVSMGVYSDGSYSVPSGLIYSFPVTCRNGDWSIVQGLPIDEVSRKKMDLT AEELKEEKDLAYS(CSO)LS ; ;MAKEPVRVLVTGAAGQIGYALVPMIARGIMLGADQPVILHMLDIPPAAEALNGVKMELIDAAFPLLKGVVATTDAVEGCT GVNVAVMVGGFPRKEGMERKDVMSKNVSIYKSQAAALEKHAAPNCKVLVVANPANTNALILKEFAPSIPEKNISCLTRLD HNRALGQISERLSVPVSDVKNVIIWGNHSSSQYPDVNHAKVQTSSGEKPVRELVKDDAWLDGEFISTVQQRGAAIIKARK LSSALSAASSACDHIRDWVLGTPEGTFVSMGVYSDGSYSVPSGLIYSFPVTCRNGDWSIVQGLPIDEVSRKKMDLTAEEL KEEKDLAYSCLS ; C ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 LYS n 1 4 GLU n 1 5 PRO n 1 6 VAL n 1 7 ARG n 1 8 VAL n 1 9 LEU n 1 10 VAL n 1 11 THR n 1 12 GLY n 1 13 ALA n 1 14 ALA n 1 15 GLY n 1 16 GLN n 1 17 ILE n 1 18 GLY n 1 19 TYR n 1 20 ALA n 1 21 LEU n 1 22 VAL n 1 23 PRO n 1 24 MET n 1 25 ILE n 1 26 ALA n 1 27 ARG n 1 28 GLY n 1 29 ILE n 1 30 MET n 1 31 LEU n 1 32 GLY n 1 33 ALA n 1 34 ASP n 1 35 GLN n 1 36 PRO n 1 37 VAL n 1 38 ILE n 1 39 LEU n 1 40 HIS n 1 41 MET n 1 42 LEU n 1 43 ASP n 1 44 ILE n 1 45 PRO n 1 46 PRO n 1 47 ALA n 1 48 ALA n 1 49 GLU n 1 50 ALA n 1 51 LEU n 1 52 ASN n 1 53 GLY n 1 54 VAL n 1 55 LYS n 1 56 MET n 1 57 GLU n 1 58 LEU n 1 59 ILE n 1 60 ASP n 1 61 ALA n 1 62 ALA n 1 63 PHE n 1 64 PRO n 1 65 LEU n 1 66 LEU n 1 67 LYS n 1 68 GLY n 1 69 VAL n 1 70 VAL n 1 71 ALA n 1 72 THR n 1 73 THR n 1 74 ASP n 1 75 ALA n 1 76 VAL n 1 77 GLU n 1 78 GLY n 1 79 CYS n 1 80 THR n 1 81 GLY n 1 82 VAL n 1 83 ASN n 1 84 VAL n 1 85 ALA n 1 86 VAL n 1 87 MET n 1 88 VAL n 1 89 GLY n 1 90 GLY n 1 91 PHE n 1 92 PRO n 1 93 ARG n 1 94 LYS n 1 95 GLU n 1 96 GLY n 1 97 MET n 1 98 GLU n 1 99 ARG n 1 100 LYS n 1 101 ASP n 1 102 VAL n 1 103 MET n 1 104 SER n 1 105 LYS n 1 106 ASN n 1 107 VAL n 1 108 SER n 1 109 ILE n 1 110 TYR n 1 111 LYS n 1 112 SER n 1 113 GLN n 1 114 ALA n 1 115 ALA n 1 116 ALA n 1 117 LEU n 1 118 GLU n 1 119 LYS n 1 120 HIS n 1 121 ALA n 1 122 ALA n 1 123 PRO n 1 124 ASN n 1 125 CYS n 1 126 LYS n 1 127 VAL n 1 128 LEU n 1 129 VAL n 1 130 VAL n 1 131 ALA n 1 132 ASN n 1 133 PRO n 1 134 ALA n 1 135 ASN n 1 136 THR n 1 137 ASN n 1 138 ALA n 1 139 LEU n 1 140 ILE n 1 141 LEU n 1 142 LYS n 1 143 GLU n 1 144 PHE n 1 145 ALA n 1 146 PRO n 1 147 SER n 1 148 ILE n 1 149 PRO n 1 150 GLU n 1 151 LYS n 1 152 ASN n 1 153 ILE n 1 154 SER n 1 155 CYS n 1 156 LEU n 1 157 THR n 1 158 ARG n 1 159 LEU n 1 160 ASP n 1 161 HIS n 1 162 ASN n 1 163 ARG n 1 164 ALA n 1 165 LEU n 1 166 GLY n 1 167 GLN n 1 168 ILE n 1 169 SER n 1 170 GLU n 1 171 ARG n 1 172 LEU n 1 173 SER n 1 174 VAL n 1 175 PRO n 1 176 VAL n 1 177 SER n 1 178 ASP n 1 179 VAL n 1 180 LYS n 1 181 ASN n 1 182 VAL n 1 183 ILE n 1 184 ILE n 1 185 TRP n 1 186 GLY n 1 187 ASN n 1 188 HIS n 1 189 SER n 1 190 SER n 1 191 SER n 1 192 GLN n 1 193 TYR n 1 194 PRO n 1 195 ASP n 1 196 VAL n 1 197 ASN n 1 198 HIS n 1 199 ALA n 1 200 LYS n 1 201 VAL n 1 202 GLN n 1 203 THR n 1 204 SER n 1 205 SER n 1 206 GLY n 1 207 GLU n 1 208 LYS n 1 209 PRO n 1 210 VAL n 1 211 ARG n 1 212 GLU n 1 213 LEU n 1 214 VAL n 1 215 LYS n 1 216 ASP n 1 217 ASP n 1 218 ALA n 1 219 TRP n 1 220 LEU n 1 221 ASP n 1 222 GLY n 1 223 GLU n 1 224 PHE n 1 225 ILE n 1 226 SER n 1 227 THR n 1 228 VAL n 1 229 GLN n 1 230 GLN n 1 231 ARG n 1 232 GLY n 1 233 ALA n 1 234 ALA n 1 235 ILE n 1 236 ILE n 1 237 LYS n 1 238 ALA n 1 239 ARG n 1 240 LYS n 1 241 LEU n 1 242 SER n 1 243 SER n 1 244 ALA n 1 245 LEU n 1 246 SER n 1 247 ALA n 1 248 ALA n 1 249 SER n 1 250 SER n 1 251 ALA n 1 252 CYS n 1 253 ASP n 1 254 HIS n 1 255 ILE n 1 256 ARG n 1 257 ASP n 1 258 TRP n 1 259 VAL n 1 260 LEU n 1 261 GLY n 1 262 THR n 1 263 PRO n 1 264 GLU n 1 265 GLY n 1 266 THR n 1 267 PHE n 1 268 VAL n 1 269 SER n 1 270 MET n 1 271 GLY n 1 272 VAL n 1 273 TYR n 1 274 SER n 1 275 ASP n 1 276 GLY n 1 277 SER n 1 278 TYR n 1 279 SER n 1 280 VAL n 1 281 PRO n 1 282 SER n 1 283 GLY n 1 284 LEU n 1 285 ILE n 1 286 TYR n 1 287 SER n 1 288 PHE n 1 289 PRO n 1 290 VAL n 1 291 THR n 1 292 CYS n 1 293 ARG n 1 294 ASN n 1 295 GLY n 1 296 ASP n 1 297 TRP n 1 298 SER n 1 299 ILE n 1 300 VAL n 1 301 GLN n 1 302 GLY n 1 303 LEU n 1 304 PRO n 1 305 ILE n 1 306 ASP n 1 307 GLU n 1 308 VAL n 1 309 SER n 1 310 ARG n 1 311 LYS n 1 312 LYS n 1 313 MET n 1 314 ASP n 1 315 LEU n 1 316 THR n 1 317 ALA n 1 318 GLU n 1 319 GLU n 1 320 LEU n 1 321 LYS n 1 322 GLU n 1 323 GLU n 1 324 LYS n 1 325 ASP n 1 326 LEU n 1 327 ALA n 1 328 TYR n 1 329 SER n 1 330 CYS n 1 331 LEU n 1 332 SER n 2 1 MET n 2 2 ALA n 2 3 LYS n 2 4 GLU n 2 5 PRO n 2 6 VAL n 2 7 ARG n 2 8 VAL n 2 9 LEU n 2 10 VAL n 2 11 THR n 2 12 GLY n 2 13 ALA n 2 14 ALA n 2 15 GLY n 2 16 GLN n 2 17 ILE n 2 18 GLY n 2 19 TYR n 2 20 ALA n 2 21 LEU n 2 22 VAL n 2 23 PRO n 2 24 MET n 2 25 ILE n 2 26 ALA n 2 27 ARG n 2 28 GLY n 2 29 ILE n 2 30 MET n 2 31 LEU n 2 32 GLY n 2 33 ALA n 2 34 ASP n 2 35 GLN n 2 36 PRO n 2 37 VAL n 2 38 ILE n 2 39 LEU n 2 40 HIS n 2 41 MET n 2 42 LEU n 2 43 ASP n 2 44 ILE n 2 45 PRO n 2 46 PRO n 2 47 ALA n 2 48 ALA n 2 49 GLU n 2 50 ALA n 2 51 LEU n 2 52 ASN n 2 53 GLY n 2 54 VAL n 2 55 LYS n 2 56 SME n 2 57 GLU n 2 58 LEU n 2 59 ILE n 2 60 ASP n 2 61 ALA n 2 62 ALA n 2 63 PHE n 2 64 PRO n 2 65 LEU n 2 66 LEU n 2 67 LYS n 2 68 GLY n 2 69 VAL n 2 70 VAL n 2 71 ALA n 2 72 THR n 2 73 THR n 2 74 ASP n 2 75 ALA n 2 76 VAL n 2 77 GLU n 2 78 GLY n 2 79 CYS n 2 80 THR n 2 81 GLY n 2 82 VAL n 2 83 ASN n 2 84 VAL n 2 85 ALA n 2 86 VAL n 2 87 MET n 2 88 VAL n 2 89 GLY n 2 90 GLY n 2 91 PHE n 2 92 PRO n 2 93 ARG n 2 94 LYS n 2 95 GLU n 2 96 GLY n 2 97 SME n 2 98 GLU n 2 99 ARG n 2 100 LYS n 2 101 ASP n 2 102 VAL n 2 103 MET n 2 104 SER n 2 105 LYS n 2 106 ASN n 2 107 VAL n 2 108 SER n 2 109 ILE n 2 110 TYR n 2 111 LYS n 2 112 SER n 2 113 GLN n 2 114 ALA n 2 115 ALA n 2 116 ALA n 2 117 LEU n 2 118 GLU n 2 119 LYS n 2 120 HIS n 2 121 ALA n 2 122 ALA n 2 123 PRO n 2 124 ASN n 2 125 CYS n 2 126 LYS n 2 127 VAL n 2 128 LEU n 2 129 VAL n 2 130 VAL n 2 131 ALA n 2 132 ASN n 2 133 PRO n 2 134 ALA n 2 135 ASN n 2 136 THR n 2 137 ASN n 2 138 ALA n 2 139 LEU n 2 140 ILE n 2 141 LEU n 2 142 LYS n 2 143 GLU n 2 144 PHE n 2 145 ALA n 2 146 PRO n 2 147 SER n 2 148 ILE n 2 149 PRO n 2 150 GLU n 2 151 LYS n 2 152 ASN n 2 153 ILE n 2 154 SER n 2 155 CYS n 2 156 LEU n 2 157 THR n 2 158 ARG n 2 159 LEU n 2 160 ASP n 2 161 HIS n 2 162 ASN n 2 163 ARG n 2 164 ALA n 2 165 LEU n 2 166 GLY n 2 167 GLN n 2 168 ILE n 2 169 SER n 2 170 GLU n 2 171 ARG n 2 172 LEU n 2 173 SER n 2 174 VAL n 2 175 PRO n 2 176 VAL n 2 177 SER n 2 178 ASP n 2 179 VAL n 2 180 LYS n 2 181 ASN n 2 182 VAL n 2 183 ILE n 2 184 ILE n 2 185 TRP n 2 186 GLY n 2 187 ASN n 2 188 HIS n 2 189 SER n 2 190 SER n 2 191 SER n 2 192 GLN n 2 193 TYR n 2 194 PRO n 2 195 ASP n 2 196 VAL n 2 197 ASN n 2 198 HIS n 2 199 ALA n 2 200 LYS n 2 201 VAL n 2 202 GLN n 2 203 THR n 2 204 SER n 2 205 SER n 2 206 GLY n 2 207 GLU n 2 208 LYS n 2 209 PRO n 2 210 VAL n 2 211 ARG n 2 212 GLU n 2 213 LEU n 2 214 VAL n 2 215 LYS n 2 216 ASP n 2 217 ASP n 2 218 ALA n 2 219 TRP n 2 220 LEU n 2 221 ASP n 2 222 GLY n 2 223 GLU n 2 224 PHE n 2 225 ILE n 2 226 SER n 2 227 THR n 2 228 VAL n 2 229 GLN n 2 230 GLN n 2 231 ARG n 2 232 GLY n 2 233 ALA n 2 234 ALA n 2 235 ILE n 2 236 ILE n 2 237 LYS n 2 238 ALA n 2 239 ARG n 2 240 LYS n 2 241 LEU n 2 242 SER n 2 243 SER n 2 244 ALA n 2 245 LEU n 2 246 SER n 2 247 ALA n 2 248 ALA n 2 249 SER n 2 250 SER n 2 251 ALA n 2 252 CYS n 2 253 ASP n 2 254 HIS n 2 255 ILE n 2 256 ARG n 2 257 ASP n 2 258 TRP n 2 259 VAL n 2 260 LEU n 2 261 GLY n 2 262 THR n 2 263 PRO n 2 264 GLU n 2 265 GLY n 2 266 THR n 2 267 PHE n 2 268 VAL n 2 269 SER n 2 270 MET n 2 271 GLY n 2 272 VAL n 2 273 TYR n 2 274 SER n 2 275 ASP n 2 276 GLY n 2 277 SER n 2 278 TYR n 2 279 SER n 2 280 VAL n 2 281 PRO n 2 282 SER n 2 283 GLY n 2 284 LEU n 2 285 ILE n 2 286 TYR n 2 287 SER n 2 288 PHE n 2 289 PRO n 2 290 VAL n 2 291 THR n 2 292 CYS n 2 293 ARG n 2 294 ASN n 2 295 GLY n 2 296 ASP n 2 297 TRP n 2 298 SER n 2 299 ILE n 2 300 VAL n 2 301 GLN n 2 302 GLY n 2 303 LEU n 2 304 PRO n 2 305 ILE n 2 306 ASP n 2 307 GLU n 2 308 VAL n 2 309 SER n 2 310 ARG n 2 311 LYS n 2 312 LYS n 2 313 MET n 2 314 ASP n 2 315 LEU n 2 316 THR n 2 317 ALA n 2 318 GLU n 2 319 GLU n 2 320 LEU n 2 321 LYS n 2 322 GLU n 2 323 GLU n 2 324 LYS n 2 325 ASP n 2 326 LEU n 2 327 ALA n 2 328 TYR n 2 329 SER n 2 330 CSD n 2 331 LEU n 2 332 SER n 3 1 MET n 3 2 ALA n 3 3 LYS n 3 4 GLU n 3 5 PRO n 3 6 VAL n 3 7 ARG n 3 8 VAL n 3 9 LEU n 3 10 VAL n 3 11 THR n 3 12 GLY n 3 13 ALA n 3 14 ALA n 3 15 GLY n 3 16 GLN n 3 17 ILE n 3 18 GLY n 3 19 TYR n 3 20 ALA n 3 21 LEU n 3 22 VAL n 3 23 PRO n 3 24 MET n 3 25 ILE n 3 26 ALA n 3 27 ARG n 3 28 GLY n 3 29 ILE n 3 30 MET n 3 31 LEU n 3 32 GLY n 3 33 ALA n 3 34 ASP n 3 35 GLN n 3 36 PRO n 3 37 VAL n 3 38 ILE n 3 39 LEU n 3 40 HIS n 3 41 MET n 3 42 LEU n 3 43 ASP n 3 44 ILE n 3 45 PRO n 3 46 PRO n 3 47 ALA n 3 48 ALA n 3 49 GLU n 3 50 ALA n 3 51 LEU n 3 52 ASN n 3 53 GLY n 3 54 VAL n 3 55 LYS n 3 56 SME n 3 57 GLU n 3 58 LEU n 3 59 ILE n 3 60 ASP n 3 61 ALA n 3 62 ALA n 3 63 PHE n 3 64 PRO n 3 65 LEU n 3 66 LEU n 3 67 LYS n 3 68 GLY n 3 69 VAL n 3 70 VAL n 3 71 ALA n 3 72 THR n 3 73 THR n 3 74 ASP n 3 75 ALA n 3 76 VAL n 3 77 GLU n 3 78 GLY n 3 79 CYS n 3 80 THR n 3 81 GLY n 3 82 VAL n 3 83 ASN n 3 84 VAL n 3 85 ALA n 3 86 VAL n 3 87 MET n 3 88 VAL n 3 89 GLY n 3 90 GLY n 3 91 PHE n 3 92 PRO n 3 93 ARG n 3 94 LYS n 3 95 GLU n 3 96 GLY n 3 97 MET n 3 98 GLU n 3 99 ARG n 3 100 LYS n 3 101 ASP n 3 102 VAL n 3 103 MET n 3 104 SER n 3 105 LYS n 3 106 ASN n 3 107 VAL n 3 108 SER n 3 109 ILE n 3 110 TYR n 3 111 LYS n 3 112 SER n 3 113 GLN n 3 114 ALA n 3 115 ALA n 3 116 ALA n 3 117 LEU n 3 118 GLU n 3 119 LYS n 3 120 HIS n 3 121 ALA n 3 122 ALA n 3 123 PRO n 3 124 ASN n 3 125 CYS n 3 126 LYS n 3 127 VAL n 3 128 LEU n 3 129 VAL n 3 130 VAL n 3 131 ALA n 3 132 ASN n 3 133 PRO n 3 134 ALA n 3 135 ASN n 3 136 THR n 3 137 ASN n 3 138 ALA n 3 139 LEU n 3 140 ILE n 3 141 LEU n 3 142 LYS n 3 143 GLU n 3 144 PHE n 3 145 ALA n 3 146 PRO n 3 147 SER n 3 148 ILE n 3 149 PRO n 3 150 GLU n 3 151 LYS n 3 152 ASN n 3 153 ILE n 3 154 SER n 3 155 CYS n 3 156 LEU n 3 157 THR n 3 158 ARG n 3 159 LEU n 3 160 ASP n 3 161 HIS n 3 162 ASN n 3 163 ARG n 3 164 ALA n 3 165 LEU n 3 166 GLY n 3 167 GLN n 3 168 ILE n 3 169 SER n 3 170 GLU n 3 171 ARG n 3 172 LEU n 3 173 SER n 3 174 VAL n 3 175 PRO n 3 176 VAL n 3 177 SER n 3 178 ASP n 3 179 VAL n 3 180 LYS n 3 181 ASN n 3 182 VAL n 3 183 ILE n 3 184 ILE n 3 185 TRP n 3 186 GLY n 3 187 ASN n 3 188 HIS n 3 189 SER n 3 190 SER n 3 191 SER n 3 192 GLN n 3 193 TYR n 3 194 PRO n 3 195 ASP n 3 196 VAL n 3 197 ASN n 3 198 HIS n 3 199 ALA n 3 200 LYS n 3 201 VAL n 3 202 GLN n 3 203 THR n 3 204 SER n 3 205 SER n 3 206 GLY n 3 207 GLU n 3 208 LYS n 3 209 PRO n 3 210 VAL n 3 211 ARG n 3 212 GLU n 3 213 LEU n 3 214 VAL n 3 215 LYS n 3 216 ASP n 3 217 ASP n 3 218 ALA n 3 219 TRP n 3 220 LEU n 3 221 ASP n 3 222 GLY n 3 223 GLU n 3 224 PHE n 3 225 ILE n 3 226 SER n 3 227 THR n 3 228 VAL n 3 229 GLN n 3 230 GLN n 3 231 ARG n 3 232 GLY n 3 233 ALA n 3 234 ALA n 3 235 ILE n 3 236 ILE n 3 237 LYS n 3 238 ALA n 3 239 ARG n 3 240 LYS n 3 241 LEU n 3 242 SER n 3 243 SER n 3 244 ALA n 3 245 LEU n 3 246 SER n 3 247 ALA n 3 248 ALA n 3 249 SER n 3 250 SER n 3 251 ALA n 3 252 CYS n 3 253 ASP n 3 254 HIS n 3 255 ILE n 3 256 ARG n 3 257 ASP n 3 258 TRP n 3 259 VAL n 3 260 LEU n 3 261 GLY n 3 262 THR n 3 263 PRO n 3 264 GLU n 3 265 GLY n 3 266 THR n 3 267 PHE n 3 268 VAL n 3 269 SER n 3 270 MET n 3 271 GLY n 3 272 VAL n 3 273 TYR n 3 274 SER n 3 275 ASP n 3 276 GLY n 3 277 SER n 3 278 TYR n 3 279 SER n 3 280 VAL n 3 281 PRO n 3 282 SER n 3 283 GLY n 3 284 LEU n 3 285 ILE n 3 286 TYR n 3 287 SER n 3 288 PHE n 3 289 PRO n 3 290 VAL n 3 291 THR n 3 292 CYS n 3 293 ARG n 3 294 ASN n 3 295 GLY n 3 296 ASP n 3 297 TRP n 3 298 SER n 3 299 ILE n 3 300 VAL n 3 301 GLN n 3 302 GLY n 3 303 LEU n 3 304 PRO n 3 305 ILE n 3 306 ASP n 3 307 GLU n 3 308 VAL n 3 309 SER n 3 310 ARG n 3 311 LYS n 3 312 LYS n 3 313 MET n 3 314 ASP n 3 315 LEU n 3 316 THR n 3 317 ALA n 3 318 GLU n 3 319 GLU n 3 320 LEU n 3 321 LYS n 3 322 GLU n 3 323 GLU n 3 324 LYS n 3 325 ASP n 3 326 LEU n 3 327 ALA n 3 328 TYR n 3 329 SER n 3 330 CSO n 3 331 LEU n 3 332 SER n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 332 'Mouse-ear cress' ? 'MDH1, At1g04410, F19P19.13' ? ? ? ? ? ? 'Arabidopsis thaliana' 3702 ? ? ? ? ? cytoplasmic ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? C41 ? ? ? ? ? ? ? ? ? ? pDEST17 ? ? 2 1 sample 'Biological sequence' 1 332 'Mouse-ear cress' ? 'MDH1, At1g04410, F19P19.13' ? ? ? ? ? ? 'Arabidopsis thaliana' 3702 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? C41 ? ? ? ? ? ? ? ? ? ? pDEST17 ? ? 3 1 sample 'Biological sequence' 1 332 'Mouse-ear cress' ? 'MDH1, At1g04410, F19P19.13' ? ? ? ? ? ? 'Arabidopsis thaliana' 3702 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? C41 ? ? ? ? ? ? ? ? ? ? pDEST17 ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP MDHC1_ARATH P93819 ? 1 ;MAKEPVRVLVTGAAGQIGYALVPMIARGIMLGADQPVILHMLDIPPAAEALNGVKMELIDAAFPLLKGVVATTDAVEGCT GVNVAVMVGGFPRKEGMERKDVMSKNVSIYKSQAAALEKHAAPNCKVLVVANPANTNALILKEFAPSIPEKNISCLTRLD HNRALGQISERLSVPVSDVKNVIIWGNHSSSQYPDVNHAKVQTSSGEKPVRELVKDDAWLDGEFISTVQQRGAAIIKARK LSSALSAASSACDHIRDWVLGTPEGTFVSMGVYSDGSYSVPSGLIYSFPVTCRNGDWSIVQGLPIDEVSRKKMDLTAEEL KEEKDLAYSCLS ; 1 2 UNP MDHC1_ARATH P93819 ? 2 ;MAKEPVRVLVTGAAGQIGYALVPMIARGIMLGADQPVILHMLDIPPAAEALNGVKMELIDAAFPLLKGVVATTDAVEGCT GVNVAVMVGGFPRKEGMERKDVMSKNVSIYKSQAAALEKHAAPNCKVLVVANPANTNALILKEFAPSIPEKNISCLTRLD HNRALGQISERLSVPVSDVKNVIIWGNHSSSQYPDVNHAKVQTSSGEKPVRELVKDDAWLDGEFISTVQQRGAAIIKARK LSSALSAASSACDHIRDWVLGTPEGTFVSMGVYSDGSYSVPSGLIYSFPVTCRNGDWSIVQGLPIDEVSRKKMDLTAEEL KEEKDLAYSCLS ; 1 3 UNP MDHC1_ARATH P93819 ? 3 ;MAKEPVRVLVTGAAGQIGYALVPMIARGIMLGADQPVILHMLDIPPAAEALNGVKMELIDAAFPLLKGVVATTDAVEGCT GVNVAVMVGGFPRKEGMERKDVMSKNVSIYKSQAAALEKHAAPNCKVLVVANPANTNALILKEFAPSIPEKNISCLTRLD HNRALGQISERLSVPVSDVKNVIIWGNHSSSQYPDVNHAKVQTSSGEKPVRELVKDDAWLDGEFISTVQQRGAAIIKARK LSSALSAASSACDHIRDWVLGTPEGTFVSMGVYSDGSYSVPSGLIYSFPVTCRNGDWSIVQGLPIDEVSRKKMDLTAEEL KEEKDLAYSCLS ; 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5NUE A 1 ? 332 ? P93819 1 ? 332 ? 1 332 2 2 5NUE B 1 ? 332 ? P93819 1 ? 332 ? 1 332 3 3 5NUE C 1 ? 332 ? P93819 1 ? 332 ? 1 332 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACT non-polymer . 'ACETATE ION' ? 'C2 H3 O2 -1' 59.044 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CSD 'L-peptide linking' n 3-SULFINOALANINE 'S-CYSTEINESULFINIC ACID; S-SULFINOCYSTEINE' 'C3 H7 N O4 S' 153.157 CSO 'L-peptide linking' n S-HYDROXYCYSTEINE ? 'C3 H7 N O3 S' 137.158 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 ETX non-polymer . 2-ETHOXYETHANOL ? 'C4 H10 O2' 90.121 FMT non-polymer . 'FORMIC ACID' ? 'C H2 O2' 46.025 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAD non-polymer . NICOTINAMIDE-ADENINE-DINUCLEOTIDE ? 'C21 H27 N7 O14 P2' 663.425 PEO non-polymer . 'HYDROGEN PEROXIDE' ? 'H2 O2' 34.015 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SME 'L-peptide linking' n 'METHIONINE SULFOXIDE' ? 'C5 H11 N O3 S' 165.211 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TRS non-polymer . 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL 'TRIS BUFFER' 'C4 H12 N O3 1' 122.143 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5NUE _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.66 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 53.87 _exptl_crystal.description '100 um x 200 um' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 283 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1.5 M ammonium sulfate, 0.1 M Tris-HCl' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details 'liquid nitrogen cryostream' _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-02-14 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.980105 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SOLEIL BEAMLINE PROXIMA 2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.980105 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'PROXIMA 2' _diffrn_source.pdbx_synchrotron_site SOLEIL # _reflns.B_iso_Wilson_estimate 14.47098422 _reflns.entry_id 5NUE _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.35 _reflns.d_resolution_low 92.561 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 236503 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.96 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 13.6 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 5.56 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.1092 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.973 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.35 _reflns_shell.d_res_low 1.398 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 0.63 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 99.98 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 13.4 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 2.934 _reflns_shell.pdbx_Rpim_I_all 0.798 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.369 _reflns_shell.pdbx_R_split ? # _refine.ls_percent_reflns_R_free 4.98260247664 _refine.pdbx_overall_phase_error 19.3646044324 _refine.ls_R_factor_obs 0.147967919778 _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.B_iso_mean 21.3464790462 _refine.ls_number_reflns_R_free 12401 _refine.ls_percent_reflns_obs 99.9213110542 _refine.ls_R_factor_R_work 0.146297730068 _refine.pdbx_solvent_shrinkage_radii 0.9 _refine.ls_d_res_high 1.35000279615 _refine.ls_number_reflns_obs 248886 _refine.pdbx_ls_sigma_F 1.32522207677 _refine.ls_number_reflns_R_work 236485 _refine.ls_d_res_low 92.5612886735 _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.ls_R_factor_R_free 0.179506294341 _refine.overall_SU_ML 0.163547634761 _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 5NUE _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 7454 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 283 _refine_hist.number_atoms_solvent 999 _refine_hist.number_atoms_total 8736 _refine_hist.d_res_high 1.35000279615 _refine_hist.d_res_low 92.5612886735 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.dev_ideal_target _refine_ls_restr.pdbx_refine_id f_bond_d 8471 0.0137813152937 ? ? ? 'X-RAY DIFFRACTION' f_angle_d 11621 1.41329654806 ? ? ? 'X-RAY DIFFRACTION' f_chiral_restr 1341 0.102487858011 ? ? ? 'X-RAY DIFFRACTION' f_plane_restr 1483 0.00854898620317 ? ? ? 'X-RAY DIFFRACTION' f_dihedral_angle_d 3326 15.6948976242 ? ? ? 'X-RAY DIFFRACTION' # loop_ _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.number_reflns_obs 1.35 1.3653 7742 0.329197231178 99.6335654086 0.353477092548 415 'X-RAY DIFFRACTION' . . . . . . . 1.3653 1.3814 7777 0.311133764164 99.7805680848 0.33913370001 408 'X-RAY DIFFRACTION' . . . . . . . 1.3814 1.3983 7811 0.304669905252 99.85428051 0.341793876234 412 'X-RAY DIFFRACTION' . . . . . . . 1.3983 1.416 7826 0.285261247816 99.8905642023 0.32557174951 389 'X-RAY DIFFRACTION' . . . . . . . 1.416 1.4346 7872 0.262675167375 99.8794745089 0.305035626434 415 'X-RAY DIFFRACTION' . . . . . . . 1.4346 1.4542 7800 0.260256209179 99.9633833761 0.278471890275 390 'X-RAY DIFFRACTION' . . . . . . . 1.4542 1.475 7857 0.248273648239 99.9757281553 0.285164090724 381 'X-RAY DIFFRACTION' . . . . . . . 1.475 1.497 7818 0.236360177552 99.9515445185 0.275802736981 433 'X-RAY DIFFRACTION' . . . . . . . 1.497 1.5204 7801 0.216503618547 99.9755889174 0.251553175223 390 'X-RAY DIFFRACTION' . . . . . . . 1.5204 1.5454 7852 0.204602223974 99.951754915 0.264895804162 435 'X-RAY DIFFRACTION' . . . . . . . 1.5454 1.572 7813 0.185979623491 99.9757016158 0.248422673717 416 'X-RAY DIFFRACTION' . . . . . . . 1.572 1.6006 7819 0.173482685778 99.9878301083 0.216107668323 397 'X-RAY DIFFRACTION' . . . . . . . 1.6006 1.6314 7841 0.157703824394 99.9515503876 0.20003428604 411 'X-RAY DIFFRACTION' . . . . . . . 1.6314 1.6647 7876 0.146221894046 99.9879605105 0.197376777214 429 'X-RAY DIFFRACTION' . . . . . . . 1.6647 1.7009 7851 0.134892366211 100.0 0.174729115947 415 'X-RAY DIFFRACTION' . . . . . . . 1.7009 1.7405 7868 0.136001726782 100.0 0.179610894156 381 'X-RAY DIFFRACTION' . . . . . . . 1.7405 1.784 7814 0.132335971369 99.9878522838 0.177972153377 417 'X-RAY DIFFRACTION' . . . . . . . 1.784 1.8322 7876 0.122710682935 99.9518246417 0.171308479743 423 'X-RAY DIFFRACTION' . . . . . . . 1.8322 1.8862 7852 0.126562539266 99.9879256218 0.169487996576 429 'X-RAY DIFFRACTION' . . . . . . . 1.8862 1.947 7901 0.119803549051 99.9639206254 0.171744997082 411 'X-RAY DIFFRACTION' . . . . . . . 1.947 2.0166 7866 0.116644407537 99.9397372544 0.171979570983 426 'X-RAY DIFFRACTION' . . . . . . . 2.0166 2.0974 7918 0.116952356755 99.9516499456 0.156588958891 351 'X-RAY DIFFRACTION' . . . . . . . 2.0974 2.1928 7893 0.117731975442 99.8798510153 0.165988823433 420 'X-RAY DIFFRACTION' . . . . . . . 2.1928 2.3085 7913 0.117049324104 99.8205097523 0.152423480886 429 'X-RAY DIFFRACTION' . . . . . . . 2.3085 2.4531 7891 0.124426027864 99.8559769563 0.156771461366 429 'X-RAY DIFFRACTION' . . . . . . . 2.4531 2.6425 7965 0.129259969531 99.8446648345 0.170844625653 391 'X-RAY DIFFRACTION' . . . . . . . 2.6425 2.9085 7953 0.137289354459 99.9046938289 0.162225897268 433 'X-RAY DIFFRACTION' . . . . . . . 2.9085 3.3293 7957 0.139984080028 99.9049542592 0.156487255653 452 'X-RAY DIFFRACTION' . . . . . . . 3.3293 4.1946 8074 0.123629850462 99.9882642882 0.141358109999 446 'X-RAY DIFFRACTION' . . . . . . . 4.1946 92.7796 8388 0.144508078913 99.9206529132 0.165736974423 427 'X-RAY DIFFRACTION' . . . . . . . # loop_ _struct_ncs_dom.id _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.details 1 1 ? 2 1 ? 3 1 ? # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.selection_details _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id 1 1 A 2 A 3 ;(chain 'A' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 93 or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 1 ? ? ? ? ? ? ? ? ? 1 1 A 6 A 14 ;(chain 'A' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 93 or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 2 ? ? ? ? ? ? ? ? ? 1 1 A 17 A 23 ;(chain 'A' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 93 or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 3 ? ? ? ? ? ? ? ? ? 1 1 A 25 A 25 ;(chain 'A' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 93 or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 4 ? ? ? ? ? ? ? ? ? 1 1 A 30 A 32 ;(chain 'A' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 93 or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 5 ? ? ? ? ? ? ? ? ? 1 1 A 35 A 40 ;(chain 'A' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 93 or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 6 ? ? ? ? ? ? ? ? ? 1 1 A 42 A 47 ;(chain 'A' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 93 or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 7 ? ? ? ? ? ? ? ? ? 1 1 A 50 A 51 ;(chain 'A' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 93 or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 8 ? ? ? ? ? ? ? ? ? 1 1 A 53 A 55 ;(chain 'A' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 93 or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 9 ? ? ? ? ? ? ? ? ? 1 1 A 57 A 58 ;(chain 'A' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 93 or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 10 ? ? ? ? ? ? ? ? ? 1 1 A 60 A 86 ;(chain 'A' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 93 or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 11 ? ? ? ? ? ? ? ? ? 1 1 A 88 A 93 ;(chain 'A' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 93 or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 12 ? ? ? ? ? ? ? ? ? 1 1 A 95 A 95 ;(chain 'A' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 93 or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 13 ? ? ? ? ? ? ? ? ? 1 1 A 98 A 102 ;(chain 'A' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 93 or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 14 ? ? ? ? ? ? ? ? ? 1 1 A 105 A 107 ;(chain 'A' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 93 or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 15 ? ? ? ? ? ? ? ? ? 1 1 A 109 A 117 ;(chain 'A' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 93 or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 16 ? ? ? ? ? ? ? ? ? 1 1 A 120 A 121 ;(chain 'A' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 93 or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 17 ? ? ? ? ? ? ? ? ? 1 1 A 125 A 125 ;(chain 'A' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 93 or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 18 ? ? ? ? ? ? ? ? ? 1 1 A 127 A 132 ;(chain 'A' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 93 or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 19 ? ? ? ? ? ? ? ? ? 1 1 A 134 A 140 ;(chain 'A' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 93 or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 20 ? ? ? ? ? ? ? ? ? 1 1 A 143 A 146 ;(chain 'A' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 93 or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 21 ? ? ? ? ? ? ? ? ? 1 1 A 148 A 149 ;(chain 'A' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 93 or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 22 ? ? ? ? ? ? ? ? ? 1 1 A 152 A 167 ;(chain 'A' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 93 or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 23 ? ? ? ? ? ? ? ? ? 1 1 A 170 A 189 ;(chain 'A' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 93 or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 24 ? ? ? ? ? ? ? ? ? 1 1 A 191 A 197 ;(chain 'A' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 93 or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 25 ? ? ? ? ? ? ? ? ? 1 1 A 199 A 208 ;(chain 'A' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 93 or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 26 ? ? ? ? ? ? ? ? ? 1 1 A 210 A 221 ;(chain 'A' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 93 or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 27 ? ? ? ? ? ? ? ? ? 1 1 A 224 A 225 ;(chain 'A' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 93 or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 28 ? ? ? ? ? ? ? ? ? 1 1 A 227 A 235 ;(chain 'A' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 93 or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 29 ? ? ? ? ? ? ? ? ? 1 1 A 237 A 239 ;(chain 'A' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 93 or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 30 ? ? ? ? ? ? ? ? ? 1 1 A 246 A 247 ;(chain 'A' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 93 or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 31 ? ? ? ? ? ? ? ? ? 1 1 A 251 A 255 ;(chain 'A' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 93 or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 32 ? ? ? ? ? ? ? ? ? 1 1 A 257 A 273 ;(chain 'A' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 93 or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 33 ? ? ? ? ? ? ? ? ? 1 1 A 275 A 281 ;(chain 'A' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 93 or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 34 ? ? ? ? ? ? ? ? ? 1 1 A 283 A 294 ;(chain 'A' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 93 or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 35 ? ? ? ? ? ? ? ? ? 1 1 A 297 A 297 ;(chain 'A' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 93 or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 36 ? ? ? ? ? ? ? ? ? 1 1 A 299 A 306 ;(chain 'A' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 93 or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 37 ? ? ? ? ? ? ? ? ? 1 1 A 308 A 310 ;(chain 'A' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 93 or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 38 ? ? ? ? ? ? ? ? ? 1 1 A 312 A 316 ;(chain 'A' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 93 or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 39 ? ? ? ? ? ? ? ? ? 1 1 A 319 A 320 ;(chain 'A' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 93 or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 40 ? ? ? ? ? ? ? ? ? 1 1 A 323 A 324 ;(chain 'A' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 93 or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 41 ? ? ? ? ? ? ? ? ? 1 1 A 326 A 326 ;(chain 'A' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 93 or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 42 ? ? ? ? ? ? ? ? ? 1 1 A 332 A 332 ;(chain 'A' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 93 or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 43 ? ? ? ? ? ? ? ? ? 1 2 B 2 B 3 ;(chain 'B' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 or (resid 99 and (name N or name CA or name C or name O or name CB )) or resid 100 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 44 ? ? ? ? ? ? ? ? ? 1 2 B 6 B 14 ;(chain 'B' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 or (resid 99 and (name N or name CA or name C or name O or name CB )) or resid 100 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 45 ? ? ? ? ? ? ? ? ? 1 2 B 17 B 23 ;(chain 'B' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 or (resid 99 and (name N or name CA or name C or name O or name CB )) or resid 100 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 46 ? ? ? ? ? ? ? ? ? 1 2 B 25 B 25 ;(chain 'B' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 or (resid 99 and (name N or name CA or name C or name O or name CB )) or resid 100 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 47 ? ? ? ? ? ? ? ? ? 1 2 B 30 B 32 ;(chain 'B' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 or (resid 99 and (name N or name CA or name C or name O or name CB )) or resid 100 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 48 ? ? ? ? ? ? ? ? ? 1 2 B 35 B 40 ;(chain 'B' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 or (resid 99 and (name N or name CA or name C or name O or name CB )) or resid 100 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 49 ? ? ? ? ? ? ? ? ? 1 2 B 42 B 47 ;(chain 'B' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 or (resid 99 and (name N or name CA or name C or name O or name CB )) or resid 100 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 50 ? ? ? ? ? ? ? ? ? 1 2 B 50 B 51 ;(chain 'B' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 or (resid 99 and (name N or name CA or name C or name O or name CB )) or resid 100 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 51 ? ? ? ? ? ? ? ? ? 1 2 B 53 B 55 ;(chain 'B' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 or (resid 99 and (name N or name CA or name C or name O or name CB )) or resid 100 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 52 ? ? ? ? ? ? ? ? ? 1 2 B 57 B 58 ;(chain 'B' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 or (resid 99 and (name N or name CA or name C or name O or name CB )) or resid 100 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 53 ? ? ? ? ? ? ? ? ? 1 2 B 60 B 86 ;(chain 'B' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 or (resid 99 and (name N or name CA or name C or name O or name CB )) or resid 100 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 54 ? ? ? ? ? ? ? ? ? 1 2 B 88 B 93 ;(chain 'B' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 or (resid 99 and (name N or name CA or name C or name O or name CB )) or resid 100 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 55 ? ? ? ? ? ? ? ? ? 1 2 B 95 B 95 ;(chain 'B' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 or (resid 99 and (name N or name CA or name C or name O or name CB )) or resid 100 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 56 ? ? ? ? ? ? ? ? ? 1 2 B 98 B 102 ;(chain 'B' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 or (resid 99 and (name N or name CA or name C or name O or name CB )) or resid 100 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 57 ? ? ? ? ? ? ? ? ? 1 2 B 105 B 107 ;(chain 'B' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 or (resid 99 and (name N or name CA or name C or name O or name CB )) or resid 100 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 58 ? ? ? ? ? ? ? ? ? 1 2 B 109 B 117 ;(chain 'B' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 or (resid 99 and (name N or name CA or name C or name O or name CB )) or resid 100 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 59 ? ? ? ? ? ? ? ? ? 1 2 B 120 B 121 ;(chain 'B' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 or (resid 99 and (name N or name CA or name C or name O or name CB )) or resid 100 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 60 ? ? ? ? ? ? ? ? ? 1 2 B 125 B 125 ;(chain 'B' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 or (resid 99 and (name N or name CA or name C or name O or name CB )) or resid 100 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 61 ? ? ? ? ? ? ? ? ? 1 2 B 127 B 132 ;(chain 'B' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 or (resid 99 and (name N or name CA or name C or name O or name CB )) or resid 100 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 62 ? ? ? ? ? ? ? ? ? 1 2 B 134 B 140 ;(chain 'B' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 or (resid 99 and (name N or name CA or name C or name O or name CB )) or resid 100 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 63 ? ? ? ? ? ? ? ? ? 1 2 B 143 B 146 ;(chain 'B' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 or (resid 99 and (name N or name CA or name C or name O or name CB )) or resid 100 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 64 ? ? ? ? ? ? ? ? ? 1 2 B 148 B 149 ;(chain 'B' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 or (resid 99 and (name N or name CA or name C or name O or name CB )) or resid 100 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 65 ? ? ? ? ? ? ? ? ? 1 2 B 152 B 167 ;(chain 'B' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 or (resid 99 and (name N or name CA or name C or name O or name CB )) or resid 100 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 66 ? ? ? ? ? ? ? ? ? 1 2 B 170 B 189 ;(chain 'B' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 or (resid 99 and (name N or name CA or name C or name O or name CB )) or resid 100 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 67 ? ? ? ? ? ? ? ? ? 1 2 B 191 B 197 ;(chain 'B' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 or (resid 99 and (name N or name CA or name C or name O or name CB )) or resid 100 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 68 ? ? ? ? ? ? ? ? ? 1 2 B 199 B 208 ;(chain 'B' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 or (resid 99 and (name N or name CA or name C or name O or name CB )) or resid 100 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 69 ? ? ? ? ? ? ? ? ? 1 2 B 210 B 221 ;(chain 'B' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 or (resid 99 and (name N or name CA or name C or name O or name CB )) or resid 100 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 70 ? ? ? ? ? ? ? ? ? 1 2 B 224 B 225 ;(chain 'B' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 or (resid 99 and (name N or name CA or name C or name O or name CB )) or resid 100 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 71 ? ? ? ? ? ? ? ? ? 1 2 B 227 B 235 ;(chain 'B' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 or (resid 99 and (name N or name CA or name C or name O or name CB )) or resid 100 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 72 ? ? ? ? ? ? ? ? ? 1 2 B 237 B 239 ;(chain 'B' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 or (resid 99 and (name N or name CA or name C or name O or name CB )) or resid 100 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 73 ? ? ? ? ? ? ? ? ? 1 2 B 246 B 247 ;(chain 'B' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 or (resid 99 and (name N or name CA or name C or name O or name CB )) or resid 100 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 74 ? ? ? ? ? ? ? ? ? 1 2 B 251 B 255 ;(chain 'B' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 or (resid 99 and (name N or name CA or name C or name O or name CB )) or resid 100 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 75 ? ? ? ? ? ? ? ? ? 1 2 B 257 B 273 ;(chain 'B' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 or (resid 99 and (name N or name CA or name C or name O or name CB )) or resid 100 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 76 ? ? ? ? ? ? ? ? ? 1 2 B 275 B 281 ;(chain 'B' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 or (resid 99 and (name N or name CA or name C or name O or name CB )) or resid 100 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 77 ? ? ? ? ? ? ? ? ? 1 2 B 283 B 294 ;(chain 'B' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 or (resid 99 and (name N or name CA or name C or name O or name CB )) or resid 100 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 78 ? ? ? ? ? ? ? ? ? 1 2 B 297 B 297 ;(chain 'B' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 or (resid 99 and (name N or name CA or name C or name O or name CB )) or resid 100 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 79 ? ? ? ? ? ? ? ? ? 1 2 B 299 B 306 ;(chain 'B' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 or (resid 99 and (name N or name CA or name C or name O or name CB )) or resid 100 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 80 ? ? ? ? ? ? ? ? ? 1 2 B 308 B 310 ;(chain 'B' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 or (resid 99 and (name N or name CA or name C or name O or name CB )) or resid 100 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 81 ? ? ? ? ? ? ? ? ? 1 2 B 312 B 316 ;(chain 'B' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 or (resid 99 and (name N or name CA or name C or name O or name CB )) or resid 100 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 82 ? ? ? ? ? ? ? ? ? 1 2 B 319 B 320 ;(chain 'B' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 or (resid 99 and (name N or name CA or name C or name O or name CB )) or resid 100 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 83 ? ? ? ? ? ? ? ? ? 1 2 B 323 B 324 ;(chain 'B' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 or (resid 99 and (name N or name CA or name C or name O or name CB )) or resid 100 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 84 ? ? ? ? ? ? ? ? ? 1 2 B 326 B 326 ;(chain 'B' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 or (resid 99 and (name N or name CA or name C or name O or name CB )) or resid 100 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 85 ? ? ? ? ? ? ? ? ? 1 2 B 332 B 332 ;(chain 'B' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 or (resid 99 and (name N or name CA or name C or name O or name CB )) or resid 100 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 86 ? ? ? ? ? ? ? ? ? 1 3 C 2 C 3 ;(chain 'C' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 87 ? ? ? ? ? ? ? ? ? 1 3 C 6 C 14 ;(chain 'C' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 88 ? ? ? ? ? ? ? ? ? 1 3 C 17 C 23 ;(chain 'C' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 89 ? ? ? ? ? ? ? ? ? 1 3 C 25 C 25 ;(chain 'C' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 90 ? ? ? ? ? ? ? ? ? 1 3 C 30 C 32 ;(chain 'C' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 91 ? ? ? ? ? ? ? ? ? 1 3 C 35 C 40 ;(chain 'C' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 92 ? ? ? ? ? ? ? ? ? 1 3 C 42 C 47 ;(chain 'C' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 93 ? ? ? ? ? ? ? ? ? 1 3 C 50 C 51 ;(chain 'C' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 94 ? ? ? ? ? ? ? ? ? 1 3 C 53 C 55 ;(chain 'C' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 95 ? ? ? ? ? ? ? ? ? 1 3 C 57 C 58 ;(chain 'C' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 96 ? ? ? ? ? ? ? ? ? 1 3 C 60 C 86 ;(chain 'C' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 97 ? ? ? ? ? ? ? ? ? 1 3 C 88 C 93 ;(chain 'C' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 98 ? ? ? ? ? ? ? ? ? 1 3 C 95 C 95 ;(chain 'C' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 99 ? ? ? ? ? ? ? ? ? 1 3 C 98 C 102 ;(chain 'C' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 100 ? ? ? ? ? ? ? ? ? 1 3 C 105 C 107 ;(chain 'C' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 101 ? ? ? ? ? ? ? ? ? 1 3 C 109 C 117 ;(chain 'C' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 102 ? ? ? ? ? ? ? ? ? 1 3 C 120 C 121 ;(chain 'C' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 103 ? ? ? ? ? ? ? ? ? 1 3 C 125 C 125 ;(chain 'C' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 104 ? ? ? ? ? ? ? ? ? 1 3 C 127 C 132 ;(chain 'C' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 105 ? ? ? ? ? ? ? ? ? 1 3 C 134 C 140 ;(chain 'C' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 106 ? ? ? ? ? ? ? ? ? 1 3 C 143 C 146 ;(chain 'C' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 107 ? ? ? ? ? ? ? ? ? 1 3 C 148 C 149 ;(chain 'C' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 108 ? ? ? ? ? ? ? ? ? 1 3 C 152 C 167 ;(chain 'C' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 109 ? ? ? ? ? ? ? ? ? 1 3 C 170 C 189 ;(chain 'C' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 110 ? ? ? ? ? ? ? ? ? 1 3 C 191 C 197 ;(chain 'C' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 111 ? ? ? ? ? ? ? ? ? 1 3 C 199 C 208 ;(chain 'C' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 112 ? ? ? ? ? ? ? ? ? 1 3 C 210 C 221 ;(chain 'C' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 113 ? ? ? ? ? ? ? ? ? 1 3 C 224 C 225 ;(chain 'C' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 114 ? ? ? ? ? ? ? ? ? 1 3 C 227 C 235 ;(chain 'C' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 115 ? ? ? ? ? ? ? ? ? 1 3 C 237 C 239 ;(chain 'C' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 116 ? ? ? ? ? ? ? ? ? 1 3 C 246 C 247 ;(chain 'C' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 117 ? ? ? ? ? ? ? ? ? 1 3 C 251 C 255 ;(chain 'C' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 118 ? ? ? ? ? ? ? ? ? 1 3 C 257 C 273 ;(chain 'C' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 119 ? ? ? ? ? ? ? ? ? 1 3 C 275 C 281 ;(chain 'C' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 120 ? ? ? ? ? ? ? ? ? 1 3 C 283 C 294 ;(chain 'C' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 121 ? ? ? ? ? ? ? ? ? 1 3 C 297 C 297 ;(chain 'C' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 122 ? ? ? ? ? ? ? ? ? 1 3 C 299 C 306 ;(chain 'C' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 123 ? ? ? ? ? ? ? ? ? 1 3 C 308 C 310 ;(chain 'C' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 124 ? ? ? ? ? ? ? ? ? 1 3 C 312 C 316 ;(chain 'C' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 125 ? ? ? ? ? ? ? ? ? 1 3 C 319 C 320 ;(chain 'C' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 126 ? ? ? ? ? ? ? ? ? 1 3 C 323 C 324 ;(chain 'C' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 127 ? ? ? ? ? ? ? ? ? 1 3 C 326 C 326 ;(chain 'C' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 128 ? ? ? ? ? ? ? ? ? 1 3 C 332 C 332 ;(chain 'C' and (resid 2 through 3 or resid 6 through 15 or resid 17 through 23 or resid 25 through 26 or resid 28 or resid 30 through 33 or resid 35 through 40 or resid 42 through 48 or resid 50 through 51 or resid 53 through 55 or resid 57 through 58 or resid 60 through 86 or resid 88 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB or name CG )) or resid 95 through 96 or resid 98 through 102 or resid 105 through 107 or resid 109 through 117 or resid 120 through 122 or resid 125 or resid 127 through 132 or resid 134 through 140 or resid 143 through 146 or resid 148 through 149 or resid 152 through 167 or resid 170 through 189 or resid 191 through 197 or resid 199 through 208 or resid 210 through 222 or resid 224 through 225 or resid 227 through 235 or resid 237 through 239 or resid 244 or resid 246 through 248 or resid 251 through 255 or resid 257 through 273 or resid 275 through 281 or resid 283 through 295 or resid 297 or resid 299 through 306 or resid 308 through 310 or resid 312 through 317 or resid 319 through 320 or resid 323 through 324 or resid 326 through 327 or resid 332)) ; 129 ? ? ? ? ? ? ? ? ? # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 5NUE _struct.title 'Cytosolic Malate Dehydrogenase 1 (peroxide-treated)' _struct.pdbx_descriptor 'Malate dehydrogenase 1, cytoplasmic (E.C.1.1.1.37)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5NUE _struct_keywords.text 'Dehydrogenase, Oxidized, Malate/Oxaloacetate, NAD+, oxidoreductase' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 5 ? G N N 6 ? H N N 6 ? I N N 7 ? J N N 7 ? K N N 7 ? L N N 8 ? M N N 9 ? N N N 10 ? O N N 4 ? P N N 5 ? Q N N 5 ? R N N 5 ? S N N 6 ? T N N 6 ? U N N 6 ? V N N 7 ? W N N 7 ? X N N 7 ? Y N N 7 ? Z N N 11 ? AA N N 11 ? BA N N 11 ? CA N N 8 ? DA N N 8 ? EA N N 12 ? FA N N 12 ? GA N N 4 ? HA N N 5 ? IA N N 5 ? JA N N 5 ? KA N N 6 ? LA N N 7 ? MA N N 7 ? NA N N 7 ? OA N N 7 ? PA N N 8 ? QA N N 8 ? RA N N 12 ? SA N N 13 ? TA N N 13 ? UA N N 13 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 15 ? ARG A 27 ? GLY A 15 ARG A 27 1 ? 13 HELX_P HELX_P2 AA2 ILE A 44 ? PRO A 46 ? ILE A 44 PRO A 46 5 ? 3 HELX_P HELX_P3 AA3 ALA A 47 ? ALA A 61 ? ALA A 47 ALA A 61 1 ? 15 HELX_P HELX_P4 AA4 ASP A 74 ? THR A 80 ? ASP A 74 THR A 80 1 ? 7 HELX_P HELX_P5 AA5 GLU A 98 ? ALA A 121 ? GLU A 98 ALA A 121 1 ? 24 HELX_P HELX_P6 AA6 PRO A 133 ? ALA A 145 ? PRO A 133 ALA A 145 1 ? 13 HELX_P HELX_P7 AA7 PRO A 149 ? LYS A 151 ? PRO A 149 LYS A 151 5 ? 3 HELX_P HELX_P8 AA8 THR A 157 ? SER A 173 ? THR A 157 SER A 173 1 ? 17 HELX_P HELX_P9 AA9 PRO A 175 ? SER A 177 ? PRO A 175 SER A 177 5 ? 3 HELX_P HELX_P10 AB1 VAL A 210 ? LYS A 215 ? VAL A 210 LYS A 215 1 ? 6 HELX_P HELX_P11 AB2 ASP A 216 ? ASP A 221 ? ASP A 216 ASP A 221 1 ? 6 HELX_P HELX_P12 AB3 GLY A 222 ? LYS A 240 ? GLY A 222 LYS A 240 1 ? 19 HELX_P HELX_P13 AB4 ALA A 244 ? GLY A 261 ? ALA A 244 GLY A 261 1 ? 18 HELX_P HELX_P14 AB5 GLY A 276 ? VAL A 280 ? GLY A 276 VAL A 280 5 ? 5 HELX_P HELX_P15 AB6 ASP A 306 ? LEU A 331 ? ASP A 306 LEU A 331 1 ? 26 HELX_P HELX_P16 AB7 GLY B 15 ? ARG B 27 ? GLY B 15 ARG B 27 1 ? 13 HELX_P HELX_P17 AB8 ILE B 44 ? PRO B 46 ? ILE B 44 PRO B 46 5 ? 3 HELX_P HELX_P18 AB9 ALA B 47 ? ALA B 61 ? ALA B 47 ALA B 61 1 ? 15 HELX_P HELX_P19 AC1 ASP B 74 ? THR B 80 ? ASP B 74 THR B 80 1 ? 7 HELX_P HELX_P20 AC2 GLU B 98 ? ASP B 101 ? GLU B 98 ASP B 101 5 ? 4 HELX_P HELX_P21 AC3 VAL B 102 ? ALA B 121 ? VAL B 102 ALA B 121 1 ? 20 HELX_P HELX_P22 AC4 PRO B 133 ? ALA B 145 ? PRO B 133 ALA B 145 1 ? 13 HELX_P HELX_P23 AC5 PRO B 149 ? LYS B 151 ? PRO B 149 LYS B 151 5 ? 3 HELX_P HELX_P24 AC6 THR B 157 ? SER B 173 ? THR B 157 SER B 173 1 ? 17 HELX_P HELX_P25 AC7 PRO B 175 ? SER B 177 ? PRO B 175 SER B 177 5 ? 3 HELX_P HELX_P26 AC8 VAL B 210 ? LYS B 215 ? VAL B 210 LYS B 215 1 ? 6 HELX_P HELX_P27 AC9 ASP B 216 ? GLY B 222 ? ASP B 216 GLY B 222 1 ? 7 HELX_P HELX_P28 AD1 GLY B 222 ? GLN B 230 ? GLY B 222 GLN B 230 1 ? 9 HELX_P HELX_P29 AD2 GLN B 230 ? LYS B 240 ? GLN B 230 LYS B 240 1 ? 11 HELX_P HELX_P30 AD3 ALA B 244 ? GLY B 261 ? ALA B 244 GLY B 261 1 ? 18 HELX_P HELX_P31 AD4 GLY B 276 ? VAL B 280 ? GLY B 276 VAL B 280 5 ? 5 HELX_P HELX_P32 AD5 ASP B 306 ? LEU B 331 ? ASP B 306 LEU B 331 1 ? 26 HELX_P HELX_P33 AD6 GLY C 15 ? ARG C 27 ? GLY C 15 ARG C 27 1 ? 13 HELX_P HELX_P34 AD7 ILE C 44 ? PRO C 46 ? ILE C 44 PRO C 46 5 ? 3 HELX_P HELX_P35 AD8 ALA C 47 ? ALA C 61 ? ALA C 47 ALA C 61 1 ? 15 HELX_P HELX_P36 AD9 ASP C 74 ? THR C 80 ? ASP C 74 THR C 80 1 ? 7 HELX_P HELX_P37 AE1 GLU C 98 ? ALA C 121 ? GLU C 98 ALA C 121 1 ? 24 HELX_P HELX_P38 AE2 PRO C 133 ? ALA C 145 ? PRO C 133 ALA C 145 1 ? 13 HELX_P HELX_P39 AE3 PRO C 149 ? LYS C 151 ? PRO C 149 LYS C 151 5 ? 3 HELX_P HELX_P40 AE4 THR C 157 ? SER C 173 ? THR C 157 SER C 173 1 ? 17 HELX_P HELX_P41 AE5 PRO C 175 ? SER C 177 ? PRO C 175 SER C 177 5 ? 3 HELX_P HELX_P42 AE6 VAL C 210 ? LYS C 215 ? VAL C 210 LYS C 215 1 ? 6 HELX_P HELX_P43 AE7 ASP C 216 ? ASP C 221 ? ASP C 216 ASP C 221 1 ? 6 HELX_P HELX_P44 AE8 GLY C 222 ? LYS C 240 ? GLY C 222 LYS C 240 1 ? 19 HELX_P HELX_P45 AE9 ALA C 244 ? GLY C 261 ? ALA C 244 GLY C 261 1 ? 18 HELX_P HELX_P46 AF1 GLY C 276 ? VAL C 280 ? GLY C 276 VAL C 280 5 ? 5 HELX_P HELX_P47 AF2 ASP C 306 ? LEU C 331 ? ASP C 306 LEU C 331 1 ? 26 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale both ? B LYS 55 C ? ? ? 1_555 B SME 56 N ? ? B LYS 55 B SME 56 1_555 ? ? ? ? ? ? ? 1.352 ? covale2 covale both ? B SME 56 C ? ? ? 1_555 B GLU 57 N ? ? B SME 56 B GLU 57 1_555 ? ? ? ? ? ? ? 1.327 ? covale3 covale both ? B GLY 96 C ? ? ? 1_555 B SME 97 N ? ? B GLY 96 B SME 97 1_555 ? ? ? ? ? ? ? 1.329 ? covale4 covale both ? B SME 97 C ? ? ? 1_555 B GLU 98 N ? ? B SME 97 B GLU 98 1_555 ? ? ? ? ? ? ? 1.320 ? covale5 covale both ? B SER 329 C ? ? ? 1_555 B CSD 330 N ? ? B SER 329 B CSD 330 1_555 ? ? ? ? ? ? ? 1.333 ? covale6 covale both ? B CSD 330 C ? ? ? 1_555 B LEU 331 N ? ? B CSD 330 B LEU 331 1_555 ? ? ? ? ? ? ? 1.341 ? covale7 covale both ? C LYS 55 C ? ? ? 1_555 C SME 56 N ? ? C LYS 55 C SME 56 1_555 ? ? ? ? ? ? ? 1.344 ? covale8 covale both ? C SME 56 C ? ? ? 1_555 C GLU 57 N ? ? C SME 56 C GLU 57 1_555 ? ? ? ? ? ? ? 1.345 ? covale9 covale both ? C SER 329 C ? ? ? 1_555 C CSO 330 N ? ? C SER 329 C CSO 330 1_555 ? ? ? ? ? ? ? 1.323 ? covale10 covale both ? C CSO 330 C ? ? ? 1_555 C LEU 331 N A ? C CSO 330 C LEU 331 1_555 ? ? ? ? ? ? ? 1.333 ? covale11 covale both ? C CSO 330 C ? ? ? 1_555 C LEU 331 N B ? C CSO 330 C LEU 331 1_555 ? ? ? ? ? ? ? 1.323 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ASN 132 A . ? ASN 132 A PRO 133 A ? PRO 133 A 1 -2.74 2 ASN 132 A . ? ASN 132 A PRO 133 A ? PRO 133 A 1 -1.95 3 ASN 132 B . ? ASN 132 B PRO 133 B ? PRO 133 B 1 -6.42 4 ASN 132 C . ? ASN 132 C PRO 133 C ? PRO 133 C 1 -2.27 5 ASN 132 C . ? ASN 132 C PRO 133 C ? PRO 133 C 1 -1.75 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 3 ? AA3 ? 2 ? AA4 ? 3 ? AA5 ? 9 ? AA6 ? 3 ? AA7 ? 2 ? AA8 ? 6 ? AA9 ? 3 ? AB1 ? 2 ? AB2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA5 1 2 ? parallel AA5 2 3 ? parallel AA5 3 4 ? parallel AA5 4 5 ? parallel AA5 5 6 ? parallel AA5 6 7 ? anti-parallel AA5 7 8 ? anti-parallel AA5 8 9 ? anti-parallel AA6 1 2 ? anti-parallel AA6 2 3 ? anti-parallel AA7 1 2 ? anti-parallel AA8 1 2 ? parallel AA8 2 3 ? parallel AA8 3 4 ? parallel AA8 4 5 ? parallel AA8 5 6 ? parallel AA9 1 2 ? anti-parallel AA9 2 3 ? anti-parallel AB1 1 2 ? anti-parallel AB2 1 2 ? anti-parallel AB2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 66 ? THR A 72 ? LEU A 66 THR A 72 AA1 2 VAL A 37 ? LEU A 42 ? VAL A 37 LEU A 42 AA1 3 VAL A 6 ? THR A 11 ? VAL A 6 THR A 11 AA1 4 VAL A 84 ? MET A 87 ? VAL A 84 MET A 87 AA1 5 LYS A 126 ? VAL A 129 ? LYS A 126 VAL A 129 AA1 6 ILE A 153 ? CYS A 155 ? ILE A 153 CYS A 155 AA2 1 VAL A 179 ? LYS A 180 ? VAL A 179 LYS A 180 AA2 2 LYS A 200 ? THR A 203 ? LYS A 200 THR A 203 AA2 3 GLY A 206 ? PRO A 209 ? GLY A 206 PRO A 209 AA3 1 ILE A 183 ? TRP A 185 ? ILE A 183 TRP A 185 AA3 2 TYR A 193 ? ASP A 195 ? TYR A 193 ASP A 195 AA4 1 VAL A 268 ? TYR A 273 ? VAL A 268 TYR A 273 AA4 2 ILE A 285 ? ARG A 293 ? ILE A 285 ARG A 293 AA4 3 ASP A 296 ? ILE A 299 ? ASP A 296 ILE A 299 AA5 1 LEU B 66 ? THR B 72 ? LEU B 66 THR B 72 AA5 2 VAL B 37 ? LEU B 42 ? VAL B 37 LEU B 42 AA5 3 VAL B 6 ? THR B 11 ? VAL B 6 THR B 11 AA5 4 VAL B 84 ? MET B 87 ? VAL B 84 MET B 87 AA5 5 LYS B 126 ? VAL B 129 ? LYS B 126 VAL B 129 AA5 6 ILE B 153 ? CYS B 155 ? ILE B 153 CYS B 155 AA5 7 VAL B 268 ? TYR B 273 ? VAL B 268 TYR B 273 AA5 8 ILE B 285 ? ARG B 293 ? ILE B 285 ARG B 293 AA5 9 ASP B 296 ? ILE B 299 ? ASP B 296 ILE B 299 AA6 1 VAL B 179 ? LYS B 180 ? VAL B 179 LYS B 180 AA6 2 LYS B 200 ? THR B 203 ? LYS B 200 THR B 203 AA6 3 GLY B 206 ? PRO B 209 ? GLY B 206 PRO B 209 AA7 1 ILE B 183 ? TRP B 185 ? ILE B 183 TRP B 185 AA7 2 TYR B 193 ? ASP B 195 ? TYR B 193 ASP B 195 AA8 1 LEU C 66 ? THR C 72 ? LEU C 66 THR C 72 AA8 2 VAL C 37 ? LEU C 42 ? VAL C 37 LEU C 42 AA8 3 VAL C 6 ? THR C 11 ? VAL C 6 THR C 11 AA8 4 VAL C 84 ? MET C 87 ? VAL C 84 MET C 87 AA8 5 LYS C 126 ? VAL C 129 ? LYS C 126 VAL C 129 AA8 6 ILE C 153 ? CYS C 155 ? ILE C 153 CYS C 155 AA9 1 VAL C 179 ? LYS C 180 ? VAL C 179 LYS C 180 AA9 2 LYS C 200 ? THR C 203 ? LYS C 200 THR C 203 AA9 3 GLY C 206 ? PRO C 209 ? GLY C 206 PRO C 209 AB1 1 ILE C 183 ? TRP C 185 ? ILE C 183 TRP C 185 AB1 2 TYR C 193 ? ASP C 195 ? TYR C 193 ASP C 195 AB2 1 VAL C 268 ? TYR C 273 ? VAL C 268 TYR C 273 AB2 2 ILE C 285 ? ARG C 293 ? ILE C 285 ARG C 293 AB2 3 ASP C 296 ? ILE C 299 ? ASP C 296 ILE C 299 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O VAL A 70 ? O VAL A 70 N MET A 41 ? N MET A 41 AA1 2 3 O ILE A 38 ? O ILE A 38 N VAL A 8 ? N VAL A 8 AA1 3 4 N LEU A 9 ? N LEU A 9 O VAL A 86 ? O VAL A 86 AA1 4 5 N MET A 87 ? N MET A 87 O LEU A 128 ? O LEU A 128 AA1 5 6 N VAL A 129 ? N VAL A 129 O SER A 154 ? O SER A 154 AA2 1 2 N LYS A 180 ? N LYS A 180 O LYS A 200 ? O LYS A 200 AA2 2 3 N VAL A 201 ? N VAL A 201 O LYS A 208 ? O LYS A 208 AA3 1 2 N ILE A 183 ? N ILE A 183 O ASP A 195 ? O ASP A 195 AA4 1 2 N VAL A 268 ? N VAL A 268 O VAL A 290 ? O VAL A 290 AA4 2 3 N THR A 291 ? N THR A 291 O SER A 298 ? O SER A 298 AA5 1 2 O VAL B 70 ? O VAL B 70 N MET B 41 ? N MET B 41 AA5 2 3 O ILE B 38 ? O ILE B 38 N VAL B 8 ? N VAL B 8 AA5 3 4 N LEU B 9 ? N LEU B 9 O VAL B 86 ? O VAL B 86 AA5 4 5 N MET B 87 ? N MET B 87 O LEU B 128 ? O LEU B 128 AA5 5 6 N VAL B 129 ? N VAL B 129 O SER B 154 ? O SER B 154 AA5 6 7 N CYS B 155 ? N CYS B 155 O GLY B 271 ? O GLY B 271 AA5 7 8 N VAL B 268 ? N VAL B 268 O VAL B 290 ? O VAL B 290 AA5 8 9 N THR B 291 ? N THR B 291 O SER B 298 ? O SER B 298 AA6 1 2 N LYS B 180 ? N LYS B 180 O LYS B 200 ? O LYS B 200 AA6 2 3 N VAL B 201 ? N VAL B 201 O LYS B 208 ? O LYS B 208 AA7 1 2 N ILE B 183 ? N ILE B 183 O ASP B 195 ? O ASP B 195 AA8 1 2 O LYS C 67 ? O LYS C 67 N VAL C 37 ? N VAL C 37 AA8 2 3 O ILE C 38 ? O ILE C 38 N VAL C 8 ? N VAL C 8 AA8 3 4 N LEU C 9 ? N LEU C 9 O VAL C 86 ? O VAL C 86 AA8 4 5 N MET C 87 ? N MET C 87 O LEU C 128 ? O LEU C 128 AA8 5 6 N VAL C 129 ? N VAL C 129 O SER C 154 ? O SER C 154 AA9 1 2 N LYS C 180 ? N LYS C 180 O LYS C 200 ? O LYS C 200 AA9 2 3 N VAL C 201 ? N VAL C 201 O LYS C 208 ? O LYS C 208 AB1 1 2 N ILE C 183 ? N ILE C 183 O ASP C 195 ? O ASP C 195 AB2 1 2 N VAL C 268 ? N VAL C 268 O VAL C 290 ? O VAL C 290 AB2 2 3 N THR C 291 ? N THR C 291 O SER C 298 ? O SER C 298 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A NAD 401 ? 33 'binding site for residue NAD A 401' AC2 Software A SO4 402 ? 10 'binding site for residue SO4 A 402' AC3 Software A SO4 403 ? 6 'binding site for residue SO4 A 403' AC4 Software A GOL 404 ? 9 'binding site for residue GOL A 404' AC5 Software A GOL 405 ? 4 'binding site for residue GOL A 405' AC6 Software A PEO 406 ? 6 'binding site for residue PEO A 406' AC7 Software A PEO 407 ? 7 'binding site for residue PEO A 407' AC8 Software A PEO 408 ? 5 'binding site for residue PEO A 408' AC9 Software A FMT 409 ? 4 'binding site for residue FMT A 409' AD1 Software A TRS 410 ? 4 'binding site for residue TRS A 410' AD2 Software A ETX 411 ? 7 'binding site for residue ETX A 411' AD3 Software B NAD 401 ? 34 'binding site for residue NAD B 401' AD4 Software B SO4 402 ? 8 'binding site for residue SO4 B 402' AD5 Software B SO4 403 ? 9 'binding site for residue SO4 B 403' AD6 Software B SO4 404 ? 11 'binding site for residue SO4 B 404' AD7 Software B GOL 405 ? 6 'binding site for residue GOL B 405' AD8 Software B GOL 406 ? 5 'binding site for residue GOL B 406' AD9 Software B GOL 407 ? 8 'binding site for residue GOL B 407' AE1 Software B PEO 408 ? 4 'binding site for residue PEO B 408' AE2 Software B PEO 409 ? 4 'binding site for residue PEO B 409' AE3 Software B PEO 410 ? 8 'binding site for residue PEO B 410' AE4 Software B PEO 411 ? 5 'binding site for residue PEO B 411' AE5 Software B ACT 412 ? 5 'binding site for residue ACT B 412' AE6 Software B ACT 413 ? 2 'binding site for residue ACT B 413' AE7 Software B ACT 414 ? 4 'binding site for residue ACT B 414' AE8 Software B FMT 415 ? 2 'binding site for residue FMT B 415' AE9 Software B FMT 416 ? 2 'binding site for residue FMT B 416' AF1 Software B EDO 417 ? 10 'binding site for residue EDO B 417' AF2 Software B EDO 418 ? 8 'binding site for residue EDO B 418' AF3 Software C NAD 401 ? 33 'binding site for residue NAD C 401' AF4 Software C SO4 402 ? 10 'binding site for residue SO4 C 402' AF5 Software C SO4 403 ? 10 'binding site for residue SO4 C 403' AF6 Software C SO4 404 ? 7 'binding site for residue SO4 C 404' AF7 Software C GOL 405 ? 7 'binding site for residue GOL C 405' AF8 Software C PEO 406 ? 6 'binding site for residue PEO C 406' AF9 Software C PEO 407 ? 5 'binding site for residue PEO C 407' AG1 Software C PEO 408 ? 7 'binding site for residue PEO C 408' AG2 Software C PEO 409 ? 7 'binding site for residue PEO C 409' AG3 Software C FMT 410 ? 4 'binding site for residue FMT C 410' AG4 Software C FMT 411 ? 7 'binding site for residue FMT C 411' AG5 Software C EDO 412 ? 6 'binding site for residue EDO C 412' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 33 GLY A 12 ? GLY A 12 . ? 1_555 ? 2 AC1 33 GLY A 15 ? GLY A 15 . ? 1_555 ? 3 AC1 33 GLN A 16 ? GLN A 16 . ? 1_555 ? 4 AC1 33 ILE A 17 ? ILE A 17 . ? 1_555 ? 5 AC1 33 ASP A 43 ? ASP A 43 . ? 1_555 ? 6 AC1 33 ILE A 44 ? ILE A 44 . ? 1_555 ? 7 AC1 33 VAL A 88 ? VAL A 88 . ? 1_555 ? 8 AC1 33 GLY A 89 ? GLY A 89 . ? 1_555 ? 9 AC1 33 GLY A 90 ? GLY A 90 . ? 1_555 ? 10 AC1 33 PHE A 91 ? PHE A 91 . ? 1_555 ? 11 AC1 33 PRO A 92 ? PRO A 92 . ? 1_555 ? 12 AC1 33 ILE A 109 ? ILE A 109 . ? 1_555 ? 13 AC1 33 GLN A 113 ? GLN A 113 . ? 1_555 ? 14 AC1 33 VAL A 130 ? VAL A 130 . ? 1_555 ? 15 AC1 33 ALA A 131 ? ALA A 131 . ? 1_555 ? 16 AC1 33 ASN A 132 ? ASN A 132 . ? 1_555 ? 17 AC1 33 LEU A 156 ? LEU A 156 . ? 1_555 ? 18 AC1 33 HIS A 188 ? HIS A 188 . ? 1_555 ? 19 AC1 33 SER A 243 ? SER A 243 . ? 1_555 ? 20 AC1 33 SO4 E . ? SO4 A 402 . ? 1_555 ? 21 AC1 33 HOH SA . ? HOH A 517 . ? 1_555 ? 22 AC1 33 HOH SA . ? HOH A 553 . ? 1_555 ? 23 AC1 33 HOH SA . ? HOH A 561 . ? 1_555 ? 24 AC1 33 HOH SA . ? HOH A 564 . ? 1_555 ? 25 AC1 33 HOH SA . ? HOH A 567 . ? 1_555 ? 26 AC1 33 HOH SA . ? HOH A 570 . ? 1_555 ? 27 AC1 33 HOH SA . ? HOH A 571 . ? 1_555 ? 28 AC1 33 HOH SA . ? HOH A 589 . ? 1_555 ? 29 AC1 33 HOH SA . ? HOH A 599 . ? 1_555 ? 30 AC1 33 HOH SA . ? HOH A 600 . ? 1_555 ? 31 AC1 33 HOH SA . ? HOH A 614 . ? 1_555 ? 32 AC1 33 HOH SA . ? HOH A 631 . ? 1_555 ? 33 AC1 33 HOH SA . ? HOH A 655 . ? 1_555 ? 34 AC2 10 ASN A 132 ? ASN A 132 . ? 1_555 ? 35 AC2 10 ARG A 163 ? ARG A 163 . ? 1_555 ? 36 AC2 10 HIS A 188 ? HIS A 188 . ? 1_555 ? 37 AC2 10 GLY A 232 ? GLY A 232 . ? 1_555 ? 38 AC2 10 SER A 243 ? SER A 243 . ? 1_555 ? 39 AC2 10 NAD D . ? NAD A 401 . ? 1_555 ? 40 AC2 10 HOH SA . ? HOH A 565 . ? 1_555 ? 41 AC2 10 HOH SA . ? HOH A 611 . ? 1_555 ? 42 AC2 10 HOH SA . ? HOH A 674 . ? 1_555 ? 43 AC2 10 HOH SA . ? HOH A 679 . ? 1_555 ? 44 AC3 6 ARG A 7 ? ARG A 7 . ? 1_555 ? 45 AC3 6 ILE A 38 ? ILE A 38 . ? 1_555 ? 46 AC3 6 HIS A 40 ? HIS A 40 . ? 1_555 ? 47 AC3 6 VAL A 70 ? VAL A 70 . ? 1_555 ? 48 AC3 6 HOH SA . ? HOH A 508 . ? 1_555 ? 49 AC3 6 HOH SA . ? HOH A 520 . ? 1_555 ? 50 AC4 9 ILE A 299 ? ILE A 299 . ? 1_555 ? 51 AC4 9 VAL A 300 ? VAL A 300 . ? 1_555 ? 52 AC4 9 GLN A 301 ? GLN A 301 . ? 1_555 ? 53 AC4 9 HOH SA . ? HOH A 537 . ? 1_555 ? 54 AC4 9 LYS B 100 ? LYS B 100 . ? 1_455 ? 55 AC4 9 ASP B 101 ? ASP B 101 . ? 1_455 ? 56 AC4 9 MET B 103 ? MET B 103 . ? 1_455 ? 57 AC4 9 SER B 104 ? SER B 104 . ? 1_455 ? 58 AC4 9 LEU B 326 ? LEU B 326 . ? 1_455 ? 59 AC5 4 GLN A 202 ? GLN A 202 . ? 1_555 ? 60 AC5 4 GLY A 206 ? GLY A 206 . ? 1_555 ? 61 AC5 4 GLU A 207 ? GLU A 207 . ? 1_555 ? 62 AC5 4 HOH SA . ? HOH A 514 . ? 1_555 ? 63 AC6 6 ARG A 163 ? ARG A 163 . ? 1_555 ? 64 AC6 6 GLY A 166 ? GLY A 166 . ? 1_555 ? 65 AC6 6 GLN A 167 ? GLN A 167 . ? 1_555 ? 66 AC6 6 ARG A 231 ? ARG A 231 . ? 1_555 ? 67 AC6 6 ILE B 59 ? ILE B 59 . ? 1_555 ? 68 AC6 6 ASP B 60 ? ASP B 60 . ? 1_555 ? 69 AC7 7 ASP A 253 ? ASP A 253 . ? 1_555 ? 70 AC7 7 HOH SA . ? HOH A 598 . ? 1_555 ? 71 AC7 7 HOH SA . ? HOH A 640 . ? 1_555 ? 72 AC7 7 ARG B 27 ? ARG B 27 . ? 1_555 ? 73 AC7 7 ALA B 61 ? ALA B 61 . ? 1_555 ? 74 AC7 7 ALA B 62 ? ALA B 62 . ? 1_555 ? 75 AC7 7 HOH TA . ? HOH B 628 . ? 1_555 ? 76 AC8 5 LYS A 142 ? LYS A 142 . ? 1_555 ? 77 AC8 5 GLU A 143 ? GLU A 143 . ? 1_555 ? 78 AC8 5 PRO A 146 ? PRO A 146 . ? 1_555 ? 79 AC8 5 HOH SA . ? HOH A 507 . ? 1_555 ? 80 AC8 5 HOH SA . ? HOH A 601 . ? 1_555 ? 81 AC9 4 SER A 190 ? SER A 190 . ? 1_555 ? 82 AC9 4 GLN A 230 ? GLN A 230 . ? 1_555 ? 83 AC9 4 HOH SA . ? HOH A 531 . ? 1_555 ? 84 AC9 4 HOH SA . ? HOH A 597 . ? 1_555 ? 85 AD1 4 LYS A 215 ? LYS A 215 . ? 1_555 ? 86 AD1 4 ASP A 216 ? ASP A 216 . ? 1_555 ? 87 AD1 4 ASP A 217 ? ASP A 217 . ? 1_555 ? 88 AD1 4 ALA A 218 ? ALA A 218 . ? 1_555 ? 89 AD2 7 GLN A 167 ? GLN A 167 . ? 1_555 ? 90 AD2 7 ARG A 231 ? ARG A 231 . ? 1_555 ? 91 AD2 7 HOH SA . ? HOH A 709 . ? 1_555 ? 92 AD2 7 HOH SA . ? HOH A 760 . ? 1_555 ? 93 AD2 7 SME B 56 ? SME B 56 . ? 1_555 ? 94 AD2 7 ILE B 59 ? ILE B 59 . ? 1_555 ? 95 AD2 7 HOH UA . ? HOH C 792 . ? 4_554 ? 96 AD3 34 GLY B 12 ? GLY B 12 . ? 1_555 ? 97 AD3 34 ALA B 14 ? ALA B 14 . ? 1_555 ? 98 AD3 34 GLY B 15 ? GLY B 15 . ? 1_555 ? 99 AD3 34 GLN B 16 ? GLN B 16 . ? 1_555 ? 100 AD3 34 ILE B 17 ? ILE B 17 . ? 1_555 ? 101 AD3 34 ASP B 43 ? ASP B 43 . ? 1_555 ? 102 AD3 34 ILE B 44 ? ILE B 44 . ? 1_555 ? 103 AD3 34 VAL B 88 ? VAL B 88 . ? 1_555 ? 104 AD3 34 GLY B 89 ? GLY B 89 . ? 1_555 ? 105 AD3 34 GLY B 90 ? GLY B 90 . ? 1_555 ? 106 AD3 34 PHE B 91 ? PHE B 91 . ? 1_555 ? 107 AD3 34 PRO B 92 ? PRO B 92 . ? 1_555 ? 108 AD3 34 ILE B 109 ? ILE B 109 . ? 1_555 ? 109 AD3 34 GLN B 113 ? GLN B 113 . ? 1_555 ? 110 AD3 34 VAL B 130 ? VAL B 130 . ? 1_555 ? 111 AD3 34 ALA B 131 ? ALA B 131 . ? 1_555 ? 112 AD3 34 ASN B 132 ? ASN B 132 . ? 1_555 ? 113 AD3 34 LEU B 156 ? LEU B 156 . ? 1_555 ? 114 AD3 34 HIS B 188 ? HIS B 188 . ? 1_555 ? 115 AD3 34 SER B 242 ? SER B 242 . ? 1_555 ? 116 AD3 34 SER B 243 ? SER B 243 . ? 1_555 ? 117 AD3 34 SO4 R . ? SO4 B 404 . ? 1_555 ? 118 AD3 34 PEO Y . ? PEO B 411 . ? 1_555 ? 119 AD3 34 HOH TA . ? HOH B 503 . ? 1_555 ? 120 AD3 34 HOH TA . ? HOH B 512 . ? 1_555 ? 121 AD3 34 HOH TA . ? HOH B 561 . ? 1_555 ? 122 AD3 34 HOH TA . ? HOH B 562 . ? 1_555 ? 123 AD3 34 HOH TA . ? HOH B 564 . ? 1_555 ? 124 AD3 34 HOH TA . ? HOH B 585 . ? 1_555 ? 125 AD3 34 HOH TA . ? HOH B 599 . ? 1_555 ? 126 AD3 34 HOH TA . ? HOH B 604 . ? 1_555 ? 127 AD3 34 HOH TA . ? HOH B 648 . ? 1_555 ? 128 AD3 34 HOH TA . ? HOH B 670 . ? 1_555 ? 129 AD3 34 HOH TA . ? HOH B 682 . ? 1_555 ? 130 AD4 8 GLU B 98 ? GLU B 98 . ? 1_555 ? 131 AD4 8 ARG B 99 ? ARG B 99 . ? 1_555 ? 132 AD4 8 SER B 189 ? SER B 189 . ? 1_555 ? 133 AD4 8 SER B 190 ? SER B 190 . ? 1_555 ? 134 AD4 8 HOH TA . ? HOH B 592 . ? 1_555 ? 135 AD4 8 HOH TA . ? HOH B 632 . ? 1_555 ? 136 AD4 8 HOH TA . ? HOH B 654 . ? 1_555 ? 137 AD4 8 HOH TA . ? HOH B 683 . ? 1_555 ? 138 AD5 9 ARG B 7 ? ARG B 7 . ? 1_555 ? 139 AD5 9 ILE B 38 ? ILE B 38 . ? 1_555 ? 140 AD5 9 HIS B 40 ? HIS B 40 . ? 1_555 ? 141 AD5 9 VAL B 70 ? VAL B 70 . ? 1_555 ? 142 AD5 9 HOH TA . ? HOH B 502 . ? 1_555 ? 143 AD5 9 HOH TA . ? HOH B 504 . ? 1_555 ? 144 AD5 9 HOH TA . ? HOH B 571 . ? 1_555 ? 145 AD5 9 HOH TA . ? HOH B 621 . ? 1_555 ? 146 AD5 9 GLU C 170 ? GLU C 170 . ? 3_555 ? 147 AD6 11 ARG B 93 ? ARG B 93 . ? 1_555 ? 148 AD6 11 ARG B 99 ? ARG B 99 . ? 1_555 ? 149 AD6 11 ASN B 132 ? ASN B 132 . ? 1_555 ? 150 AD6 11 ARG B 163 ? ARG B 163 . ? 1_555 ? 151 AD6 11 HIS B 188 ? HIS B 188 . ? 1_555 ? 152 AD6 11 GLY B 232 ? GLY B 232 . ? 1_555 ? 153 AD6 11 SER B 243 ? SER B 243 . ? 1_555 ? 154 AD6 11 NAD O . ? NAD B 401 . ? 1_555 ? 155 AD6 11 PEO Y . ? PEO B 411 . ? 1_555 ? 156 AD6 11 EDO EA . ? EDO B 417 . ? 1_555 ? 157 AD6 11 HOH TA . ? HOH B 549 . ? 1_555 ? 158 AD7 6 ILE A 59 ? ILE A 59 . ? 1_555 ? 159 AD7 6 GLN B 167 ? GLN B 167 . ? 1_555 ? 160 AD7 6 ARG B 231 ? ARG B 231 . ? 1_555 ? 161 AD7 6 HOH TA . ? HOH B 555 . ? 1_555 ? 162 AD7 6 HOH TA . ? HOH B 581 . ? 1_555 ? 163 AD7 6 HOH TA . ? HOH B 607 . ? 1_555 ? 164 AD8 5 ASN B 83 ? ASN B 83 . ? 1_555 ? 165 AD8 5 ASN B 124 ? ASN B 124 . ? 1_555 ? 166 AD8 5 LYS B 126 ? LYS B 126 . ? 1_555 ? 167 AD8 5 HOH TA . ? HOH B 541 . ? 1_555 ? 168 AD8 5 HOH TA . ? HOH B 749 . ? 1_555 ? 169 AD9 8 ARG A 239 ? ARG A 239 . ? 1_555 ? 170 AD9 8 HOH SA . ? HOH A 683 . ? 1_555 ? 171 AD9 8 ALA B 14 ? ALA B 14 . ? 1_555 ? 172 AD9 8 GLY B 15 ? GLY B 15 . ? 1_555 ? 173 AD9 8 GLN B 16 ? GLN B 16 . ? 1_555 ? 174 AD9 8 HOH TA . ? HOH B 511 . ? 1_555 ? 175 AD9 8 HOH TA . ? HOH B 547 . ? 1_555 ? 176 AD9 8 HOH TA . ? HOH B 630 . ? 1_555 ? 177 AE1 4 ASP A 60 ? ASP A 60 . ? 1_555 ? 178 AE1 4 ARG B 163 ? ARG B 163 . ? 1_555 ? 179 AE1 4 GLN B 167 ? GLN B 167 . ? 1_555 ? 180 AE1 4 ARG B 231 ? ARG B 231 . ? 1_555 ? 181 AE2 4 LYS B 142 ? LYS B 142 . ? 1_555 ? 182 AE2 4 GLU B 143 ? GLU B 143 . ? 1_555 ? 183 AE2 4 PRO B 146 ? PRO B 146 . ? 1_555 ? 184 AE2 4 HOH TA . ? HOH B 536 . ? 1_555 ? 185 AE3 8 VAL A 176 ? VAL A 176 . ? 1_555 ? 186 AE3 8 HOH SA . ? HOH A 555 . ? 1_555 ? 187 AE3 8 ILE B 59 ? ILE B 59 . ? 1_555 ? 188 AE3 8 PHE B 63 ? PHE B 63 . ? 1_555 ? 189 AE3 8 LEU B 66 ? LEU B 66 . ? 1_555 ? 190 AE3 8 HOH TA . ? HOH B 507 . ? 1_555 ? 191 AE3 8 HOH TA . ? HOH B 530 . ? 1_555 ? 192 AE3 8 HOH TA . ? HOH B 583 . ? 1_555 ? 193 AE4 5 GLY B 232 ? GLY B 232 . ? 1_555 ? 194 AE4 5 SER B 242 ? SER B 242 . ? 1_555 ? 195 AE4 5 SER B 243 ? SER B 243 . ? 1_555 ? 196 AE4 5 NAD O . ? NAD B 401 . ? 1_555 ? 197 AE4 5 SO4 R . ? SO4 B 404 . ? 1_555 ? 198 AE5 5 ASP B 216 ? ASP B 216 . ? 1_555 ? 199 AE5 5 ASP B 217 ? ASP B 217 . ? 1_555 ? 200 AE5 5 ALA B 218 ? ALA B 218 . ? 1_555 ? 201 AE5 5 GLU C 318 ? GLU C 318 . ? 2_666 ? 202 AE5 5 LYS C 321 ? LYS C 321 . ? 2_666 ? 203 AE6 2 PRO B 149 ? PRO B 149 . ? 1_555 ? 204 AE6 2 GLU B 150 ? GLU B 150 . ? 1_555 ? 205 AE7 4 PRO B 281 ? PRO B 281 . ? 1_555 ? 206 AE7 4 SER B 282 ? SER B 282 . ? 1_555 ? 207 AE7 4 HOH TA . ? HOH B 509 . ? 1_555 ? 208 AE7 4 HOH TA . ? HOH B 663 . ? 1_555 ? 209 AE8 2 GLY B 206 ? GLY B 206 . ? 1_555 ? 210 AE8 2 GLU B 207 ? GLU B 207 . ? 1_555 ? 211 AE9 2 LYS B 111 ? LYS B 111 . ? 1_555 ? 212 AE9 2 SER B 332 ? SER B 332 . ? 1_555 ? 213 AF1 10 ARG B 99 ? ARG B 99 . ? 1_555 ? 214 AF1 10 ASP B 160 ? ASP B 160 . ? 1_555 ? 215 AF1 10 ARG B 163 ? ARG B 163 . ? 1_555 ? 216 AF1 10 GLN B 192 ? GLN B 192 . ? 1_555 ? 217 AF1 10 VAL B 228 ? VAL B 228 . ? 1_555 ? 218 AF1 10 GLN B 229 ? GLN B 229 . ? 1_555 ? 219 AF1 10 ARG B 231 ? ARG B 231 . ? 1_555 ? 220 AF1 10 GLY B 232 ? GLY B 232 . ? 1_555 ? 221 AF1 10 SO4 R . ? SO4 B 404 . ? 1_555 ? 222 AF1 10 HOH TA . ? HOH B 613 . ? 1_555 ? 223 AF2 8 LYS A 180 ? LYS A 180 . ? 1_655 ? 224 AF2 8 LYS A 200 ? LYS A 200 . ? 1_655 ? 225 AF2 8 GLU A 207 ? GLU A 207 . ? 1_655 ? 226 AF2 8 ASP B 325 ? ASP B 325 . ? 1_555 ? 227 AF2 8 TYR B 328 ? TYR B 328 . ? 1_555 ? 228 AF2 8 SER B 329 ? SER B 329 . ? 1_555 ? 229 AF2 8 HOH TA . ? HOH B 685 . ? 1_555 ? 230 AF2 8 HOH TA . ? HOH B 734 . ? 1_555 ? 231 AF3 33 GLY C 12 ? GLY C 12 . ? 1_555 ? 232 AF3 33 GLY C 15 ? GLY C 15 . ? 1_555 ? 233 AF3 33 GLN C 16 ? GLN C 16 . ? 1_555 ? 234 AF3 33 ILE C 17 ? ILE C 17 . ? 1_555 ? 235 AF3 33 ASP C 43 ? ASP C 43 . ? 1_555 ? 236 AF3 33 ILE C 44 ? ILE C 44 . ? 1_555 ? 237 AF3 33 VAL C 88 ? VAL C 88 . ? 1_555 ? 238 AF3 33 GLY C 89 ? GLY C 89 . ? 1_555 ? 239 AF3 33 GLY C 90 ? GLY C 90 . ? 1_555 ? 240 AF3 33 PHE C 91 ? PHE C 91 . ? 1_555 ? 241 AF3 33 PRO C 92 ? PRO C 92 . ? 1_555 ? 242 AF3 33 ILE C 109 ? ILE C 109 . ? 1_555 ? 243 AF3 33 GLN C 113 ? GLN C 113 . ? 1_555 ? 244 AF3 33 VAL C 130 ? VAL C 130 . ? 1_555 ? 245 AF3 33 ALA C 131 ? ALA C 131 . ? 1_555 ? 246 AF3 33 ASN C 132 ? ASN C 132 . ? 1_555 ? 247 AF3 33 LEU C 156 ? LEU C 156 . ? 1_555 ? 248 AF3 33 HIS C 188 ? HIS C 188 . ? 1_555 ? 249 AF3 33 SER C 243 ? SER C 243 . ? 1_555 ? 250 AF3 33 SO4 HA . ? SO4 C 402 . ? 1_555 ? 251 AF3 33 PEO MA . ? PEO C 407 . ? 1_555 ? 252 AF3 33 HOH UA . ? HOH C 520 . ? 1_555 ? 253 AF3 33 HOH UA . ? HOH C 547 . ? 1_555 ? 254 AF3 33 HOH UA . ? HOH C 554 . ? 1_555 ? 255 AF3 33 HOH UA . ? HOH C 585 . ? 1_555 ? 256 AF3 33 HOH UA . ? HOH C 593 . ? 1_555 ? 257 AF3 33 HOH UA . ? HOH C 598 . ? 1_555 ? 258 AF3 33 HOH UA . ? HOH C 601 . ? 1_555 ? 259 AF3 33 HOH UA . ? HOH C 603 . ? 1_555 ? 260 AF3 33 HOH UA . ? HOH C 604 . ? 1_555 ? 261 AF3 33 HOH UA . ? HOH C 625 . ? 1_555 ? 262 AF3 33 HOH UA . ? HOH C 658 . ? 1_555 ? 263 AF3 33 HOH UA . ? HOH C 695 . ? 1_555 ? 264 AF4 10 ASN C 132 ? ASN C 132 . ? 1_555 ? 265 AF4 10 ARG C 163 ? ARG C 163 . ? 1_555 ? 266 AF4 10 HIS C 188 ? HIS C 188 . ? 1_555 ? 267 AF4 10 GLY C 232 ? GLY C 232 . ? 1_555 ? 268 AF4 10 SER C 243 ? SER C 243 . ? 1_555 ? 269 AF4 10 NAD GA . ? NAD C 401 . ? 1_555 ? 270 AF4 10 HOH UA . ? HOH C 578 . ? 1_555 ? 271 AF4 10 HOH UA . ? HOH C 620 . ? 1_555 ? 272 AF4 10 HOH UA . ? HOH C 693 . ? 1_555 ? 273 AF4 10 HOH UA . ? HOH C 741 . ? 1_555 ? 274 AF5 10 GLU A 170 ? GLU A 170 . ? 4_555 ? 275 AF5 10 HOH SA . ? HOH A 652 . ? 4_555 ? 276 AF5 10 HOH TA . ? HOH B 780 . ? 4_555 ? 277 AF5 10 ARG C 7 ? ARG C 7 . ? 1_555 ? 278 AF5 10 ILE C 38 ? ILE C 38 . ? 1_555 ? 279 AF5 10 HIS C 40 ? HIS C 40 . ? 1_555 ? 280 AF5 10 VAL C 70 ? VAL C 70 . ? 1_555 ? 281 AF5 10 HOH UA . ? HOH C 501 . ? 1_555 ? 282 AF5 10 HOH UA . ? HOH C 599 . ? 1_555 ? 283 AF5 10 HOH UA . ? HOH C 629 . ? 1_555 ? 284 AF6 7 ARG A 171 ? ARG A 171 . ? 4_555 ? 285 AF6 7 GLU A 223 ? GLU A 223 . ? 4_555 ? 286 AF6 7 HOH SA . ? HOH A 781 . ? 4_555 ? 287 AF6 7 ALA C 122 ? ALA C 122 . ? 1_555 ? 288 AF6 7 PRO C 123 ? PRO C 123 . ? 1_555 ? 289 AF6 7 ASN C 124 ? ASN C 124 . ? 1_555 ? 290 AF6 7 HOH UA . ? HOH C 674 . ? 1_555 ? 291 AF7 7 SER C 277 ? SER C 277 . ? 1_555 ? 292 AF7 7 TYR C 278 ? TYR C 278 . ? 1_555 ? 293 AF7 7 GLN C 301 ? GLN C 301 . ? 1_555 ? 294 AF7 7 GLY C 302 ? GLY C 302 . ? 1_555 ? 295 AF7 7 EDO RA . ? EDO C 412 . ? 1_555 ? 296 AF7 7 HOH UA . ? HOH C 642 . ? 1_555 ? 297 AF7 7 HOH UA . ? HOH C 725 . ? 1_555 ? 298 AF8 6 ILE C 59 ? ILE C 59 . ? 1_555 ? 299 AF8 6 ASP C 60 ? ASP C 60 . ? 1_555 ? 300 AF8 6 ARG C 163 ? ARG C 163 . ? 2_556 ? 301 AF8 6 GLY C 166 ? GLY C 166 . ? 2_556 ? 302 AF8 6 GLN C 167 ? GLN C 167 . ? 2_556 ? 303 AF8 6 ARG C 231 ? ARG C 231 . ? 2_556 ? 304 AF9 5 ILE C 44 ? ILE C 44 . ? 1_555 ? 305 AF9 5 NAD GA . ? NAD C 401 . ? 1_555 ? 306 AF9 5 HOH UA . ? HOH C 549 . ? 1_555 ? 307 AF9 5 HOH UA . ? HOH C 552 . ? 1_555 ? 308 AF9 5 HOH UA . ? HOH C 631 . ? 1_555 ? 309 AG1 7 ILE C 59 ? ILE C 59 . ? 1_555 ? 310 AG1 7 PHE C 63 ? PHE C 63 . ? 1_555 ? 311 AG1 7 LEU C 66 ? LEU C 66 . ? 1_555 ? 312 AG1 7 VAL C 176 ? VAL C 176 . ? 2_556 ? 313 AG1 7 HOH UA . ? HOH C 504 . ? 1_555 ? 314 AG1 7 HOH UA . ? HOH C 590 . ? 1_555 ? 315 AG1 7 HOH UA . ? HOH C 699 . ? 2_556 ? 316 AG2 7 GLN C 16 ? GLN C 16 . ? 1_555 ? 317 AG2 7 TYR C 19 ? TYR C 19 . ? 2_556 ? 318 AG2 7 ARG C 239 ? ARG C 239 . ? 1_555 ? 319 AG2 7 HOH UA . ? HOH C 521 . ? 1_555 ? 320 AG2 7 HOH UA . ? HOH C 521 . ? 2_556 ? 321 AG2 7 HOH UA . ? HOH C 662 . ? 1_555 ? 322 AG2 7 HOH UA . ? HOH C 712 . ? 1_555 ? 323 AG3 4 SER C 190 ? SER C 190 . ? 1_555 ? 324 AG3 4 GLN C 230 ? GLN C 230 . ? 1_555 ? 325 AG3 4 HOH UA . ? HOH C 519 . ? 1_555 ? 326 AG3 4 HOH UA . ? HOH C 656 . ? 1_555 ? 327 AG4 7 VAL C 259 ? VAL C 259 . ? 1_555 ? 328 AG4 7 LEU C 260 ? LEU C 260 . ? 1_555 ? 329 AG4 7 GLY C 261 ? GLY C 261 . ? 1_555 ? 330 AG4 7 ARG C 293 ? ARG C 293 . ? 1_555 ? 331 AG4 7 ASN C 294 ? ASN C 294 . ? 1_555 ? 332 AG4 7 HOH UA . ? HOH C 508 . ? 1_555 ? 333 AG4 7 HOH UA . ? HOH C 678 . ? 1_555 ? 334 AG5 6 TYR C 278 ? TYR C 278 . ? 1_555 ? 335 AG5 6 SER C 279 ? SER C 279 . ? 1_555 ? 336 AG5 6 ARG C 310 ? ARG C 310 . ? 1_555 ? 337 AG5 6 GOL KA . ? GOL C 405 . ? 1_555 ? 338 AG5 6 HOH UA . ? HOH C 507 . ? 1_555 ? 339 AG5 6 HOH UA . ? HOH C 723 . ? 1_555 ? # _atom_sites.entry_id 5NUE _atom_sites.fract_transf_matrix[1][1] 0.015480 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008448 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006735 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 MET 24 24 24 MET MET A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 MET 30 30 30 MET MET A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 HIS 40 40 40 HIS HIS A . n A 1 41 MET 41 41 41 MET MET A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 MET 56 56 56 MET MET A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 CYS 79 79 79 CYS CYS A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 ASN 83 83 83 ASN ASN A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 MET 87 87 87 MET MET A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 PHE 91 91 91 PHE PHE A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 MET 97 97 97 MET MET A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 ASP 101 101 101 ASP ASP A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 MET 103 103 103 MET MET A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 ASN 106 106 106 ASN ASN A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 ILE 109 109 109 ILE ILE A . n A 1 110 TYR 110 110 110 TYR TYR A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 SER 112 112 112 SER SER A . n A 1 113 GLN 113 113 113 GLN GLN A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 HIS 120 120 120 HIS HIS A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 PRO 123 123 123 PRO PRO A . n A 1 124 ASN 124 124 124 ASN ASN A . n A 1 125 CYS 125 125 125 CYS CYS A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 VAL 127 127 127 VAL VAL A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 VAL 129 129 129 VAL VAL A . n A 1 130 VAL 130 130 130 VAL VAL A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 ASN 132 132 132 ASN ASN A . n A 1 133 PRO 133 133 133 PRO PRO A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 ASN 135 135 135 ASN ASN A . n A 1 136 THR 136 136 136 THR THR A . n A 1 137 ASN 137 137 137 ASN ASN A . n A 1 138 ALA 138 138 138 ALA ALA A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 ILE 140 140 140 ILE ILE A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 LYS 142 142 142 LYS LYS A . n A 1 143 GLU 143 143 143 GLU GLU A . n A 1 144 PHE 144 144 144 PHE PHE A . n A 1 145 ALA 145 145 145 ALA ALA A . n A 1 146 PRO 146 146 146 PRO PRO A . n A 1 147 SER 147 147 147 SER SER A . n A 1 148 ILE 148 148 148 ILE ILE A . n A 1 149 PRO 149 149 149 PRO PRO A . n A 1 150 GLU 150 150 150 GLU GLU A . n A 1 151 LYS 151 151 151 LYS LYS A . n A 1 152 ASN 152 152 152 ASN ASN A . n A 1 153 ILE 153 153 153 ILE ILE A . n A 1 154 SER 154 154 154 SER SER A . n A 1 155 CYS 155 155 155 CYS CYS A . n A 1 156 LEU 156 156 156 LEU LEU A . n A 1 157 THR 157 157 157 THR THR A . n A 1 158 ARG 158 158 158 ARG ARG A . n A 1 159 LEU 159 159 159 LEU LEU A . n A 1 160 ASP 160 160 160 ASP ASP A . n A 1 161 HIS 161 161 161 HIS HIS A . n A 1 162 ASN 162 162 162 ASN ASN A . n A 1 163 ARG 163 163 163 ARG ARG A . n A 1 164 ALA 164 164 164 ALA ALA A . n A 1 165 LEU 165 165 165 LEU LEU A . n A 1 166 GLY 166 166 166 GLY GLY A . n A 1 167 GLN 167 167 167 GLN GLN A . n A 1 168 ILE 168 168 168 ILE ILE A . n A 1 169 SER 169 169 169 SER SER A . n A 1 170 GLU 170 170 170 GLU GLU A . n A 1 171 ARG 171 171 171 ARG ARG A . n A 1 172 LEU 172 172 172 LEU LEU A . n A 1 173 SER 173 173 173 SER SER A . n A 1 174 VAL 174 174 174 VAL VAL A . n A 1 175 PRO 175 175 175 PRO PRO A . n A 1 176 VAL 176 176 176 VAL VAL A . n A 1 177 SER 177 177 177 SER SER A . n A 1 178 ASP 178 178 178 ASP ASP A . n A 1 179 VAL 179 179 179 VAL VAL A . n A 1 180 LYS 180 180 180 LYS LYS A . n A 1 181 ASN 181 181 181 ASN ASN A . n A 1 182 VAL 182 182 182 VAL VAL A . n A 1 183 ILE 183 183 183 ILE ILE A . n A 1 184 ILE 184 184 184 ILE ILE A . n A 1 185 TRP 185 185 185 TRP TRP A . n A 1 186 GLY 186 186 186 GLY GLY A . n A 1 187 ASN 187 187 187 ASN ASN A . n A 1 188 HIS 188 188 188 HIS HIS A . n A 1 189 SER 189 189 189 SER SER A . n A 1 190 SER 190 190 190 SER SER A . n A 1 191 SER 191 191 191 SER SER A . n A 1 192 GLN 192 192 192 GLN GLN A . n A 1 193 TYR 193 193 193 TYR TYR A . n A 1 194 PRO 194 194 194 PRO PRO A . n A 1 195 ASP 195 195 195 ASP ASP A . n A 1 196 VAL 196 196 196 VAL VAL A . n A 1 197 ASN 197 197 197 ASN ASN A . n A 1 198 HIS 198 198 198 HIS HIS A . n A 1 199 ALA 199 199 199 ALA ALA A . n A 1 200 LYS 200 200 200 LYS LYS A . n A 1 201 VAL 201 201 201 VAL VAL A . n A 1 202 GLN 202 202 202 GLN GLN A . n A 1 203 THR 203 203 203 THR THR A . n A 1 204 SER 204 204 204 SER SER A . n A 1 205 SER 205 205 205 SER SER A . n A 1 206 GLY 206 206 206 GLY GLY A . n A 1 207 GLU 207 207 207 GLU GLU A . n A 1 208 LYS 208 208 208 LYS LYS A . n A 1 209 PRO 209 209 209 PRO PRO A . n A 1 210 VAL 210 210 210 VAL VAL A . n A 1 211 ARG 211 211 211 ARG ARG A . n A 1 212 GLU 212 212 212 GLU GLU A . n A 1 213 LEU 213 213 213 LEU LEU A . n A 1 214 VAL 214 214 214 VAL VAL A . n A 1 215 LYS 215 215 215 LYS LYS A . n A 1 216 ASP 216 216 216 ASP ASP A . n A 1 217 ASP 217 217 217 ASP ASP A . n A 1 218 ALA 218 218 218 ALA ALA A . n A 1 219 TRP 219 219 219 TRP TRP A . n A 1 220 LEU 220 220 220 LEU LEU A . n A 1 221 ASP 221 221 221 ASP ASP A . n A 1 222 GLY 222 222 222 GLY GLY A . n A 1 223 GLU 223 223 223 GLU GLU A . n A 1 224 PHE 224 224 224 PHE PHE A . n A 1 225 ILE 225 225 225 ILE ILE A . n A 1 226 SER 226 226 226 SER SER A . n A 1 227 THR 227 227 227 THR THR A . n A 1 228 VAL 228 228 228 VAL VAL A . n A 1 229 GLN 229 229 229 GLN GLN A . n A 1 230 GLN 230 230 230 GLN GLN A . n A 1 231 ARG 231 231 231 ARG ARG A . n A 1 232 GLY 232 232 232 GLY GLY A . n A 1 233 ALA 233 233 233 ALA ALA A . n A 1 234 ALA 234 234 234 ALA ALA A . n A 1 235 ILE 235 235 235 ILE ILE A . n A 1 236 ILE 236 236 236 ILE ILE A . n A 1 237 LYS 237 237 237 LYS LYS A . n A 1 238 ALA 238 238 238 ALA ALA A . n A 1 239 ARG 239 239 239 ARG ARG A . n A 1 240 LYS 240 240 240 LYS LYS A . n A 1 241 LEU 241 241 241 LEU LEU A . n A 1 242 SER 242 242 242 SER SER A . n A 1 243 SER 243 243 243 SER SER A . n A 1 244 ALA 244 244 244 ALA ALA A . n A 1 245 LEU 245 245 245 LEU LEU A . n A 1 246 SER 246 246 246 SER SER A . n A 1 247 ALA 247 247 247 ALA ALA A . n A 1 248 ALA 248 248 248 ALA ALA A . n A 1 249 SER 249 249 249 SER SER A . n A 1 250 SER 250 250 250 SER SER A . n A 1 251 ALA 251 251 251 ALA ALA A . n A 1 252 CYS 252 252 252 CYS CYS A . n A 1 253 ASP 253 253 253 ASP ASP A . n A 1 254 HIS 254 254 254 HIS HIS A . n A 1 255 ILE 255 255 255 ILE ILE A . n A 1 256 ARG 256 256 256 ARG ARG A . n A 1 257 ASP 257 257 257 ASP ASP A . n A 1 258 TRP 258 258 258 TRP TRP A . n A 1 259 VAL 259 259 259 VAL VAL A . n A 1 260 LEU 260 260 260 LEU LEU A . n A 1 261 GLY 261 261 261 GLY GLY A . n A 1 262 THR 262 262 262 THR THR A . n A 1 263 PRO 263 263 263 PRO PRO A . n A 1 264 GLU 264 264 264 GLU GLU A . n A 1 265 GLY 265 265 265 GLY GLY A . n A 1 266 THR 266 266 266 THR THR A . n A 1 267 PHE 267 267 267 PHE PHE A . n A 1 268 VAL 268 268 268 VAL VAL A . n A 1 269 SER 269 269 269 SER SER A . n A 1 270 MET 270 270 270 MET MET A . n A 1 271 GLY 271 271 271 GLY GLY A . n A 1 272 VAL 272 272 272 VAL VAL A . n A 1 273 TYR 273 273 273 TYR TYR A . n A 1 274 SER 274 274 274 SER SER A . n A 1 275 ASP 275 275 275 ASP ASP A . n A 1 276 GLY 276 276 276 GLY GLY A . n A 1 277 SER 277 277 277 SER SER A . n A 1 278 TYR 278 278 278 TYR TYR A . n A 1 279 SER 279 279 279 SER SER A . n A 1 280 VAL 280 280 280 VAL VAL A . n A 1 281 PRO 281 281 281 PRO PRO A . n A 1 282 SER 282 282 282 SER SER A . n A 1 283 GLY 283 283 283 GLY GLY A . n A 1 284 LEU 284 284 284 LEU LEU A . n A 1 285 ILE 285 285 285 ILE ILE A . n A 1 286 TYR 286 286 286 TYR TYR A . n A 1 287 SER 287 287 287 SER SER A . n A 1 288 PHE 288 288 288 PHE PHE A . n A 1 289 PRO 289 289 289 PRO PRO A . n A 1 290 VAL 290 290 290 VAL VAL A . n A 1 291 THR 291 291 291 THR THR A . n A 1 292 CYS 292 292 292 CYS CYS A . n A 1 293 ARG 293 293 293 ARG ARG A . n A 1 294 ASN 294 294 294 ASN ASN A . n A 1 295 GLY 295 295 295 GLY GLY A . n A 1 296 ASP 296 296 296 ASP ASP A . n A 1 297 TRP 297 297 297 TRP TRP A . n A 1 298 SER 298 298 298 SER SER A . n A 1 299 ILE 299 299 299 ILE ILE A . n A 1 300 VAL 300 300 300 VAL VAL A . n A 1 301 GLN 301 301 301 GLN GLN A . n A 1 302 GLY 302 302 302 GLY GLY A . n A 1 303 LEU 303 303 303 LEU LEU A . n A 1 304 PRO 304 304 304 PRO PRO A . n A 1 305 ILE 305 305 305 ILE ILE A . n A 1 306 ASP 306 306 306 ASP ASP A . n A 1 307 GLU 307 307 307 GLU GLU A . n A 1 308 VAL 308 308 308 VAL VAL A . n A 1 309 SER 309 309 309 SER SER A . n A 1 310 ARG 310 310 310 ARG ARG A . n A 1 311 LYS 311 311 311 LYS LYS A . n A 1 312 LYS 312 312 312 LYS LYS A . n A 1 313 MET 313 313 313 MET MET A . n A 1 314 ASP 314 314 314 ASP ASP A . n A 1 315 LEU 315 315 315 LEU LEU A . n A 1 316 THR 316 316 316 THR THR A . n A 1 317 ALA 317 317 317 ALA ALA A . n A 1 318 GLU 318 318 318 GLU GLU A . n A 1 319 GLU 319 319 319 GLU GLU A . n A 1 320 LEU 320 320 320 LEU LEU A . n A 1 321 LYS 321 321 321 LYS LYS A . n A 1 322 GLU 322 322 322 GLU GLU A . n A 1 323 GLU 323 323 323 GLU GLU A . n A 1 324 LYS 324 324 324 LYS LYS A . n A 1 325 ASP 325 325 325 ASP ASP A . n A 1 326 LEU 326 326 326 LEU LEU A . n A 1 327 ALA 327 327 327 ALA ALA A . n A 1 328 TYR 328 328 328 TYR TYR A . n A 1 329 SER 329 329 329 SER SER A . n A 1 330 CYS 330 330 330 CYS CYS A . n A 1 331 LEU 331 331 331 LEU LEU A . n A 1 332 SER 332 332 332 SER SER A . n B 2 1 MET 1 1 1 MET MET B . n B 2 2 ALA 2 2 2 ALA ALA B . n B 2 3 LYS 3 3 3 LYS LYS B . n B 2 4 GLU 4 4 4 GLU GLU B . n B 2 5 PRO 5 5 5 PRO PRO B . n B 2 6 VAL 6 6 6 VAL VAL B . n B 2 7 ARG 7 7 7 ARG ARG B . n B 2 8 VAL 8 8 8 VAL VAL B . n B 2 9 LEU 9 9 9 LEU LEU B . n B 2 10 VAL 10 10 10 VAL VAL B . n B 2 11 THR 11 11 11 THR THR B . n B 2 12 GLY 12 12 12 GLY GLY B . n B 2 13 ALA 13 13 13 ALA ALA B . n B 2 14 ALA 14 14 14 ALA ALA B . n B 2 15 GLY 15 15 15 GLY GLY B . n B 2 16 GLN 16 16 16 GLN GLN B . n B 2 17 ILE 17 17 17 ILE ILE B . n B 2 18 GLY 18 18 18 GLY GLY B . n B 2 19 TYR 19 19 19 TYR TYR B . n B 2 20 ALA 20 20 20 ALA ALA B . n B 2 21 LEU 21 21 21 LEU LEU B . n B 2 22 VAL 22 22 22 VAL VAL B . n B 2 23 PRO 23 23 23 PRO PRO B . n B 2 24 MET 24 24 24 MET MET B . n B 2 25 ILE 25 25 25 ILE ILE B . n B 2 26 ALA 26 26 26 ALA ALA B . n B 2 27 ARG 27 27 27 ARG ARG B . n B 2 28 GLY 28 28 28 GLY GLY B . n B 2 29 ILE 29 29 29 ILE ILE B . n B 2 30 MET 30 30 30 MET MET B . n B 2 31 LEU 31 31 31 LEU LEU B . n B 2 32 GLY 32 32 32 GLY GLY B . n B 2 33 ALA 33 33 33 ALA ALA B . n B 2 34 ASP 34 34 34 ASP ASP B . n B 2 35 GLN 35 35 35 GLN GLN B . n B 2 36 PRO 36 36 36 PRO PRO B . n B 2 37 VAL 37 37 37 VAL VAL B . n B 2 38 ILE 38 38 38 ILE ILE B . n B 2 39 LEU 39 39 39 LEU LEU B . n B 2 40 HIS 40 40 40 HIS HIS B . n B 2 41 MET 41 41 41 MET MET B . n B 2 42 LEU 42 42 42 LEU LEU B . n B 2 43 ASP 43 43 43 ASP ASP B . n B 2 44 ILE 44 44 44 ILE ILE B . n B 2 45 PRO 45 45 45 PRO PRO B . n B 2 46 PRO 46 46 46 PRO PRO B . n B 2 47 ALA 47 47 47 ALA ALA B . n B 2 48 ALA 48 48 48 ALA ALA B . n B 2 49 GLU 49 49 49 GLU GLU B . n B 2 50 ALA 50 50 50 ALA ALA B . n B 2 51 LEU 51 51 51 LEU LEU B . n B 2 52 ASN 52 52 52 ASN ASN B . n B 2 53 GLY 53 53 53 GLY GLY B . n B 2 54 VAL 54 54 54 VAL VAL B . n B 2 55 LYS 55 55 55 LYS LYS B . n B 2 56 SME 56 56 56 SME SME B . n B 2 57 GLU 57 57 57 GLU GLU B . n B 2 58 LEU 58 58 58 LEU LEU B . n B 2 59 ILE 59 59 59 ILE ILE B . n B 2 60 ASP 60 60 60 ASP ASP B . n B 2 61 ALA 61 61 61 ALA ALA B . n B 2 62 ALA 62 62 62 ALA ALA B . n B 2 63 PHE 63 63 63 PHE PHE B . n B 2 64 PRO 64 64 64 PRO PRO B . n B 2 65 LEU 65 65 65 LEU LEU B . n B 2 66 LEU 66 66 66 LEU LEU B . n B 2 67 LYS 67 67 67 LYS LYS B . n B 2 68 GLY 68 68 68 GLY GLY B . n B 2 69 VAL 69 69 69 VAL VAL B . n B 2 70 VAL 70 70 70 VAL VAL B . n B 2 71 ALA 71 71 71 ALA ALA B . n B 2 72 THR 72 72 72 THR THR B . n B 2 73 THR 73 73 73 THR THR B . n B 2 74 ASP 74 74 74 ASP ASP B . n B 2 75 ALA 75 75 75 ALA ALA B . n B 2 76 VAL 76 76 76 VAL VAL B . n B 2 77 GLU 77 77 77 GLU GLU B . n B 2 78 GLY 78 78 78 GLY GLY B . n B 2 79 CYS 79 79 79 CYS CYS B . n B 2 80 THR 80 80 80 THR THR B . n B 2 81 GLY 81 81 81 GLY GLY B . n B 2 82 VAL 82 82 82 VAL VAL B . n B 2 83 ASN 83 83 83 ASN ASN B . n B 2 84 VAL 84 84 84 VAL VAL B . n B 2 85 ALA 85 85 85 ALA ALA B . n B 2 86 VAL 86 86 86 VAL VAL B . n B 2 87 MET 87 87 87 MET MET B . n B 2 88 VAL 88 88 88 VAL VAL B . n B 2 89 GLY 89 89 89 GLY GLY B . n B 2 90 GLY 90 90 90 GLY GLY B . n B 2 91 PHE 91 91 91 PHE PHE B . n B 2 92 PRO 92 92 92 PRO PRO B . n B 2 93 ARG 93 93 93 ARG ARG B . n B 2 94 LYS 94 94 94 LYS LYS B . n B 2 95 GLU 95 95 95 GLU GLU B . n B 2 96 GLY 96 96 96 GLY GLY B . n B 2 97 SME 97 97 97 SME SME B . n B 2 98 GLU 98 98 98 GLU GLU B . n B 2 99 ARG 99 99 99 ARG ARG B . n B 2 100 LYS 100 100 100 LYS LYS B . n B 2 101 ASP 101 101 101 ASP ASP B . n B 2 102 VAL 102 102 102 VAL VAL B . n B 2 103 MET 103 103 103 MET MET B . n B 2 104 SER 104 104 104 SER SER B . n B 2 105 LYS 105 105 105 LYS LYS B . n B 2 106 ASN 106 106 106 ASN ASN B . n B 2 107 VAL 107 107 107 VAL VAL B . n B 2 108 SER 108 108 108 SER SER B . n B 2 109 ILE 109 109 109 ILE ILE B . n B 2 110 TYR 110 110 110 TYR TYR B . n B 2 111 LYS 111 111 111 LYS LYS B . n B 2 112 SER 112 112 112 SER SER B . n B 2 113 GLN 113 113 113 GLN GLN B . n B 2 114 ALA 114 114 114 ALA ALA B . n B 2 115 ALA 115 115 115 ALA ALA B . n B 2 116 ALA 116 116 116 ALA ALA B . n B 2 117 LEU 117 117 117 LEU LEU B . n B 2 118 GLU 118 118 118 GLU GLU B . n B 2 119 LYS 119 119 119 LYS LYS B . n B 2 120 HIS 120 120 120 HIS HIS B . n B 2 121 ALA 121 121 121 ALA ALA B . n B 2 122 ALA 122 122 122 ALA ALA B . n B 2 123 PRO 123 123 123 PRO PRO B . n B 2 124 ASN 124 124 124 ASN ASN B . n B 2 125 CYS 125 125 125 CYS CYS B . n B 2 126 LYS 126 126 126 LYS LYS B . n B 2 127 VAL 127 127 127 VAL VAL B . n B 2 128 LEU 128 128 128 LEU LEU B . n B 2 129 VAL 129 129 129 VAL VAL B . n B 2 130 VAL 130 130 130 VAL VAL B . n B 2 131 ALA 131 131 131 ALA ALA B . n B 2 132 ASN 132 132 132 ASN ASN B . n B 2 133 PRO 133 133 133 PRO PRO B . n B 2 134 ALA 134 134 134 ALA ALA B . n B 2 135 ASN 135 135 135 ASN ASN B . n B 2 136 THR 136 136 136 THR THR B . n B 2 137 ASN 137 137 137 ASN ASN B . n B 2 138 ALA 138 138 138 ALA ALA B . n B 2 139 LEU 139 139 139 LEU LEU B . n B 2 140 ILE 140 140 140 ILE ILE B . n B 2 141 LEU 141 141 141 LEU LEU B . n B 2 142 LYS 142 142 142 LYS LYS B . n B 2 143 GLU 143 143 143 GLU GLU B . n B 2 144 PHE 144 144 144 PHE PHE B . n B 2 145 ALA 145 145 145 ALA ALA B . n B 2 146 PRO 146 146 146 PRO PRO B . n B 2 147 SER 147 147 147 SER SER B . n B 2 148 ILE 148 148 148 ILE ILE B . n B 2 149 PRO 149 149 149 PRO PRO B . n B 2 150 GLU 150 150 150 GLU GLU B . n B 2 151 LYS 151 151 151 LYS LYS B . n B 2 152 ASN 152 152 152 ASN ASN B . n B 2 153 ILE 153 153 153 ILE ILE B . n B 2 154 SER 154 154 154 SER SER B . n B 2 155 CYS 155 155 155 CYS CYS B . n B 2 156 LEU 156 156 156 LEU LEU B . n B 2 157 THR 157 157 157 THR THR B . n B 2 158 ARG 158 158 158 ARG ARG B . n B 2 159 LEU 159 159 159 LEU LEU B . n B 2 160 ASP 160 160 160 ASP ASP B . n B 2 161 HIS 161 161 161 HIS HIS B . n B 2 162 ASN 162 162 162 ASN ASN B . n B 2 163 ARG 163 163 163 ARG ARG B . n B 2 164 ALA 164 164 164 ALA ALA B . n B 2 165 LEU 165 165 165 LEU LEU B . n B 2 166 GLY 166 166 166 GLY GLY B . n B 2 167 GLN 167 167 167 GLN GLN B . n B 2 168 ILE 168 168 168 ILE ILE B . n B 2 169 SER 169 169 169 SER SER B . n B 2 170 GLU 170 170 170 GLU GLU B . n B 2 171 ARG 171 171 171 ARG ARG B . n B 2 172 LEU 172 172 172 LEU LEU B . n B 2 173 SER 173 173 173 SER SER B . n B 2 174 VAL 174 174 174 VAL VAL B . n B 2 175 PRO 175 175 175 PRO PRO B . n B 2 176 VAL 176 176 176 VAL VAL B . n B 2 177 SER 177 177 177 SER SER B . n B 2 178 ASP 178 178 178 ASP ASP B . n B 2 179 VAL 179 179 179 VAL VAL B . n B 2 180 LYS 180 180 180 LYS LYS B . n B 2 181 ASN 181 181 181 ASN ASN B . n B 2 182 VAL 182 182 182 VAL VAL B . n B 2 183 ILE 183 183 183 ILE ILE B . n B 2 184 ILE 184 184 184 ILE ILE B . n B 2 185 TRP 185 185 185 TRP TRP B . n B 2 186 GLY 186 186 186 GLY GLY B . n B 2 187 ASN 187 187 187 ASN ASN B . n B 2 188 HIS 188 188 188 HIS HIS B . n B 2 189 SER 189 189 189 SER SER B . n B 2 190 SER 190 190 190 SER SER B . n B 2 191 SER 191 191 191 SER SER B . n B 2 192 GLN 192 192 192 GLN GLN B . n B 2 193 TYR 193 193 193 TYR TYR B . n B 2 194 PRO 194 194 194 PRO PRO B . n B 2 195 ASP 195 195 195 ASP ASP B . n B 2 196 VAL 196 196 196 VAL VAL B . n B 2 197 ASN 197 197 197 ASN ASN B . n B 2 198 HIS 198 198 198 HIS HIS B . n B 2 199 ALA 199 199 199 ALA ALA B . n B 2 200 LYS 200 200 200 LYS LYS B . n B 2 201 VAL 201 201 201 VAL VAL B . n B 2 202 GLN 202 202 202 GLN GLN B . n B 2 203 THR 203 203 203 THR THR B . n B 2 204 SER 204 204 204 SER SER B . n B 2 205 SER 205 205 205 SER SER B . n B 2 206 GLY 206 206 206 GLY GLY B . n B 2 207 GLU 207 207 207 GLU GLU B . n B 2 208 LYS 208 208 208 LYS LYS B . n B 2 209 PRO 209 209 209 PRO PRO B . n B 2 210 VAL 210 210 210 VAL VAL B . n B 2 211 ARG 211 211 211 ARG ARG B . n B 2 212 GLU 212 212 212 GLU GLU B . n B 2 213 LEU 213 213 213 LEU LEU B . n B 2 214 VAL 214 214 214 VAL VAL B . n B 2 215 LYS 215 215 215 LYS LYS B . n B 2 216 ASP 216 216 216 ASP ASP B . n B 2 217 ASP 217 217 217 ASP ASP B . n B 2 218 ALA 218 218 218 ALA ALA B . n B 2 219 TRP 219 219 219 TRP TRP B . n B 2 220 LEU 220 220 220 LEU LEU B . n B 2 221 ASP 221 221 221 ASP ASP B . n B 2 222 GLY 222 222 222 GLY GLY B . n B 2 223 GLU 223 223 223 GLU GLU B . n B 2 224 PHE 224 224 224 PHE PHE B . n B 2 225 ILE 225 225 225 ILE ILE B . n B 2 226 SER 226 226 226 SER SER B . n B 2 227 THR 227 227 227 THR THR B . n B 2 228 VAL 228 228 228 VAL VAL B . n B 2 229 GLN 229 229 229 GLN GLN B . n B 2 230 GLN 230 230 230 GLN GLN B . n B 2 231 ARG 231 231 231 ARG ARG B . n B 2 232 GLY 232 232 232 GLY GLY B . n B 2 233 ALA 233 233 233 ALA ALA B . n B 2 234 ALA 234 234 234 ALA ALA B . n B 2 235 ILE 235 235 235 ILE ILE B . n B 2 236 ILE 236 236 236 ILE ILE B . n B 2 237 LYS 237 237 237 LYS LYS B . n B 2 238 ALA 238 238 238 ALA ALA B . n B 2 239 ARG 239 239 239 ARG ARG B . n B 2 240 LYS 240 240 240 LYS LYS B . n B 2 241 LEU 241 241 241 LEU LEU B . n B 2 242 SER 242 242 242 SER SER B . n B 2 243 SER 243 243 243 SER SER B . n B 2 244 ALA 244 244 244 ALA ALA B . n B 2 245 LEU 245 245 245 LEU LEU B . n B 2 246 SER 246 246 246 SER SER B . n B 2 247 ALA 247 247 247 ALA ALA B . n B 2 248 ALA 248 248 248 ALA ALA B . n B 2 249 SER 249 249 249 SER SER B . n B 2 250 SER 250 250 250 SER SER B . n B 2 251 ALA 251 251 251 ALA ALA B . n B 2 252 CYS 252 252 252 CYS CYS B . n B 2 253 ASP 253 253 253 ASP ASP B . n B 2 254 HIS 254 254 254 HIS HIS B . n B 2 255 ILE 255 255 255 ILE ILE B . n B 2 256 ARG 256 256 256 ARG ARG B . n B 2 257 ASP 257 257 257 ASP ASP B . n B 2 258 TRP 258 258 258 TRP TRP B . n B 2 259 VAL 259 259 259 VAL VAL B . n B 2 260 LEU 260 260 260 LEU LEU B . n B 2 261 GLY 261 261 261 GLY GLY B . n B 2 262 THR 262 262 262 THR THR B . n B 2 263 PRO 263 263 263 PRO PRO B . n B 2 264 GLU 264 264 264 GLU GLU B . n B 2 265 GLY 265 265 265 GLY GLY B . n B 2 266 THR 266 266 266 THR THR B . n B 2 267 PHE 267 267 267 PHE PHE B . n B 2 268 VAL 268 268 268 VAL VAL B . n B 2 269 SER 269 269 269 SER SER B . n B 2 270 MET 270 270 270 MET MET B . n B 2 271 GLY 271 271 271 GLY GLY B . n B 2 272 VAL 272 272 272 VAL VAL B . n B 2 273 TYR 273 273 273 TYR TYR B . n B 2 274 SER 274 274 274 SER SER B . n B 2 275 ASP 275 275 275 ASP ASP B . n B 2 276 GLY 276 276 276 GLY GLY B . n B 2 277 SER 277 277 277 SER SER B . n B 2 278 TYR 278 278 278 TYR TYR B . n B 2 279 SER 279 279 279 SER SER B . n B 2 280 VAL 280 280 280 VAL VAL B . n B 2 281 PRO 281 281 281 PRO PRO B . n B 2 282 SER 282 282 282 SER SER B . n B 2 283 GLY 283 283 283 GLY GLY B . n B 2 284 LEU 284 284 284 LEU LEU B . n B 2 285 ILE 285 285 285 ILE ILE B . n B 2 286 TYR 286 286 286 TYR TYR B . n B 2 287 SER 287 287 287 SER SER B . n B 2 288 PHE 288 288 288 PHE PHE B . n B 2 289 PRO 289 289 289 PRO PRO B . n B 2 290 VAL 290 290 290 VAL VAL B . n B 2 291 THR 291 291 291 THR THR B . n B 2 292 CYS 292 292 292 CYS CYS B . n B 2 293 ARG 293 293 293 ARG ARG B . n B 2 294 ASN 294 294 294 ASN ASN B . n B 2 295 GLY 295 295 295 GLY GLY B . n B 2 296 ASP 296 296 296 ASP ASP B . n B 2 297 TRP 297 297 297 TRP TRP B . n B 2 298 SER 298 298 298 SER SER B . n B 2 299 ILE 299 299 299 ILE ILE B . n B 2 300 VAL 300 300 300 VAL VAL B . n B 2 301 GLN 301 301 301 GLN GLN B . n B 2 302 GLY 302 302 302 GLY GLY B . n B 2 303 LEU 303 303 303 LEU LEU B . n B 2 304 PRO 304 304 304 PRO PRO B . n B 2 305 ILE 305 305 305 ILE ILE B . n B 2 306 ASP 306 306 306 ASP ASP B . n B 2 307 GLU 307 307 307 GLU GLU B . n B 2 308 VAL 308 308 308 VAL VAL B . n B 2 309 SER 309 309 309 SER SER B . n B 2 310 ARG 310 310 310 ARG ARG B . n B 2 311 LYS 311 311 311 LYS LYS B . n B 2 312 LYS 312 312 312 LYS LYS B . n B 2 313 MET 313 313 313 MET MET B . n B 2 314 ASP 314 314 314 ASP ASP B . n B 2 315 LEU 315 315 315 LEU LEU B . n B 2 316 THR 316 316 316 THR THR B . n B 2 317 ALA 317 317 317 ALA ALA B . n B 2 318 GLU 318 318 318 GLU GLU B . n B 2 319 GLU 319 319 319 GLU GLU B . n B 2 320 LEU 320 320 320 LEU LEU B . n B 2 321 LYS 321 321 321 LYS LYS B . n B 2 322 GLU 322 322 322 GLU GLU B . n B 2 323 GLU 323 323 323 GLU GLU B . n B 2 324 LYS 324 324 324 LYS LYS B . n B 2 325 ASP 325 325 325 ASP ASP B . n B 2 326 LEU 326 326 326 LEU LEU B . n B 2 327 ALA 327 327 327 ALA ALA B . n B 2 328 TYR 328 328 328 TYR TYR B . n B 2 329 SER 329 329 329 SER SER B . n B 2 330 CSD 330 330 330 CSD CSD B . n B 2 331 LEU 331 331 331 LEU LEU B . n B 2 332 SER 332 332 332 SER SER B . n C 3 1 MET 1 1 1 MET MET C . n C 3 2 ALA 2 2 2 ALA ALA C . n C 3 3 LYS 3 3 3 LYS LYS C . n C 3 4 GLU 4 4 4 GLU GLU C . n C 3 5 PRO 5 5 5 PRO PRO C . n C 3 6 VAL 6 6 6 VAL VAL C . n C 3 7 ARG 7 7 7 ARG ARG C . n C 3 8 VAL 8 8 8 VAL VAL C . n C 3 9 LEU 9 9 9 LEU LEU C . n C 3 10 VAL 10 10 10 VAL VAL C . n C 3 11 THR 11 11 11 THR THR C . n C 3 12 GLY 12 12 12 GLY GLY C . n C 3 13 ALA 13 13 13 ALA ALA C . n C 3 14 ALA 14 14 14 ALA ALA C . n C 3 15 GLY 15 15 15 GLY GLY C . n C 3 16 GLN 16 16 16 GLN GLN C . n C 3 17 ILE 17 17 17 ILE ILE C . n C 3 18 GLY 18 18 18 GLY GLY C . n C 3 19 TYR 19 19 19 TYR TYR C . n C 3 20 ALA 20 20 20 ALA ALA C . n C 3 21 LEU 21 21 21 LEU LEU C . n C 3 22 VAL 22 22 22 VAL VAL C . n C 3 23 PRO 23 23 23 PRO PRO C . n C 3 24 MET 24 24 24 MET MET C . n C 3 25 ILE 25 25 25 ILE ILE C . n C 3 26 ALA 26 26 26 ALA ALA C . n C 3 27 ARG 27 27 27 ARG ARG C . n C 3 28 GLY 28 28 28 GLY GLY C . n C 3 29 ILE 29 29 29 ILE ILE C . n C 3 30 MET 30 30 30 MET MET C . n C 3 31 LEU 31 31 31 LEU LEU C . n C 3 32 GLY 32 32 32 GLY GLY C . n C 3 33 ALA 33 33 33 ALA ALA C . n C 3 34 ASP 34 34 34 ASP ASP C . n C 3 35 GLN 35 35 35 GLN GLN C . n C 3 36 PRO 36 36 36 PRO PRO C . n C 3 37 VAL 37 37 37 VAL VAL C . n C 3 38 ILE 38 38 38 ILE ILE C . n C 3 39 LEU 39 39 39 LEU LEU C . n C 3 40 HIS 40 40 40 HIS HIS C . n C 3 41 MET 41 41 41 MET MET C . n C 3 42 LEU 42 42 42 LEU LEU C . n C 3 43 ASP 43 43 43 ASP ASP C . n C 3 44 ILE 44 44 44 ILE ILE C . n C 3 45 PRO 45 45 45 PRO PRO C . n C 3 46 PRO 46 46 46 PRO PRO C . n C 3 47 ALA 47 47 47 ALA ALA C . n C 3 48 ALA 48 48 48 ALA ALA C . n C 3 49 GLU 49 49 49 GLU GLU C . n C 3 50 ALA 50 50 50 ALA ALA C . n C 3 51 LEU 51 51 51 LEU LEU C . n C 3 52 ASN 52 52 52 ASN ASN C . n C 3 53 GLY 53 53 53 GLY GLY C . n C 3 54 VAL 54 54 54 VAL VAL C . n C 3 55 LYS 55 55 55 LYS LYS C . n C 3 56 SME 56 56 56 SME SME C . n C 3 57 GLU 57 57 57 GLU GLU C . n C 3 58 LEU 58 58 58 LEU LEU C . n C 3 59 ILE 59 59 59 ILE ILE C . n C 3 60 ASP 60 60 60 ASP ASP C . n C 3 61 ALA 61 61 61 ALA ALA C . n C 3 62 ALA 62 62 62 ALA ALA C . n C 3 63 PHE 63 63 63 PHE PHE C . n C 3 64 PRO 64 64 64 PRO PRO C . n C 3 65 LEU 65 65 65 LEU LEU C . n C 3 66 LEU 66 66 66 LEU LEU C . n C 3 67 LYS 67 67 67 LYS LYS C . n C 3 68 GLY 68 68 68 GLY GLY C . n C 3 69 VAL 69 69 69 VAL VAL C . n C 3 70 VAL 70 70 70 VAL VAL C . n C 3 71 ALA 71 71 71 ALA ALA C . n C 3 72 THR 72 72 72 THR THR C . n C 3 73 THR 73 73 73 THR THR C . n C 3 74 ASP 74 74 74 ASP ASP C . n C 3 75 ALA 75 75 75 ALA ALA C . n C 3 76 VAL 76 76 76 VAL VAL C . n C 3 77 GLU 77 77 77 GLU GLU C . n C 3 78 GLY 78 78 78 GLY GLY C . n C 3 79 CYS 79 79 79 CYS CYS C . n C 3 80 THR 80 80 80 THR THR C . n C 3 81 GLY 81 81 81 GLY GLY C . n C 3 82 VAL 82 82 82 VAL VAL C . n C 3 83 ASN 83 83 83 ASN ASN C . n C 3 84 VAL 84 84 84 VAL VAL C . n C 3 85 ALA 85 85 85 ALA ALA C . n C 3 86 VAL 86 86 86 VAL VAL C . n C 3 87 MET 87 87 87 MET MET C . n C 3 88 VAL 88 88 88 VAL VAL C . n C 3 89 GLY 89 89 89 GLY GLY C . n C 3 90 GLY 90 90 90 GLY GLY C . n C 3 91 PHE 91 91 91 PHE PHE C . n C 3 92 PRO 92 92 92 PRO PRO C . n C 3 93 ARG 93 93 93 ARG ARG C . n C 3 94 LYS 94 94 94 LYS LYS C . n C 3 95 GLU 95 95 95 GLU GLU C . n C 3 96 GLY 96 96 96 GLY GLY C . n C 3 97 MET 97 97 97 MET MET C . n C 3 98 GLU 98 98 98 GLU GLU C . n C 3 99 ARG 99 99 99 ARG ARG C . n C 3 100 LYS 100 100 100 LYS LYS C . n C 3 101 ASP 101 101 101 ASP ASP C . n C 3 102 VAL 102 102 102 VAL VAL C . n C 3 103 MET 103 103 103 MET MET C . n C 3 104 SER 104 104 104 SER SER C . n C 3 105 LYS 105 105 105 LYS LYS C . n C 3 106 ASN 106 106 106 ASN ASN C . n C 3 107 VAL 107 107 107 VAL VAL C . n C 3 108 SER 108 108 108 SER SER C . n C 3 109 ILE 109 109 109 ILE ILE C . n C 3 110 TYR 110 110 110 TYR TYR C . n C 3 111 LYS 111 111 111 LYS LYS C . n C 3 112 SER 112 112 112 SER SER C . n C 3 113 GLN 113 113 113 GLN GLN C . n C 3 114 ALA 114 114 114 ALA ALA C . n C 3 115 ALA 115 115 115 ALA ALA C . n C 3 116 ALA 116 116 116 ALA ALA C . n C 3 117 LEU 117 117 117 LEU LEU C . n C 3 118 GLU 118 118 118 GLU GLU C . n C 3 119 LYS 119 119 119 LYS LYS C . n C 3 120 HIS 120 120 120 HIS HIS C . n C 3 121 ALA 121 121 121 ALA ALA C . n C 3 122 ALA 122 122 122 ALA ALA C . n C 3 123 PRO 123 123 123 PRO PRO C . n C 3 124 ASN 124 124 124 ASN ASN C . n C 3 125 CYS 125 125 125 CYS CYS C . n C 3 126 LYS 126 126 126 LYS LYS C . n C 3 127 VAL 127 127 127 VAL VAL C . n C 3 128 LEU 128 128 128 LEU LEU C . n C 3 129 VAL 129 129 129 VAL VAL C . n C 3 130 VAL 130 130 130 VAL VAL C . n C 3 131 ALA 131 131 131 ALA ALA C . n C 3 132 ASN 132 132 132 ASN ASN C . n C 3 133 PRO 133 133 133 PRO PRO C . n C 3 134 ALA 134 134 134 ALA ALA C . n C 3 135 ASN 135 135 135 ASN ASN C . n C 3 136 THR 136 136 136 THR THR C . n C 3 137 ASN 137 137 137 ASN ASN C . n C 3 138 ALA 138 138 138 ALA ALA C . n C 3 139 LEU 139 139 139 LEU LEU C . n C 3 140 ILE 140 140 140 ILE ILE C . n C 3 141 LEU 141 141 141 LEU LEU C . n C 3 142 LYS 142 142 142 LYS LYS C . n C 3 143 GLU 143 143 143 GLU GLU C . n C 3 144 PHE 144 144 144 PHE PHE C . n C 3 145 ALA 145 145 145 ALA ALA C . n C 3 146 PRO 146 146 146 PRO PRO C . n C 3 147 SER 147 147 147 SER SER C . n C 3 148 ILE 148 148 148 ILE ILE C . n C 3 149 PRO 149 149 149 PRO PRO C . n C 3 150 GLU 150 150 150 GLU GLU C . n C 3 151 LYS 151 151 151 LYS LYS C . n C 3 152 ASN 152 152 152 ASN ASN C . n C 3 153 ILE 153 153 153 ILE ILE C . n C 3 154 SER 154 154 154 SER SER C . n C 3 155 CYS 155 155 155 CYS CYS C . n C 3 156 LEU 156 156 156 LEU LEU C . n C 3 157 THR 157 157 157 THR THR C . n C 3 158 ARG 158 158 158 ARG ARG C . n C 3 159 LEU 159 159 159 LEU LEU C . n C 3 160 ASP 160 160 160 ASP ASP C . n C 3 161 HIS 161 161 161 HIS HIS C . n C 3 162 ASN 162 162 162 ASN ASN C . n C 3 163 ARG 163 163 163 ARG ARG C . n C 3 164 ALA 164 164 164 ALA ALA C . n C 3 165 LEU 165 165 165 LEU LEU C . n C 3 166 GLY 166 166 166 GLY GLY C . n C 3 167 GLN 167 167 167 GLN GLN C . n C 3 168 ILE 168 168 168 ILE ILE C . n C 3 169 SER 169 169 169 SER SER C . n C 3 170 GLU 170 170 170 GLU GLU C . n C 3 171 ARG 171 171 171 ARG ARG C . n C 3 172 LEU 172 172 172 LEU LEU C . n C 3 173 SER 173 173 173 SER SER C . n C 3 174 VAL 174 174 174 VAL VAL C . n C 3 175 PRO 175 175 175 PRO PRO C . n C 3 176 VAL 176 176 176 VAL VAL C . n C 3 177 SER 177 177 177 SER SER C . n C 3 178 ASP 178 178 178 ASP ASP C . n C 3 179 VAL 179 179 179 VAL VAL C . n C 3 180 LYS 180 180 180 LYS LYS C . n C 3 181 ASN 181 181 181 ASN ASN C . n C 3 182 VAL 182 182 182 VAL VAL C . n C 3 183 ILE 183 183 183 ILE ILE C . n C 3 184 ILE 184 184 184 ILE ILE C . n C 3 185 TRP 185 185 185 TRP TRP C . n C 3 186 GLY 186 186 186 GLY GLY C . n C 3 187 ASN 187 187 187 ASN ASN C . n C 3 188 HIS 188 188 188 HIS HIS C . n C 3 189 SER 189 189 189 SER SER C . n C 3 190 SER 190 190 190 SER SER C . n C 3 191 SER 191 191 191 SER SER C . n C 3 192 GLN 192 192 192 GLN GLN C . n C 3 193 TYR 193 193 193 TYR TYR C . n C 3 194 PRO 194 194 194 PRO PRO C . n C 3 195 ASP 195 195 195 ASP ASP C . n C 3 196 VAL 196 196 196 VAL VAL C . n C 3 197 ASN 197 197 197 ASN ASN C . n C 3 198 HIS 198 198 198 HIS HIS C . n C 3 199 ALA 199 199 199 ALA ALA C . n C 3 200 LYS 200 200 200 LYS LYS C . n C 3 201 VAL 201 201 201 VAL VAL C . n C 3 202 GLN 202 202 202 GLN GLN C . n C 3 203 THR 203 203 203 THR THR C . n C 3 204 SER 204 204 204 SER SER C . n C 3 205 SER 205 205 205 SER SER C . n C 3 206 GLY 206 206 206 GLY GLY C . n C 3 207 GLU 207 207 207 GLU GLU C . n C 3 208 LYS 208 208 208 LYS LYS C . n C 3 209 PRO 209 209 209 PRO PRO C . n C 3 210 VAL 210 210 210 VAL VAL C . n C 3 211 ARG 211 211 211 ARG ARG C . n C 3 212 GLU 212 212 212 GLU GLU C . n C 3 213 LEU 213 213 213 LEU LEU C . n C 3 214 VAL 214 214 214 VAL VAL C . n C 3 215 LYS 215 215 215 LYS LYS C . n C 3 216 ASP 216 216 216 ASP ASP C . n C 3 217 ASP 217 217 217 ASP ASP C . n C 3 218 ALA 218 218 218 ALA ALA C . n C 3 219 TRP 219 219 219 TRP TRP C . n C 3 220 LEU 220 220 220 LEU LEU C . n C 3 221 ASP 221 221 221 ASP ASP C . n C 3 222 GLY 222 222 222 GLY GLY C . n C 3 223 GLU 223 223 223 GLU GLU C . n C 3 224 PHE 224 224 224 PHE PHE C . n C 3 225 ILE 225 225 225 ILE ILE C . n C 3 226 SER 226 226 226 SER SER C . n C 3 227 THR 227 227 227 THR THR C . n C 3 228 VAL 228 228 228 VAL VAL C . n C 3 229 GLN 229 229 229 GLN GLN C . n C 3 230 GLN 230 230 230 GLN GLN C . n C 3 231 ARG 231 231 231 ARG ARG C . n C 3 232 GLY 232 232 232 GLY GLY C . n C 3 233 ALA 233 233 233 ALA ALA C . n C 3 234 ALA 234 234 234 ALA ALA C . n C 3 235 ILE 235 235 235 ILE ILE C . n C 3 236 ILE 236 236 236 ILE ILE C . n C 3 237 LYS 237 237 237 LYS LYS C . n C 3 238 ALA 238 238 238 ALA ALA C . n C 3 239 ARG 239 239 239 ARG ARG C . n C 3 240 LYS 240 240 240 LYS LYS C . n C 3 241 LEU 241 241 241 LEU LEU C . n C 3 242 SER 242 242 242 SER SER C . n C 3 243 SER 243 243 243 SER SER C . n C 3 244 ALA 244 244 244 ALA ALA C . n C 3 245 LEU 245 245 245 LEU LEU C . n C 3 246 SER 246 246 246 SER SER C . n C 3 247 ALA 247 247 247 ALA ALA C . n C 3 248 ALA 248 248 248 ALA ALA C . n C 3 249 SER 249 249 249 SER SER C . n C 3 250 SER 250 250 250 SER SER C . n C 3 251 ALA 251 251 251 ALA ALA C . n C 3 252 CYS 252 252 252 CYS CYS C . n C 3 253 ASP 253 253 253 ASP ASP C . n C 3 254 HIS 254 254 254 HIS HIS C . n C 3 255 ILE 255 255 255 ILE ILE C . n C 3 256 ARG 256 256 256 ARG ARG C . n C 3 257 ASP 257 257 257 ASP ASP C . n C 3 258 TRP 258 258 258 TRP TRP C . n C 3 259 VAL 259 259 259 VAL VAL C . n C 3 260 LEU 260 260 260 LEU LEU C . n C 3 261 GLY 261 261 261 GLY GLY C . n C 3 262 THR 262 262 262 THR THR C . n C 3 263 PRO 263 263 263 PRO PRO C . n C 3 264 GLU 264 264 264 GLU GLU C . n C 3 265 GLY 265 265 265 GLY GLY C . n C 3 266 THR 266 266 266 THR THR C . n C 3 267 PHE 267 267 267 PHE PHE C . n C 3 268 VAL 268 268 268 VAL VAL C . n C 3 269 SER 269 269 269 SER SER C . n C 3 270 MET 270 270 270 MET MET C . n C 3 271 GLY 271 271 271 GLY GLY C . n C 3 272 VAL 272 272 272 VAL VAL C . n C 3 273 TYR 273 273 273 TYR TYR C . n C 3 274 SER 274 274 274 SER SER C . n C 3 275 ASP 275 275 275 ASP ASP C . n C 3 276 GLY 276 276 276 GLY GLY C . n C 3 277 SER 277 277 277 SER SER C . n C 3 278 TYR 278 278 278 TYR TYR C . n C 3 279 SER 279 279 279 SER SER C . n C 3 280 VAL 280 280 280 VAL VAL C . n C 3 281 PRO 281 281 281 PRO PRO C . n C 3 282 SER 282 282 282 SER SER C . n C 3 283 GLY 283 283 283 GLY GLY C . n C 3 284 LEU 284 284 284 LEU LEU C . n C 3 285 ILE 285 285 285 ILE ILE C . n C 3 286 TYR 286 286 286 TYR TYR C . n C 3 287 SER 287 287 287 SER SER C . n C 3 288 PHE 288 288 288 PHE PHE C . n C 3 289 PRO 289 289 289 PRO PRO C . n C 3 290 VAL 290 290 290 VAL VAL C . n C 3 291 THR 291 291 291 THR THR C . n C 3 292 CYS 292 292 292 CYS CYS C . n C 3 293 ARG 293 293 293 ARG ARG C . n C 3 294 ASN 294 294 294 ASN ASN C . n C 3 295 GLY 295 295 295 GLY GLY C . n C 3 296 ASP 296 296 296 ASP ASP C . n C 3 297 TRP 297 297 297 TRP TRP C . n C 3 298 SER 298 298 298 SER SER C . n C 3 299 ILE 299 299 299 ILE ILE C . n C 3 300 VAL 300 300 300 VAL VAL C . n C 3 301 GLN 301 301 301 GLN GLN C . n C 3 302 GLY 302 302 302 GLY GLY C . n C 3 303 LEU 303 303 303 LEU LEU C . n C 3 304 PRO 304 304 304 PRO PRO C . n C 3 305 ILE 305 305 305 ILE ILE C . n C 3 306 ASP 306 306 306 ASP ASP C . n C 3 307 GLU 307 307 307 GLU GLU C . n C 3 308 VAL 308 308 308 VAL VAL C . n C 3 309 SER 309 309 309 SER SER C . n C 3 310 ARG 310 310 310 ARG ARG C . n C 3 311 LYS 311 311 311 LYS LYS C . n C 3 312 LYS 312 312 312 LYS LYS C . n C 3 313 MET 313 313 313 MET MET C . n C 3 314 ASP 314 314 314 ASP ASP C . n C 3 315 LEU 315 315 315 LEU LEU C . n C 3 316 THR 316 316 316 THR THR C . n C 3 317 ALA 317 317 317 ALA ALA C . n C 3 318 GLU 318 318 318 GLU GLU C . n C 3 319 GLU 319 319 319 GLU GLU C . n C 3 320 LEU 320 320 320 LEU LEU C . n C 3 321 LYS 321 321 321 LYS LYS C . n C 3 322 GLU 322 322 322 GLU GLU C . n C 3 323 GLU 323 323 323 GLU GLU C . n C 3 324 LYS 324 324 324 LYS LYS C . n C 3 325 ASP 325 325 325 ASP ASP C . n C 3 326 LEU 326 326 326 LEU LEU C . n C 3 327 ALA 327 327 327 ALA ALA C . n C 3 328 TYR 328 328 328 TYR TYR C . n C 3 329 SER 329 329 329 SER SER C . n C 3 330 CSO 330 330 330 CSO CSO C . n C 3 331 LEU 331 331 331 LEU LEU C . n C 3 332 SER 332 332 332 SER SER C . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code D 4 NAD 1 401 2 NAD NAD A . E 5 SO4 1 402 5 SO4 SO4 A . F 5 SO4 1 403 9 SO4 SO4 A . G 6 GOL 1 404 14 GOL GOL A . H 6 GOL 1 405 17 GOL GOL A . I 7 PEO 1 406 18 PEO PEO A . J 7 PEO 1 407 22 PEO PEO A . K 7 PEO 1 408 24 PEO PEO A . L 8 FMT 1 409 35 FMT FMT A . M 9 TRS 1 410 41 TRS TRS A . N 10 ETX 1 411 42 ETX ETX A . O 4 NAD 1 401 1 NAD NAD B . P 5 SO4 1 402 4 SO4 SO4 B . Q 5 SO4 1 403 6 SO4 SO4 B . R 5 SO4 1 404 8 SO4 SO4 B . S 6 GOL 1 405 12 GOL GOL B . T 6 GOL 1 406 13 GOL GOL B . U 6 GOL 1 407 16 GOL GOL B . V 7 PEO 1 408 20 PEO PEO B . W 7 PEO 1 409 21 PEO PEO B . X 7 PEO 1 410 27 PEO PEO B . Y 7 PEO 1 411 29 PEO PEO B . Z 11 ACT 1 412 31 ACT ACT B . AA 11 ACT 1 413 32 ACT ACT B . BA 11 ACT 1 414 33 ACT ACT B . CA 8 FMT 1 415 36 FMT FMT B . DA 8 FMT 1 416 37 FMT FMT B . EA 12 EDO 1 417 40 EDO EDO B . FA 12 EDO 1 418 1 EDO EDO B . GA 4 NAD 1 401 3 NAD NAD C . HA 5 SO4 1 402 7 SO4 SO4 C . IA 5 SO4 1 403 10 SO4 SO4 C . JA 5 SO4 1 404 11 SO4 SO4 C . KA 6 GOL 1 405 15 GOL GOL C . LA 7 PEO 1 406 19 PEO PEO C . MA 7 PEO 1 407 25 PEO PEO C . NA 7 PEO 1 408 26 PEO PEO C . OA 7 PEO 1 409 28 PEO PEO C . PA 8 FMT 1 410 34 FMT FMT C . QA 8 FMT 1 411 38 FMT FMT C . RA 12 EDO 1 412 39 EDO EDO C . SA 13 HOH 1 501 605 HOH HOH A . SA 13 HOH 2 502 813 HOH HOH A . SA 13 HOH 3 503 766 HOH HOH A . SA 13 HOH 4 504 786 HOH HOH A . SA 13 HOH 5 505 603 HOH HOH A . SA 13 HOH 6 506 229 HOH HOH A . SA 13 HOH 7 507 591 HOH HOH A . SA 13 HOH 8 508 647 HOH HOH A . SA 13 HOH 9 509 115 HOH HOH A . SA 13 HOH 10 510 620 HOH HOH A . SA 13 HOH 11 511 641 HOH HOH A . SA 13 HOH 12 512 335 HOH HOH A . SA 13 HOH 13 513 952 HOH HOH A . SA 13 HOH 14 514 745 HOH HOH A . SA 13 HOH 15 515 965 HOH HOH A . SA 13 HOH 16 516 399 HOH HOH A . SA 13 HOH 17 517 37 HOH HOH A . SA 13 HOH 18 518 260 HOH HOH A . SA 13 HOH 19 519 698 HOH HOH A . SA 13 HOH 20 520 346 HOH HOH A . SA 13 HOH 21 521 354 HOH HOH A . SA 13 HOH 22 522 668 HOH HOH A . SA 13 HOH 23 523 663 HOH HOH A . SA 13 HOH 24 524 530 HOH HOH A . SA 13 HOH 25 525 649 HOH HOH A . SA 13 HOH 26 526 55 HOH HOH A . SA 13 HOH 27 527 737 HOH HOH A . SA 13 HOH 28 528 634 HOH HOH A . SA 13 HOH 29 529 256 HOH HOH A . SA 13 HOH 30 530 249 HOH HOH A . SA 13 HOH 31 531 754 HOH HOH A . SA 13 HOH 32 532 1011 HOH HOH A . SA 13 HOH 33 533 744 HOH HOH A . SA 13 HOH 34 534 78 HOH HOH A . SA 13 HOH 35 535 52 HOH HOH A . SA 13 HOH 36 536 307 HOH HOH A . SA 13 HOH 37 537 194 HOH HOH A . SA 13 HOH 38 538 181 HOH HOH A . SA 13 HOH 39 539 261 HOH HOH A . SA 13 HOH 40 540 1008 HOH HOH A . SA 13 HOH 41 541 184 HOH HOH A . SA 13 HOH 42 542 145 HOH HOH A . SA 13 HOH 43 543 70 HOH HOH A . SA 13 HOH 44 544 10 HOH HOH A . SA 13 HOH 45 545 596 HOH HOH A . SA 13 HOH 46 546 263 HOH HOH A . SA 13 HOH 47 547 185 HOH HOH A . SA 13 HOH 48 548 421 HOH HOH A . SA 13 HOH 49 549 250 HOH HOH A . SA 13 HOH 50 550 182 HOH HOH A . SA 13 HOH 51 551 803 HOH HOH A . SA 13 HOH 52 552 18 HOH HOH A . SA 13 HOH 53 553 426 HOH HOH A . SA 13 HOH 54 554 984 HOH HOH A . SA 13 HOH 55 555 150 HOH HOH A . SA 13 HOH 56 556 147 HOH HOH A . SA 13 HOH 57 557 494 HOH HOH A . SA 13 HOH 58 558 589 HOH HOH A . SA 13 HOH 59 559 971 HOH HOH A . SA 13 HOH 60 560 651 HOH HOH A . SA 13 HOH 61 561 210 HOH HOH A . SA 13 HOH 62 562 190 HOH HOH A . SA 13 HOH 63 563 581 HOH HOH A . SA 13 HOH 64 564 442 HOH HOH A . SA 13 HOH 65 565 318 HOH HOH A . SA 13 HOH 66 566 32 HOH HOH A . SA 13 HOH 67 567 469 HOH HOH A . SA 13 HOH 68 568 835 HOH HOH A . SA 13 HOH 69 569 226 HOH HOH A . SA 13 HOH 70 570 222 HOH HOH A . SA 13 HOH 71 571 119 HOH HOH A . SA 13 HOH 72 572 382 HOH HOH A . SA 13 HOH 73 573 102 HOH HOH A . SA 13 HOH 74 574 252 HOH HOH A . SA 13 HOH 75 575 227 HOH HOH A . SA 13 HOH 76 576 900 HOH HOH A . SA 13 HOH 77 577 609 HOH HOH A . SA 13 HOH 78 578 616 HOH HOH A . SA 13 HOH 79 579 31 HOH HOH A . SA 13 HOH 80 580 997 HOH HOH A . SA 13 HOH 81 581 913 HOH HOH A . SA 13 HOH 82 582 747 HOH HOH A . SA 13 HOH 83 583 57 HOH HOH A . SA 13 HOH 84 584 496 HOH HOH A . SA 13 HOH 85 585 279 HOH HOH A . SA 13 HOH 86 586 179 HOH HOH A . SA 13 HOH 87 587 211 HOH HOH A . SA 13 HOH 88 588 209 HOH HOH A . SA 13 HOH 89 589 62 HOH HOH A . SA 13 HOH 90 590 41 HOH HOH A . SA 13 HOH 91 591 315 HOH HOH A . SA 13 HOH 92 592 549 HOH HOH A . SA 13 HOH 93 593 67 HOH HOH A . SA 13 HOH 94 594 465 HOH HOH A . SA 13 HOH 95 595 576 HOH HOH A . SA 13 HOH 96 596 544 HOH HOH A . SA 13 HOH 97 597 406 HOH HOH A . SA 13 HOH 98 598 560 HOH HOH A . SA 13 HOH 99 599 106 HOH HOH A . SA 13 HOH 100 600 5 HOH HOH A . SA 13 HOH 101 601 325 HOH HOH A . SA 13 HOH 102 602 696 HOH HOH A . SA 13 HOH 103 603 171 HOH HOH A . SA 13 HOH 104 604 543 HOH HOH A . SA 13 HOH 105 605 292 HOH HOH A . SA 13 HOH 106 606 4 HOH HOH A . SA 13 HOH 107 607 815 HOH HOH A . SA 13 HOH 108 608 464 HOH HOH A . SA 13 HOH 109 609 368 HOH HOH A . SA 13 HOH 110 610 1051 HOH HOH A . SA 13 HOH 111 611 323 HOH HOH A . SA 13 HOH 112 612 448 HOH HOH A . SA 13 HOH 113 613 561 HOH HOH A . SA 13 HOH 114 614 6 HOH HOH A . SA 13 HOH 115 615 661 HOH HOH A . SA 13 HOH 116 616 920 HOH HOH A . SA 13 HOH 117 617 240 HOH HOH A . SA 13 HOH 118 618 152 HOH HOH A . SA 13 HOH 119 619 500 HOH HOH A . SA 13 HOH 120 620 245 HOH HOH A . SA 13 HOH 121 621 111 HOH HOH A . SA 13 HOH 122 622 56 HOH HOH A . SA 13 HOH 123 623 40 HOH HOH A . SA 13 HOH 124 624 199 HOH HOH A . SA 13 HOH 125 625 358 HOH HOH A . SA 13 HOH 126 626 39 HOH HOH A . SA 13 HOH 127 627 1004 HOH HOH A . SA 13 HOH 128 628 178 HOH HOH A . SA 13 HOH 129 629 355 HOH HOH A . SA 13 HOH 130 630 383 HOH HOH A . SA 13 HOH 131 631 202 HOH HOH A . SA 13 HOH 132 632 15 HOH HOH A . SA 13 HOH 133 633 748 HOH HOH A . SA 13 HOH 134 634 212 HOH HOH A . SA 13 HOH 135 635 134 HOH HOH A . SA 13 HOH 136 636 1001 HOH HOH A . SA 13 HOH 137 637 100 HOH HOH A . SA 13 HOH 138 638 53 HOH HOH A . SA 13 HOH 139 639 316 HOH HOH A . SA 13 HOH 140 640 11 HOH HOH A . SA 13 HOH 141 641 424 HOH HOH A . SA 13 HOH 142 642 917 HOH HOH A . SA 13 HOH 143 643 352 HOH HOH A . SA 13 HOH 144 644 24 HOH HOH A . SA 13 HOH 145 645 207 HOH HOH A . SA 13 HOH 146 646 478 HOH HOH A . SA 13 HOH 147 647 553 HOH HOH A . SA 13 HOH 148 648 303 HOH HOH A . SA 13 HOH 149 649 982 HOH HOH A . SA 13 HOH 150 650 400 HOH HOH A . SA 13 HOH 151 651 499 HOH HOH A . SA 13 HOH 152 652 356 HOH HOH A . SA 13 HOH 153 653 613 HOH HOH A . SA 13 HOH 154 654 491 HOH HOH A . SA 13 HOH 155 655 816 HOH HOH A . SA 13 HOH 156 656 116 HOH HOH A . SA 13 HOH 157 657 58 HOH HOH A . SA 13 HOH 158 658 524 HOH HOH A . SA 13 HOH 159 659 567 HOH HOH A . SA 13 HOH 160 660 394 HOH HOH A . SA 13 HOH 161 661 460 HOH HOH A . SA 13 HOH 162 662 1003 HOH HOH A . SA 13 HOH 163 663 604 HOH HOH A . SA 13 HOH 164 664 390 HOH HOH A . SA 13 HOH 165 665 139 HOH HOH A . SA 13 HOH 166 666 419 HOH HOH A . SA 13 HOH 167 667 275 HOH HOH A . SA 13 HOH 168 668 298 HOH HOH A . SA 13 HOH 169 669 531 HOH HOH A . SA 13 HOH 170 670 680 HOH HOH A . SA 13 HOH 171 671 113 HOH HOH A . SA 13 HOH 172 672 230 HOH HOH A . SA 13 HOH 173 673 901 HOH HOH A . SA 13 HOH 174 674 378 HOH HOH A . SA 13 HOH 175 675 388 HOH HOH A . SA 13 HOH 176 676 602 HOH HOH A . SA 13 HOH 177 677 120 HOH HOH A . SA 13 HOH 178 678 290 HOH HOH A . SA 13 HOH 179 679 94 HOH HOH A . SA 13 HOH 180 680 19 HOH HOH A . SA 13 HOH 181 681 742 HOH HOH A . SA 13 HOH 182 682 163 HOH HOH A . SA 13 HOH 183 683 805 HOH HOH A . SA 13 HOH 184 684 170 HOH HOH A . SA 13 HOH 185 685 328 HOH HOH A . SA 13 HOH 186 686 472 HOH HOH A . SA 13 HOH 187 687 557 HOH HOH A . SA 13 HOH 188 688 347 HOH HOH A . SA 13 HOH 189 689 525 HOH HOH A . SA 13 HOH 190 690 451 HOH HOH A . SA 13 HOH 191 691 639 HOH HOH A . SA 13 HOH 192 692 552 HOH HOH A . SA 13 HOH 193 693 875 HOH HOH A . SA 13 HOH 194 694 841 HOH HOH A . SA 13 HOH 195 695 490 HOH HOH A . SA 13 HOH 196 696 237 HOH HOH A . SA 13 HOH 197 697 166 HOH HOH A . SA 13 HOH 198 698 162 HOH HOH A . SA 13 HOH 199 699 267 HOH HOH A . SA 13 HOH 200 700 694 HOH HOH A . SA 13 HOH 201 701 371 HOH HOH A . SA 13 HOH 202 702 470 HOH HOH A . SA 13 HOH 203 703 289 HOH HOH A . SA 13 HOH 204 704 432 HOH HOH A . SA 13 HOH 205 705 278 HOH HOH A . SA 13 HOH 206 706 850 HOH HOH A . SA 13 HOH 207 707 203 HOH HOH A . SA 13 HOH 208 708 717 HOH HOH A . SA 13 HOH 209 709 643 HOH HOH A . SA 13 HOH 210 710 461 HOH HOH A . SA 13 HOH 211 711 454 HOH HOH A . SA 13 HOH 212 712 546 HOH HOH A . SA 13 HOH 213 713 87 HOH HOH A . SA 13 HOH 214 714 312 HOH HOH A . SA 13 HOH 215 715 772 HOH HOH A . SA 13 HOH 216 716 630 HOH HOH A . SA 13 HOH 217 717 711 HOH HOH A . SA 13 HOH 218 718 713 HOH HOH A . SA 13 HOH 219 719 704 HOH HOH A . SA 13 HOH 220 720 540 HOH HOH A . SA 13 HOH 221 721 381 HOH HOH A . SA 13 HOH 222 722 142 HOH HOH A . SA 13 HOH 223 723 265 HOH HOH A . SA 13 HOH 224 724 832 HOH HOH A . SA 13 HOH 225 725 409 HOH HOH A . SA 13 HOH 226 726 304 HOH HOH A . SA 13 HOH 227 727 635 HOH HOH A . SA 13 HOH 228 728 392 HOH HOH A . SA 13 HOH 229 729 291 HOH HOH A . SA 13 HOH 230 730 459 HOH HOH A . SA 13 HOH 231 731 779 HOH HOH A . SA 13 HOH 232 732 721 HOH HOH A . SA 13 HOH 233 733 667 HOH HOH A . SA 13 HOH 234 734 1000 HOH HOH A . SA 13 HOH 235 735 838 HOH HOH A . SA 13 HOH 236 736 926 HOH HOH A . SA 13 HOH 237 737 972 HOH HOH A . SA 13 HOH 238 738 1015 HOH HOH A . SA 13 HOH 239 739 687 HOH HOH A . SA 13 HOH 240 740 739 HOH HOH A . SA 13 HOH 241 741 828 HOH HOH A . SA 13 HOH 242 742 857 HOH HOH A . SA 13 HOH 243 743 880 HOH HOH A . SA 13 HOH 244 744 730 HOH HOH A . SA 13 HOH 245 745 1005 HOH HOH A . SA 13 HOH 246 746 991 HOH HOH A . SA 13 HOH 247 747 305 HOH HOH A . SA 13 HOH 248 748 578 HOH HOH A . SA 13 HOH 249 749 888 HOH HOH A . SA 13 HOH 250 750 845 HOH HOH A . SA 13 HOH 251 751 918 HOH HOH A . SA 13 HOH 252 752 925 HOH HOH A . SA 13 HOH 253 753 881 HOH HOH A . SA 13 HOH 254 754 562 HOH HOH A . SA 13 HOH 255 755 601 HOH HOH A . SA 13 HOH 256 756 636 HOH HOH A . SA 13 HOH 257 757 622 HOH HOH A . SA 13 HOH 258 758 946 HOH HOH A . SA 13 HOH 259 759 860 HOH HOH A . SA 13 HOH 260 760 486 HOH HOH A . SA 13 HOH 261 761 455 HOH HOH A . SA 13 HOH 262 762 545 HOH HOH A . SA 13 HOH 263 763 878 HOH HOH A . SA 13 HOH 264 764 792 HOH HOH A . SA 13 HOH 265 765 731 HOH HOH A . SA 13 HOH 266 766 746 HOH HOH A . SA 13 HOH 267 767 518 HOH HOH A . SA 13 HOH 268 768 629 HOH HOH A . SA 13 HOH 269 769 937 HOH HOH A . SA 13 HOH 270 770 823 HOH HOH A . SA 13 HOH 271 771 625 HOH HOH A . SA 13 HOH 272 772 689 HOH HOH A . SA 13 HOH 273 773 423 HOH HOH A . SA 13 HOH 274 774 749 HOH HOH A . SA 13 HOH 275 775 697 HOH HOH A . SA 13 HOH 276 776 710 HOH HOH A . SA 13 HOH 277 777 864 HOH HOH A . SA 13 HOH 278 778 481 HOH HOH A . SA 13 HOH 279 779 759 HOH HOH A . SA 13 HOH 280 780 29 HOH HOH A . SA 13 HOH 281 781 708 HOH HOH A . SA 13 HOH 282 782 1031 HOH HOH A . SA 13 HOH 283 783 547 HOH HOH A . SA 13 HOH 284 784 477 HOH HOH A . SA 13 HOH 285 785 364 HOH HOH A . SA 13 HOH 286 786 611 HOH HOH A . SA 13 HOH 287 787 73 HOH HOH A . SA 13 HOH 288 788 580 HOH HOH A . SA 13 HOH 289 789 285 HOH HOH A . SA 13 HOH 290 790 532 HOH HOH A . SA 13 HOH 291 791 844 HOH HOH A . SA 13 HOH 292 792 871 HOH HOH A . SA 13 HOH 293 793 907 HOH HOH A . SA 13 HOH 294 794 756 HOH HOH A . SA 13 HOH 295 795 513 HOH HOH A . SA 13 HOH 296 796 837 HOH HOH A . SA 13 HOH 297 797 682 HOH HOH A . SA 13 HOH 298 798 299 HOH HOH A . SA 13 HOH 299 799 282 HOH HOH A . SA 13 HOH 300 800 535 HOH HOH A . SA 13 HOH 301 801 468 HOH HOH A . SA 13 HOH 302 802 808 HOH HOH A . SA 13 HOH 303 803 910 HOH HOH A . SA 13 HOH 304 804 699 HOH HOH A . SA 13 HOH 305 805 571 HOH HOH A . SA 13 HOH 306 806 769 HOH HOH A . SA 13 HOH 307 807 1045 HOH HOH A . SA 13 HOH 308 808 788 HOH HOH A . SA 13 HOH 309 809 755 HOH HOH A . SA 13 HOH 310 810 362 HOH HOH A . SA 13 HOH 311 811 933 HOH HOH A . SA 13 HOH 312 812 1043 HOH HOH A . SA 13 HOH 313 813 773 HOH HOH A . SA 13 HOH 314 814 718 HOH HOH A . SA 13 HOH 315 815 776 HOH HOH A . SA 13 HOH 316 816 977 HOH HOH A . SA 13 HOH 317 817 834 HOH HOH A . SA 13 HOH 318 818 843 HOH HOH A . TA 13 HOH 1 501 437 HOH HOH B . TA 13 HOH 2 502 313 HOH HOH B . TA 13 HOH 3 503 962 HOH HOH B . TA 13 HOH 4 504 582 HOH HOH B . TA 13 HOH 5 505 196 HOH HOH B . TA 13 HOH 6 506 934 HOH HOH B . TA 13 HOH 7 507 308 HOH HOH B . TA 13 HOH 8 508 404 HOH HOH B . TA 13 HOH 9 509 945 HOH HOH B . TA 13 HOH 10 510 389 HOH HOH B . TA 13 HOH 11 511 638 HOH HOH B . TA 13 HOH 12 512 428 HOH HOH B . TA 13 HOH 13 513 427 HOH HOH B . TA 13 HOH 14 514 672 HOH HOH B . TA 13 HOH 15 515 164 HOH HOH B . TA 13 HOH 16 516 734 HOH HOH B . TA 13 HOH 17 517 74 HOH HOH B . TA 13 HOH 18 518 453 HOH HOH B . TA 13 HOH 19 519 852 HOH HOH B . TA 13 HOH 20 520 793 HOH HOH B . TA 13 HOH 21 521 821 HOH HOH B . TA 13 HOH 22 522 765 HOH HOH B . TA 13 HOH 23 523 51 HOH HOH B . TA 13 HOH 24 524 274 HOH HOH B . TA 13 HOH 25 525 376 HOH HOH B . TA 13 HOH 26 526 26 HOH HOH B . TA 13 HOH 27 527 551 HOH HOH B . TA 13 HOH 28 528 391 HOH HOH B . TA 13 HOH 29 529 503 HOH HOH B . TA 13 HOH 30 530 126 HOH HOH B . TA 13 HOH 31 531 65 HOH HOH B . TA 13 HOH 32 532 859 HOH HOH B . TA 13 HOH 33 533 407 HOH HOH B . TA 13 HOH 34 534 232 HOH HOH B . TA 13 HOH 35 535 330 HOH HOH B . TA 13 HOH 36 536 450 HOH HOH B . TA 13 HOH 37 537 439 HOH HOH B . TA 13 HOH 38 538 566 HOH HOH B . TA 13 HOH 39 539 314 HOH HOH B . TA 13 HOH 40 540 224 HOH HOH B . TA 13 HOH 41 541 414 HOH HOH B . TA 13 HOH 42 542 193 HOH HOH B . TA 13 HOH 43 543 108 HOH HOH B . TA 13 HOH 44 544 84 HOH HOH B . TA 13 HOH 45 545 568 HOH HOH B . TA 13 HOH 46 546 528 HOH HOH B . TA 13 HOH 47 547 619 HOH HOH B . TA 13 HOH 48 548 526 HOH HOH B . TA 13 HOH 49 549 963 HOH HOH B . TA 13 HOH 50 550 898 HOH HOH B . TA 13 HOH 51 551 161 HOH HOH B . TA 13 HOH 52 552 411 HOH HOH B . TA 13 HOH 53 553 958 HOH HOH B . TA 13 HOH 54 554 998 HOH HOH B . TA 13 HOH 55 555 485 HOH HOH B . TA 13 HOH 56 556 123 HOH HOH B . TA 13 HOH 57 557 286 HOH HOH B . TA 13 HOH 58 558 447 HOH HOH B . TA 13 HOH 59 559 101 HOH HOH B . TA 13 HOH 60 560 507 HOH HOH B . TA 13 HOH 61 561 974 HOH HOH B . TA 13 HOH 62 562 283 HOH HOH B . TA 13 HOH 63 563 124 HOH HOH B . TA 13 HOH 64 564 435 HOH HOH B . TA 13 HOH 65 565 329 HOH HOH B . TA 13 HOH 66 566 436 HOH HOH B . TA 13 HOH 67 567 238 HOH HOH B . TA 13 HOH 68 568 968 HOH HOH B . TA 13 HOH 69 569 418 HOH HOH B . TA 13 HOH 70 570 317 HOH HOH B . TA 13 HOH 71 571 284 HOH HOH B . TA 13 HOH 72 572 130 HOH HOH B . TA 13 HOH 73 573 35 HOH HOH B . TA 13 HOH 74 574 30 HOH HOH B . TA 13 HOH 75 575 127 HOH HOH B . TA 13 HOH 76 576 960 HOH HOH B . TA 13 HOH 77 577 324 HOH HOH B . TA 13 HOH 78 578 13 HOH HOH B . TA 13 HOH 79 579 188 HOH HOH B . TA 13 HOH 80 580 136 HOH HOH B . TA 13 HOH 81 581 445 HOH HOH B . TA 13 HOH 82 582 138 HOH HOH B . TA 13 HOH 83 583 890 HOH HOH B . TA 13 HOH 84 584 462 HOH HOH B . TA 13 HOH 85 585 1047 HOH HOH B . TA 13 HOH 86 586 599 HOH HOH B . TA 13 HOH 87 587 1 HOH HOH B . TA 13 HOH 88 588 1016 HOH HOH B . TA 13 HOH 89 589 953 HOH HOH B . TA 13 HOH 90 590 564 HOH HOH B . TA 13 HOH 91 591 353 HOH HOH B . TA 13 HOH 92 592 105 HOH HOH B . TA 13 HOH 93 593 919 HOH HOH B . TA 13 HOH 94 594 380 HOH HOH B . TA 13 HOH 95 595 262 HOH HOH B . TA 13 HOH 96 596 763 HOH HOH B . TA 13 HOH 97 597 750 HOH HOH B . TA 13 HOH 98 598 300 HOH HOH B . TA 13 HOH 99 599 175 HOH HOH B . TA 13 HOH 100 600 221 HOH HOH B . TA 13 HOH 101 601 17 HOH HOH B . TA 13 HOH 102 602 59 HOH HOH B . TA 13 HOH 103 603 71 HOH HOH B . TA 13 HOH 104 604 420 HOH HOH B . TA 13 HOH 105 605 593 HOH HOH B . TA 13 HOH 106 606 375 HOH HOH B . TA 13 HOH 107 607 846 HOH HOH B . TA 13 HOH 108 608 565 HOH HOH B . TA 13 HOH 109 609 50 HOH HOH B . TA 13 HOH 110 610 85 HOH HOH B . TA 13 HOH 111 611 709 HOH HOH B . TA 13 HOH 112 612 135 HOH HOH B . TA 13 HOH 113 613 137 HOH HOH B . TA 13 HOH 114 614 271 HOH HOH B . TA 13 HOH 115 615 14 HOH HOH B . TA 13 HOH 116 616 1025 HOH HOH B . TA 13 HOH 117 617 173 HOH HOH B . TA 13 HOH 118 618 359 HOH HOH B . TA 13 HOH 119 619 476 HOH HOH B . TA 13 HOH 120 620 254 HOH HOH B . TA 13 HOH 121 621 373 HOH HOH B . TA 13 HOH 122 622 980 HOH HOH B . TA 13 HOH 123 623 295 HOH HOH B . TA 13 HOH 124 624 21 HOH HOH B . TA 13 HOH 125 625 688 HOH HOH B . TA 13 HOH 126 626 1027 HOH HOH B . TA 13 HOH 127 627 192 HOH HOH B . TA 13 HOH 128 628 205 HOH HOH B . TA 13 HOH 129 629 807 HOH HOH B . TA 13 HOH 130 630 784 HOH HOH B . TA 13 HOH 131 631 830 HOH HOH B . TA 13 HOH 132 632 429 HOH HOH B . TA 13 HOH 133 633 655 HOH HOH B . TA 13 HOH 134 634 508 HOH HOH B . TA 13 HOH 135 635 527 HOH HOH B . TA 13 HOH 136 636 201 HOH HOH B . TA 13 HOH 137 637 114 HOH HOH B . TA 13 HOH 138 638 1012 HOH HOH B . TA 13 HOH 139 639 64 HOH HOH B . TA 13 HOH 140 640 228 HOH HOH B . TA 13 HOH 141 641 341 HOH HOH B . TA 13 HOH 142 642 555 HOH HOH B . TA 13 HOH 143 643 693 HOH HOH B . TA 13 HOH 144 644 63 HOH HOH B . TA 13 HOH 145 645 42 HOH HOH B . TA 13 HOH 146 646 425 HOH HOH B . TA 13 HOH 147 647 88 HOH HOH B . TA 13 HOH 148 648 38 HOH HOH B . TA 13 HOH 149 649 612 HOH HOH B . TA 13 HOH 150 650 95 HOH HOH B . TA 13 HOH 151 651 401 HOH HOH B . TA 13 HOH 152 652 488 HOH HOH B . TA 13 HOH 153 653 684 HOH HOH B . TA 13 HOH 154 654 676 HOH HOH B . TA 13 HOH 155 655 415 HOH HOH B . TA 13 HOH 156 656 993 HOH HOH B . TA 13 HOH 157 657 68 HOH HOH B . TA 13 HOH 158 658 912 HOH HOH B . TA 13 HOH 159 659 949 HOH HOH B . TA 13 HOH 160 660 270 HOH HOH B . TA 13 HOH 161 661 82 HOH HOH B . TA 13 HOH 162 662 374 HOH HOH B . TA 13 HOH 163 663 735 HOH HOH B . TA 13 HOH 164 664 25 HOH HOH B . TA 13 HOH 165 665 81 HOH HOH B . TA 13 HOH 166 666 288 HOH HOH B . TA 13 HOH 167 667 482 HOH HOH B . TA 13 HOH 168 668 865 HOH HOH B . TA 13 HOH 169 669 343 HOH HOH B . TA 13 HOH 170 670 223 HOH HOH B . TA 13 HOH 171 671 614 HOH HOH B . TA 13 HOH 172 672 75 HOH HOH B . TA 13 HOH 173 673 231 HOH HOH B . TA 13 HOH 174 674 276 HOH HOH B . TA 13 HOH 175 675 337 HOH HOH B . TA 13 HOH 176 676 156 HOH HOH B . TA 13 HOH 177 677 54 HOH HOH B . TA 13 HOH 178 678 133 HOH HOH B . TA 13 HOH 179 679 277 HOH HOH B . TA 13 HOH 180 680 148 HOH HOH B . TA 13 HOH 181 681 985 HOH HOH B . TA 13 HOH 182 682 1021 HOH HOH B . TA 13 HOH 183 683 109 HOH HOH B . TA 13 HOH 184 684 183 HOH HOH B . TA 13 HOH 185 685 712 HOH HOH B . TA 13 HOH 186 686 658 HOH HOH B . TA 13 HOH 187 687 204 HOH HOH B . TA 13 HOH 188 688 548 HOH HOH B . TA 13 HOH 189 689 149 HOH HOH B . TA 13 HOH 190 690 174 HOH HOH B . TA 13 HOH 191 691 657 HOH HOH B . TA 13 HOH 192 692 9 HOH HOH B . TA 13 HOH 193 693 624 HOH HOH B . TA 13 HOH 194 694 519 HOH HOH B . TA 13 HOH 195 695 867 HOH HOH B . TA 13 HOH 196 696 110 HOH HOH B . TA 13 HOH 197 697 691 HOH HOH B . TA 13 HOH 198 698 976 HOH HOH B . TA 13 HOH 199 699 257 HOH HOH B . TA 13 HOH 200 700 311 HOH HOH B . TA 13 HOH 201 701 187 HOH HOH B . TA 13 HOH 202 702 405 HOH HOH B . TA 13 HOH 203 703 264 HOH HOH B . TA 13 HOH 204 704 180 HOH HOH B . TA 13 HOH 205 705 683 HOH HOH B . TA 13 HOH 206 706 827 HOH HOH B . TA 13 HOH 207 707 49 HOH HOH B . TA 13 HOH 208 708 911 HOH HOH B . TA 13 HOH 209 709 659 HOH HOH B . TA 13 HOH 210 710 556 HOH HOH B . TA 13 HOH 211 711 885 HOH HOH B . TA 13 HOH 212 712 372 HOH HOH B . TA 13 HOH 213 713 780 HOH HOH B . TA 13 HOH 214 714 751 HOH HOH B . TA 13 HOH 215 715 168 HOH HOH B . TA 13 HOH 216 716 1006 HOH HOH B . TA 13 HOH 217 717 853 HOH HOH B . TA 13 HOH 218 718 660 HOH HOH B . TA 13 HOH 219 719 989 HOH HOH B . TA 13 HOH 220 720 646 HOH HOH B . TA 13 HOH 221 721 675 HOH HOH B . TA 13 HOH 222 722 1017 HOH HOH B . TA 13 HOH 223 723 189 HOH HOH B . TA 13 HOH 224 724 253 HOH HOH B . TA 13 HOH 225 725 577 HOH HOH B . TA 13 HOH 226 726 594 HOH HOH B . TA 13 HOH 227 727 131 HOH HOH B . TA 13 HOH 228 728 948 HOH HOH B . TA 13 HOH 229 729 921 HOH HOH B . TA 13 HOH 230 730 610 HOH HOH B . TA 13 HOH 231 731 979 HOH HOH B . TA 13 HOH 232 732 1041 HOH HOH B . TA 13 HOH 233 733 970 HOH HOH B . TA 13 HOH 234 734 570 HOH HOH B . TA 13 HOH 235 735 177 HOH HOH B . TA 13 HOH 236 736 538 HOH HOH B . TA 13 HOH 237 737 523 HOH HOH B . TA 13 HOH 238 738 1022 HOH HOH B . TA 13 HOH 239 739 554 HOH HOH B . TA 13 HOH 240 740 695 HOH HOH B . TA 13 HOH 241 741 891 HOH HOH B . TA 13 HOH 242 742 645 HOH HOH B . TA 13 HOH 243 743 889 HOH HOH B . TA 13 HOH 244 744 767 HOH HOH B . TA 13 HOH 245 745 623 HOH HOH B . TA 13 HOH 246 746 1020 HOH HOH B . TA 13 HOH 247 747 892 HOH HOH B . TA 13 HOH 248 748 1007 HOH HOH B . TA 13 HOH 249 749 879 HOH HOH B . TA 13 HOH 250 750 467 HOH HOH B . TA 13 HOH 251 751 924 HOH HOH B . TA 13 HOH 252 752 628 HOH HOH B . TA 13 HOH 253 753 870 HOH HOH B . TA 13 HOH 254 754 969 HOH HOH B . TA 13 HOH 255 755 999 HOH HOH B . TA 13 HOH 256 756 631 HOH HOH B . TA 13 HOH 257 757 1013 HOH HOH B . TA 13 HOH 258 758 801 HOH HOH B . TA 13 HOH 259 759 714 HOH HOH B . TA 13 HOH 260 760 626 HOH HOH B . TA 13 HOH 261 761 981 HOH HOH B . TA 13 HOH 262 762 674 HOH HOH B . TA 13 HOH 263 763 863 HOH HOH B . TA 13 HOH 264 764 393 HOH HOH B . TA 13 HOH 265 765 652 HOH HOH B . TA 13 HOH 266 766 692 HOH HOH B . TA 13 HOH 267 767 515 HOH HOH B . TA 13 HOH 268 768 502 HOH HOH B . TA 13 HOH 269 769 724 HOH HOH B . TA 13 HOH 270 770 642 HOH HOH B . TA 13 HOH 271 771 915 HOH HOH B . TA 13 HOH 272 772 936 HOH HOH B . TA 13 HOH 273 773 600 HOH HOH B . TA 13 HOH 274 774 514 HOH HOH B . TA 13 HOH 275 775 872 HOH HOH B . TA 13 HOH 276 776 632 HOH HOH B . TA 13 HOH 277 777 983 HOH HOH B . TA 13 HOH 278 778 446 HOH HOH B . TA 13 HOH 279 779 542 HOH HOH B . TA 13 HOH 280 780 862 HOH HOH B . TA 13 HOH 281 781 690 HOH HOH B . TA 13 HOH 282 782 716 HOH HOH B . TA 13 HOH 283 783 896 HOH HOH B . TA 13 HOH 284 784 729 HOH HOH B . TA 13 HOH 285 785 339 HOH HOH B . TA 13 HOH 286 786 456 HOH HOH B . TA 13 HOH 287 787 758 HOH HOH B . TA 13 HOH 288 788 396 HOH HOH B . TA 13 HOH 289 789 728 HOH HOH B . TA 13 HOH 290 790 522 HOH HOH B . TA 13 HOH 291 791 176 HOH HOH B . TA 13 HOH 292 792 811 HOH HOH B . TA 13 HOH 293 793 569 HOH HOH B . TA 13 HOH 294 794 644 HOH HOH B . TA 13 HOH 295 795 840 HOH HOH B . TA 13 HOH 296 796 1038 HOH HOH B . TA 13 HOH 297 797 666 HOH HOH B . TA 13 HOH 298 798 417 HOH HOH B . TA 13 HOH 299 799 1037 HOH HOH B . TA 13 HOH 300 800 598 HOH HOH B . TA 13 HOH 301 801 824 HOH HOH B . TA 13 HOH 302 802 369 HOH HOH B . TA 13 HOH 303 803 849 HOH HOH B . TA 13 HOH 304 804 908 HOH HOH B . TA 13 HOH 305 805 416 HOH HOH B . TA 13 HOH 306 806 719 HOH HOH B . TA 13 HOH 307 807 558 HOH HOH B . TA 13 HOH 308 808 662 HOH HOH B . TA 13 HOH 309 809 586 HOH HOH B . TA 13 HOH 310 810 706 HOH HOH B . TA 13 HOH 311 811 944 HOH HOH B . TA 13 HOH 312 812 463 HOH HOH B . TA 13 HOH 313 813 873 HOH HOH B . TA 13 HOH 314 814 966 HOH HOH B . TA 13 HOH 315 815 584 HOH HOH B . TA 13 HOH 316 816 957 HOH HOH B . TA 13 HOH 317 817 590 HOH HOH B . TA 13 HOH 318 818 839 HOH HOH B . TA 13 HOH 319 819 280 HOH HOH B . TA 13 HOH 320 820 903 HOH HOH B . TA 13 HOH 321 821 333 HOH HOH B . TA 13 HOH 322 822 893 HOH HOH B . TA 13 HOH 323 823 927 HOH HOH B . TA 13 HOH 324 824 583 HOH HOH B . TA 13 HOH 325 825 738 HOH HOH B . TA 13 HOH 326 826 702 HOH HOH B . TA 13 HOH 327 827 722 HOH HOH B . UA 13 HOH 1 501 367 HOH HOH C . UA 13 HOH 2 502 77 HOH HOH C . UA 13 HOH 3 503 883 HOH HOH C . UA 13 HOH 4 504 397 HOH HOH C . UA 13 HOH 5 505 322 HOH HOH C . UA 13 HOH 6 506 296 HOH HOH C . UA 13 HOH 7 507 433 HOH HOH C . UA 13 HOH 8 508 725 HOH HOH C . UA 13 HOH 9 509 501 HOH HOH C . UA 13 HOH 10 510 140 HOH HOH C . UA 13 HOH 11 511 165 HOH HOH C . UA 13 HOH 12 512 269 HOH HOH C . UA 13 HOH 13 513 541 HOH HOH C . UA 13 HOH 14 514 592 HOH HOH C . UA 13 HOH 15 515 861 HOH HOH C . UA 13 HOH 16 516 331 HOH HOH C . UA 13 HOH 17 517 536 HOH HOH C . UA 13 HOH 18 518 955 HOH HOH C . UA 13 HOH 19 519 967 HOH HOH C . UA 13 HOH 20 520 23 HOH HOH C . UA 13 HOH 21 521 916 HOH HOH C . UA 13 HOH 22 522 44 HOH HOH C . UA 13 HOH 23 523 236 HOH HOH C . UA 13 HOH 24 524 76 HOH HOH C . UA 13 HOH 25 525 637 HOH HOH C . UA 13 HOH 26 526 363 HOH HOH C . UA 13 HOH 27 527 753 HOH HOH C . UA 13 HOH 28 528 72 HOH HOH C . UA 13 HOH 29 529 509 HOH HOH C . UA 13 HOH 30 530 80 HOH HOH C . UA 13 HOH 31 531 92 HOH HOH C . UA 13 HOH 32 532 235 HOH HOH C . UA 13 HOH 33 533 794 HOH HOH C . UA 13 HOH 34 534 964 HOH HOH C . UA 13 HOH 35 535 160 HOH HOH C . UA 13 HOH 36 536 876 HOH HOH C . UA 13 HOH 37 537 12 HOH HOH C . UA 13 HOH 38 538 869 HOH HOH C . UA 13 HOH 39 539 932 HOH HOH C . UA 13 HOH 40 540 332 HOH HOH C . UA 13 HOH 41 541 665 HOH HOH C . UA 13 HOH 42 542 1010 HOH HOH C . UA 13 HOH 43 543 951 HOH HOH C . UA 13 HOH 44 544 648 HOH HOH C . UA 13 HOH 45 545 338 HOH HOH C . UA 13 HOH 46 546 47 HOH HOH C . UA 13 HOH 47 547 258 HOH HOH C . UA 13 HOH 48 548 585 HOH HOH C . UA 13 HOH 49 549 441 HOH HOH C . UA 13 HOH 50 550 302 HOH HOH C . UA 13 HOH 51 551 206 HOH HOH C . UA 13 HOH 52 552 1024 HOH HOH C . UA 13 HOH 53 553 443 HOH HOH C . UA 13 HOH 54 554 197 HOH HOH C . UA 13 HOH 55 555 798 HOH HOH C . UA 13 HOH 56 556 272 HOH HOH C . UA 13 HOH 57 557 172 HOH HOH C . UA 13 HOH 58 558 326 HOH HOH C . UA 13 HOH 59 559 402 HOH HOH C . UA 13 HOH 60 560 154 HOH HOH C . UA 13 HOH 61 561 345 HOH HOH C . UA 13 HOH 62 562 98 HOH HOH C . UA 13 HOH 63 563 440 HOH HOH C . UA 13 HOH 64 564 79 HOH HOH C . UA 13 HOH 65 565 357 HOH HOH C . UA 13 HOH 66 566 487 HOH HOH C . UA 13 HOH 67 567 215 HOH HOH C . UA 13 HOH 68 568 93 HOH HOH C . UA 13 HOH 69 569 408 HOH HOH C . UA 13 HOH 70 570 157 HOH HOH C . UA 13 HOH 71 571 158 HOH HOH C . UA 13 HOH 72 572 122 HOH HOH C . UA 13 HOH 73 573 243 HOH HOH C . UA 13 HOH 74 574 191 HOH HOH C . UA 13 HOH 75 575 259 HOH HOH C . UA 13 HOH 76 576 387 HOH HOH C . UA 13 HOH 77 577 379 HOH HOH C . UA 13 HOH 78 578 348 HOH HOH C . UA 13 HOH 79 579 403 HOH HOH C . UA 13 HOH 80 580 225 HOH HOH C . UA 13 HOH 81 581 90 HOH HOH C . UA 13 HOH 82 582 218 HOH HOH C . UA 13 HOH 83 583 234 HOH HOH C . UA 13 HOH 84 584 22 HOH HOH C . UA 13 HOH 85 585 988 HOH HOH C . UA 13 HOH 86 586 309 HOH HOH C . UA 13 HOH 87 587 214 HOH HOH C . UA 13 HOH 88 588 27 HOH HOH C . UA 13 HOH 89 589 239 HOH HOH C . UA 13 HOH 90 590 8 HOH HOH C . UA 13 HOH 91 591 48 HOH HOH C . UA 13 HOH 92 592 33 HOH HOH C . UA 13 HOH 93 593 60 HOH HOH C . UA 13 HOH 94 594 539 HOH HOH C . UA 13 HOH 95 595 377 HOH HOH C . UA 13 HOH 96 596 128 HOH HOH C . UA 13 HOH 97 597 195 HOH HOH C . UA 13 HOH 98 598 293 HOH HOH C . UA 13 HOH 99 599 198 HOH HOH C . UA 13 HOH 100 600 151 HOH HOH C . UA 13 HOH 101 601 86 HOH HOH C . UA 13 HOH 102 602 615 HOH HOH C . UA 13 HOH 103 603 132 HOH HOH C . UA 13 HOH 104 604 118 HOH HOH C . UA 13 HOH 105 605 621 HOH HOH C . UA 13 HOH 106 606 559 HOH HOH C . UA 13 HOH 107 607 833 HOH HOH C . UA 13 HOH 108 608 3 HOH HOH C . UA 13 HOH 109 609 640 HOH HOH C . UA 13 HOH 110 610 484 HOH HOH C . UA 13 HOH 111 611 366 HOH HOH C . UA 13 HOH 112 612 505 HOH HOH C . UA 13 HOH 113 613 457 HOH HOH C . UA 13 HOH 114 614 266 HOH HOH C . UA 13 HOH 115 615 707 HOH HOH C . UA 13 HOH 116 616 146 HOH HOH C . UA 13 HOH 117 617 97 HOH HOH C . UA 13 HOH 118 618 281 HOH HOH C . UA 13 HOH 119 619 395 HOH HOH C . UA 13 HOH 120 620 301 HOH HOH C . UA 13 HOH 121 621 7 HOH HOH C . UA 13 HOH 122 622 169 HOH HOH C . UA 13 HOH 123 623 987 HOH HOH C . UA 13 HOH 124 624 200 HOH HOH C . UA 13 HOH 125 625 627 HOH HOH C . UA 13 HOH 126 626 975 HOH HOH C . UA 13 HOH 127 627 796 HOH HOH C . UA 13 HOH 128 628 597 HOH HOH C . UA 13 HOH 129 629 155 HOH HOH C . UA 13 HOH 130 630 104 HOH HOH C . UA 13 HOH 131 631 608 HOH HOH C . UA 13 HOH 132 632 736 HOH HOH C . UA 13 HOH 133 633 310 HOH HOH C . UA 13 HOH 134 634 978 HOH HOH C . UA 13 HOH 135 635 412 HOH HOH C . UA 13 HOH 136 636 868 HOH HOH C . UA 13 HOH 137 637 877 HOH HOH C . UA 13 HOH 138 638 220 HOH HOH C . UA 13 HOH 139 639 681 HOH HOH C . UA 13 HOH 140 640 294 HOH HOH C . UA 13 HOH 141 641 342 HOH HOH C . UA 13 HOH 142 642 510 HOH HOH C . UA 13 HOH 143 643 340 HOH HOH C . UA 13 HOH 144 644 899 HOH HOH C . UA 13 HOH 145 645 107 HOH HOH C . UA 13 HOH 146 646 20 HOH HOH C . UA 13 HOH 147 647 43 HOH HOH C . UA 13 HOH 148 648 61 HOH HOH C . UA 13 HOH 149 649 1048 HOH HOH C . UA 13 HOH 150 650 28 HOH HOH C . UA 13 HOH 151 651 96 HOH HOH C . UA 13 HOH 152 652 143 HOH HOH C . UA 13 HOH 153 653 16 HOH HOH C . UA 13 HOH 154 654 217 HOH HOH C . UA 13 HOH 155 655 159 HOH HOH C . UA 13 HOH 156 656 430 HOH HOH C . UA 13 HOH 157 657 361 HOH HOH C . UA 13 HOH 158 658 986 HOH HOH C . UA 13 HOH 159 659 705 HOH HOH C . UA 13 HOH 160 660 319 HOH HOH C . UA 13 HOH 161 661 233 HOH HOH C . UA 13 HOH 162 662 45 HOH HOH C . UA 13 HOH 163 663 653 HOH HOH C . UA 13 HOH 164 664 268 HOH HOH C . UA 13 HOH 165 665 129 HOH HOH C . UA 13 HOH 166 666 91 HOH HOH C . UA 13 HOH 167 667 727 HOH HOH C . UA 13 HOH 168 668 167 HOH HOH C . UA 13 HOH 169 669 66 HOH HOH C . UA 13 HOH 170 670 36 HOH HOH C . UA 13 HOH 171 671 700 HOH HOH C . UA 13 HOH 172 672 533 HOH HOH C . UA 13 HOH 173 673 996 HOH HOH C . UA 13 HOH 174 674 83 HOH HOH C . UA 13 HOH 175 675 248 HOH HOH C . UA 13 HOH 176 676 768 HOH HOH C . UA 13 HOH 177 677 489 HOH HOH C . UA 13 HOH 178 678 103 HOH HOH C . UA 13 HOH 179 679 216 HOH HOH C . UA 13 HOH 180 680 365 HOH HOH C . UA 13 HOH 181 681 480 HOH HOH C . UA 13 HOH 182 682 550 HOH HOH C . UA 13 HOH 183 683 422 HOH HOH C . UA 13 HOH 184 684 46 HOH HOH C . UA 13 HOH 185 685 334 HOH HOH C . UA 13 HOH 186 686 2 HOH HOH C . UA 13 HOH 187 687 247 HOH HOH C . UA 13 HOH 188 688 349 HOH HOH C . UA 13 HOH 189 689 606 HOH HOH C . UA 13 HOH 190 690 219 HOH HOH C . UA 13 HOH 191 691 34 HOH HOH C . UA 13 HOH 192 692 344 HOH HOH C . UA 13 HOH 193 693 69 HOH HOH C . UA 13 HOH 194 694 255 HOH HOH C . UA 13 HOH 195 695 812 HOH HOH C . UA 13 HOH 196 696 244 HOH HOH C . UA 13 HOH 197 697 321 HOH HOH C . UA 13 HOH 198 698 241 HOH HOH C . UA 13 HOH 199 699 213 HOH HOH C . UA 13 HOH 200 700 771 HOH HOH C . UA 13 HOH 201 701 112 HOH HOH C . UA 13 HOH 202 702 804 HOH HOH C . UA 13 HOH 203 703 121 HOH HOH C . UA 13 HOH 204 704 384 HOH HOH C . UA 13 HOH 205 705 809 HOH HOH C . UA 13 HOH 206 706 141 HOH HOH C . UA 13 HOH 207 707 117 HOH HOH C . UA 13 HOH 208 708 1009 HOH HOH C . UA 13 HOH 209 709 410 HOH HOH C . UA 13 HOH 210 710 781 HOH HOH C . UA 13 HOH 211 711 186 HOH HOH C . UA 13 HOH 212 712 825 HOH HOH C . UA 13 HOH 213 713 633 HOH HOH C . UA 13 HOH 214 714 306 HOH HOH C . UA 13 HOH 215 715 89 HOH HOH C . UA 13 HOH 216 716 814 HOH HOH C . UA 13 HOH 217 717 1002 HOH HOH C . UA 13 HOH 218 718 458 HOH HOH C . UA 13 HOH 219 719 1049 HOH HOH C . UA 13 HOH 220 720 350 HOH HOH C . UA 13 HOH 221 721 654 HOH HOH C . UA 13 HOH 222 722 153 HOH HOH C . UA 13 HOH 223 723 483 HOH HOH C . UA 13 HOH 224 724 866 HOH HOH C . UA 13 HOH 225 725 506 HOH HOH C . UA 13 HOH 226 726 677 HOH HOH C . UA 13 HOH 227 727 144 HOH HOH C . UA 13 HOH 228 728 287 HOH HOH C . UA 13 HOH 229 729 99 HOH HOH C . UA 13 HOH 230 730 504 HOH HOH C . UA 13 HOH 231 731 242 HOH HOH C . UA 13 HOH 232 732 385 HOH HOH C . UA 13 HOH 233 733 438 HOH HOH C . UA 13 HOH 234 734 386 HOH HOH C . UA 13 HOH 235 735 679 HOH HOH C . UA 13 HOH 236 736 434 HOH HOH C . UA 13 HOH 237 737 990 HOH HOH C . UA 13 HOH 238 738 351 HOH HOH C . UA 13 HOH 239 739 726 HOH HOH C . UA 13 HOH 240 740 497 HOH HOH C . UA 13 HOH 241 741 320 HOH HOH C . UA 13 HOH 242 742 520 HOH HOH C . UA 13 HOH 243 743 360 HOH HOH C . UA 13 HOH 244 744 251 HOH HOH C . UA 13 HOH 245 745 517 HOH HOH C . UA 13 HOH 246 746 575 HOH HOH C . UA 13 HOH 247 747 512 HOH HOH C . UA 13 HOH 248 748 246 HOH HOH C . UA 13 HOH 249 749 588 HOH HOH C . UA 13 HOH 250 750 685 HOH HOH C . UA 13 HOH 251 751 935 HOH HOH C . UA 13 HOH 252 752 1023 HOH HOH C . UA 13 HOH 253 753 670 HOH HOH C . UA 13 HOH 254 754 817 HOH HOH C . UA 13 HOH 255 755 208 HOH HOH C . UA 13 HOH 256 756 929 HOH HOH C . UA 13 HOH 257 757 715 HOH HOH C . UA 13 HOH 258 758 938 HOH HOH C . UA 13 HOH 259 759 733 HOH HOH C . UA 13 HOH 260 760 701 HOH HOH C . UA 13 HOH 261 761 563 HOH HOH C . UA 13 HOH 262 762 882 HOH HOH C . UA 13 HOH 263 763 413 HOH HOH C . UA 13 HOH 264 764 1044 HOH HOH C . UA 13 HOH 265 765 511 HOH HOH C . UA 13 HOH 266 766 973 HOH HOH C . UA 13 HOH 267 767 720 HOH HOH C . UA 13 HOH 268 768 297 HOH HOH C . UA 13 HOH 269 769 820 HOH HOH C . UA 13 HOH 270 770 671 HOH HOH C . UA 13 HOH 271 771 587 HOH HOH C . UA 13 HOH 272 772 498 HOH HOH C . UA 13 HOH 273 773 802 HOH HOH C . UA 13 HOH 274 774 906 HOH HOH C . UA 13 HOH 275 775 370 HOH HOH C . UA 13 HOH 276 776 782 HOH HOH C . UA 13 HOH 277 777 473 HOH HOH C . UA 13 HOH 278 778 595 HOH HOH C . UA 13 HOH 279 779 777 HOH HOH C . UA 13 HOH 280 780 785 HOH HOH C . UA 13 HOH 281 781 819 HOH HOH C . UA 13 HOH 282 782 327 HOH HOH C . UA 13 HOH 283 783 449 HOH HOH C . UA 13 HOH 284 784 847 HOH HOH C . UA 13 HOH 285 785 431 HOH HOH C . UA 13 HOH 286 786 537 HOH HOH C . UA 13 HOH 287 787 895 HOH HOH C . UA 13 HOH 288 788 1028 HOH HOH C . UA 13 HOH 289 789 521 HOH HOH C . UA 13 HOH 290 790 1050 HOH HOH C . UA 13 HOH 291 791 529 HOH HOH C . UA 13 HOH 292 792 858 HOH HOH C . UA 13 HOH 293 793 806 HOH HOH C . UA 13 HOH 294 794 618 HOH HOH C . UA 13 HOH 295 795 723 HOH HOH C . UA 13 HOH 296 796 572 HOH HOH C . UA 13 HOH 297 797 950 HOH HOH C . UA 13 HOH 298 798 452 HOH HOH C . UA 13 HOH 299 799 617 HOH HOH C . UA 13 HOH 300 800 656 HOH HOH C . UA 13 HOH 301 801 125 HOH HOH C . UA 13 HOH 302 802 922 HOH HOH C . UA 13 HOH 303 803 741 HOH HOH C . UA 13 HOH 304 804 444 HOH HOH C . UA 13 HOH 305 805 703 HOH HOH C . UA 13 HOH 306 806 479 HOH HOH C . UA 13 HOH 307 807 961 HOH HOH C . UA 13 HOH 308 808 493 HOH HOH C . UA 13 HOH 309 809 650 HOH HOH C . UA 13 HOH 310 810 607 HOH HOH C . UA 13 HOH 311 811 886 HOH HOH C . UA 13 HOH 312 812 471 HOH HOH C . UA 13 HOH 313 813 897 HOH HOH C . UA 13 HOH 314 814 1042 HOH HOH C . UA 13 HOH 315 815 516 HOH HOH C . UA 13 HOH 316 816 959 HOH HOH C . UA 13 HOH 317 817 930 HOH HOH C . UA 13 HOH 318 818 574 HOH HOH C . UA 13 HOH 319 819 894 HOH HOH C . UA 13 HOH 320 820 475 HOH HOH C . UA 13 HOH 321 821 826 HOH HOH C . UA 13 HOH 322 822 994 HOH HOH C . UA 13 HOH 323 823 673 HOH HOH C . UA 13 HOH 324 824 740 HOH HOH C . UA 13 HOH 325 825 939 HOH HOH C . UA 13 HOH 326 826 273 HOH HOH C . UA 13 HOH 327 827 466 HOH HOH C . UA 13 HOH 328 828 686 HOH HOH C . UA 13 HOH 329 829 752 HOH HOH C . UA 13 HOH 330 830 789 HOH HOH C . UA 13 HOH 331 831 534 HOH HOH C . UA 13 HOH 332 832 787 HOH HOH C . UA 13 HOH 333 833 848 HOH HOH C . UA 13 HOH 334 834 831 HOH HOH C . UA 13 HOH 335 835 836 HOH HOH C . UA 13 HOH 336 836 774 HOH HOH C . UA 13 HOH 337 837 1026 HOH HOH C . UA 13 HOH 338 838 1029 HOH HOH C . UA 13 HOH 339 839 791 HOH HOH C . UA 13 HOH 340 840 573 HOH HOH C . UA 13 HOH 341 841 579 HOH HOH C . UA 13 HOH 342 842 398 HOH HOH C . UA 13 HOH 343 843 954 HOH HOH C . UA 13 HOH 344 844 856 HOH HOH C . UA 13 HOH 345 845 923 HOH HOH C . UA 13 HOH 346 846 1040 HOH HOH C . UA 13 HOH 347 847 492 HOH HOH C . UA 13 HOH 348 848 1033 HOH HOH C . UA 13 HOH 349 849 842 HOH HOH C . UA 13 HOH 350 850 743 HOH HOH C . UA 13 HOH 351 851 474 HOH HOH C . UA 13 HOH 352 852 931 HOH HOH C . UA 13 HOH 353 853 495 HOH HOH C . UA 13 HOH 354 854 795 HOH HOH C . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 B SME 56 B SME 56 ? MET 'modified residue' 2 B SME 97 B SME 97 ? MET 'modified residue' 3 B CSD 330 B CSD 330 ? CYS 'modified residue' 4 C SME 56 C SME 56 ? MET 'modified residue' 5 C CSO 330 C CSO 330 ? CYS 'modified residue' # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA dimeric 2 2 author_and_software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,AA,BA,CA,DA,EA,FA,SA,TA 2 1,2 C,GA,HA,IA,JA,KA,LA,MA,NA,OA,PA,QA,RA,UA # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 11260 ? 1 MORE -103 ? 1 'SSA (A^2)' 24100 ? 2 'ABSA (A^2)' 10220 ? 2 MORE -110 ? 2 'SSA (A^2)' 24750 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_556 x,-y,-z+1 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 148.4890000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id C _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 797 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id UA _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-02-28 2 'Structure model' 1 1 2018-07-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 2 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.year' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.12_2829 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.5.32 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O C HOH 696 ? ? O C HOH 760 ? ? 1.98 2 1 OD1 A ASP 325 ? B O A HOH 502 ? ? 2.06 3 1 O A ALA 2 ? ? O A HOH 503 ? ? 2.11 4 1 NH1 B ARG 239 ? ? O B SER 242 ? B 2.16 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CD B GLU 77 ? ? OE2 B GLU 77 ? ? 1.167 1.252 -0.085 0.011 N 2 1 CD C GLU 77 ? ? OE2 C GLU 77 ? ? 1.181 1.252 -0.071 0.011 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE B ARG 310 ? ? CZ B ARG 310 ? ? NH1 B ARG 310 ? ? 125.82 120.30 5.52 0.50 N 2 1 NE B ARG 310 ? ? CZ B ARG 310 ? ? NH2 B ARG 310 ? ? 113.88 120.30 -6.42 0.50 N 3 1 CB C ASP 325 ? A CG C ASP 325 ? A OD1 C ASP 325 ? A 124.46 118.30 6.16 0.90 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 3 ? ? -99.14 -61.88 2 1 ASP A 216 ? ? -157.51 67.98 3 1 ALA A 244 ? ? -142.26 -53.11 4 1 ASP B 216 ? ? -162.10 70.62 5 1 ALA B 244 ? ? -135.01 -44.62 6 1 ASP C 216 ? ? -157.49 65.79 7 1 ALA C 244 ? ? -140.70 -56.48 8 1 LEU C 331 ? A -104.52 51.61 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 TYR B 110 ? ? 0.069 'SIDE CHAIN' 2 1 TYR C 110 ? ? 0.069 'SIDE CHAIN' # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? B HOH 827 ? 5.96 . 2 1 O ? C HOH 853 ? 5.94 . 3 1 O ? C HOH 854 ? 6.09 . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 93 ? CD ? A ARG 93 CD 2 1 Y 1 A ARG 93 ? NE ? A ARG 93 NE 3 1 Y 1 A ARG 93 ? CZ ? A ARG 93 CZ 4 1 Y 1 A ARG 93 ? NH1 ? A ARG 93 NH1 5 1 Y 1 A ARG 93 ? NH2 ? A ARG 93 NH2 6 1 Y 1 A ARG 99 ? CG ? A ARG 99 CG 7 1 Y 1 A ARG 99 ? CD ? A ARG 99 CD 8 1 Y 1 A ARG 99 ? NE ? A ARG 99 NE 9 1 Y 1 A ARG 99 ? CZ ? A ARG 99 CZ 10 1 Y 1 A ARG 99 ? NH1 ? A ARG 99 NH1 11 1 Y 1 A ARG 99 ? NH2 ? A ARG 99 NH2 12 1 Y 1 C ARG 99 ? CG ? C ARG 99 CG 13 1 Y 1 C ARG 99 ? CD ? C ARG 99 CD 14 1 Y 1 C ARG 99 ? NE ? C ARG 99 NE 15 1 Y 1 C ARG 99 ? CZ ? C ARG 99 CZ 16 1 Y 1 C ARG 99 ? NH1 ? C ARG 99 NH1 17 1 Y 1 C ARG 99 ? NH2 ? C ARG 99 NH2 # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id MET _pdbx_unobs_or_zero_occ_residues.auth_seq_id 1 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id MET _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Centre National de la Recherche Scientifique and the Agence Nationale de la Recherche' France 'ANR-Blanc Cynthiol 12-BSV6-0011' 1 VIB Belgium ? 2 'Vrije Universiteit Brussel' Belgium SPR34 3 'Research Foundation Flanders (FWO)' Belgium ? 4 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 4 NICOTINAMIDE-ADENINE-DINUCLEOTIDE NAD 5 'SULFATE ION' SO4 6 GLYCEROL GOL 7 'HYDROGEN PEROXIDE' PEO 8 'FORMIC ACID' FMT 9 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL TRS 10 2-ETHOXYETHANOL ETX 11 'ACETATE ION' ACT 12 1,2-ETHANEDIOL EDO 13 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _space_group.crystal_system orthorhombic _space_group.name_H-M_alt 'P 2 21 21' _space_group.IT_number 18 _space_group.name_Hall 'P 2 2ab (z,x,y)' _space_group.id 1 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x,-y,-z 3 -x,y+1/2,-z+1/2 4 -x,-y+1/2,z+1/2 #