data_5NZ2 # _entry.id 5NZ2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5NZ2 pdb_00005nz2 10.2210/pdb5nz2/pdb WWPDB D_1200004944 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-09-20 2 'Structure model' 1 1 2024-01-17 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5NZ2 _pdbx_database_status.recvd_initial_deposition_date 2017-05-12 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Alite, C.' 1 ? 'Humphrey, S.' 2 ? 'Donderis, J.' 3 ? 'Maiques, E.' 4 ? 'Ciges-Tomas, J.R.' 5 ? 'Penades, J.R.' 6 ? 'Marina, A.' 7 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Rep' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2045-2322 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 7 _citation.language ? _citation.page_first 11234 _citation.page_last 11234 _citation.title 'Dissecting the link between the enzymatic activity and the SaPI inducing capacity of the phage 80 alpha dUTPase.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41598-017-11234-9 _citation.pdbx_database_id_PubMed 28894239 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Alite, C.' 1 ? primary 'Humphrey, S.' 2 ? primary 'Donderis, J.' 3 ? primary 'Maiques, E.' 4 ? primary 'Ciges-Tomas, J.R.' 5 ? primary 'Penades, J.R.' 6 ? primary 'Marina, A.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man DUTPase 19128.695 1 ? D95E ? ;C-terminal not present in the strcutre although nucleotide is placed in the active center. Magnesium atom is not coordinated by E95. ; 2 non-polymer syn ;2'-DEOXYURIDINE 5'-ALPHA,BETA-IMIDO-TRIPHOSPHATE ; 467.157 1 ? ? ? ? 3 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 4 water nat water 18.015 21 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MTNTLQVKLLSKNARMPERNHKTDAGYDIFSAETVVLEPQEKAVIKTDVAVSIPEGYVGLLTSRSGVSSKTHLVIETGKI DAGYHGNLGINIKNEHEDDKMQTIFLRNIDNEKIFEKERHLYKLGSYRIEKGERIAQLVIVPIWTPELKQVEEFESVSER GEKGFGSSGV ; _entity_poly.pdbx_seq_one_letter_code_can ;MTNTLQVKLLSKNARMPERNHKTDAGYDIFSAETVVLEPQEKAVIKTDVAVSIPEGYVGLLTSRSGVSSKTHLVIETGKI DAGYHGNLGINIKNEHEDDKMQTIFLRNIDNEKIFEKERHLYKLGSYRIEKGERIAQLVIVPIWTPELKQVEEFESVSER GEKGFGSSGV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;2'-DEOXYURIDINE 5'-ALPHA,BETA-IMIDO-TRIPHOSPHATE ; DUP 3 'MAGNESIUM ION' MG 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 ASN n 1 4 THR n 1 5 LEU n 1 6 GLN n 1 7 VAL n 1 8 LYS n 1 9 LEU n 1 10 LEU n 1 11 SER n 1 12 LYS n 1 13 ASN n 1 14 ALA n 1 15 ARG n 1 16 MET n 1 17 PRO n 1 18 GLU n 1 19 ARG n 1 20 ASN n 1 21 HIS n 1 22 LYS n 1 23 THR n 1 24 ASP n 1 25 ALA n 1 26 GLY n 1 27 TYR n 1 28 ASP n 1 29 ILE n 1 30 PHE n 1 31 SER n 1 32 ALA n 1 33 GLU n 1 34 THR n 1 35 VAL n 1 36 VAL n 1 37 LEU n 1 38 GLU n 1 39 PRO n 1 40 GLN n 1 41 GLU n 1 42 LYS n 1 43 ALA n 1 44 VAL n 1 45 ILE n 1 46 LYS n 1 47 THR n 1 48 ASP n 1 49 VAL n 1 50 ALA n 1 51 VAL n 1 52 SER n 1 53 ILE n 1 54 PRO n 1 55 GLU n 1 56 GLY n 1 57 TYR n 1 58 VAL n 1 59 GLY n 1 60 LEU n 1 61 LEU n 1 62 THR n 1 63 SER n 1 64 ARG n 1 65 SER n 1 66 GLY n 1 67 VAL n 1 68 SER n 1 69 SER n 1 70 LYS n 1 71 THR n 1 72 HIS n 1 73 LEU n 1 74 VAL n 1 75 ILE n 1 76 GLU n 1 77 THR n 1 78 GLY n 1 79 LYS n 1 80 ILE n 1 81 ASP n 1 82 ALA n 1 83 GLY n 1 84 TYR n 1 85 HIS n 1 86 GLY n 1 87 ASN n 1 88 LEU n 1 89 GLY n 1 90 ILE n 1 91 ASN n 1 92 ILE n 1 93 LYS n 1 94 ASN n 1 95 GLU n 1 96 HIS n 1 97 GLU n 1 98 ASP n 1 99 ASP n 1 100 LYS n 1 101 MET n 1 102 GLN n 1 103 THR n 1 104 ILE n 1 105 PHE n 1 106 LEU n 1 107 ARG n 1 108 ASN n 1 109 ILE n 1 110 ASP n 1 111 ASN n 1 112 GLU n 1 113 LYS n 1 114 ILE n 1 115 PHE n 1 116 GLU n 1 117 LYS n 1 118 GLU n 1 119 ARG n 1 120 HIS n 1 121 LEU n 1 122 TYR n 1 123 LYS n 1 124 LEU n 1 125 GLY n 1 126 SER n 1 127 TYR n 1 128 ARG n 1 129 ILE n 1 130 GLU n 1 131 LYS n 1 132 GLY n 1 133 GLU n 1 134 ARG n 1 135 ILE n 1 136 ALA n 1 137 GLN n 1 138 LEU n 1 139 VAL n 1 140 ILE n 1 141 VAL n 1 142 PRO n 1 143 ILE n 1 144 TRP n 1 145 THR n 1 146 PRO n 1 147 GLU n 1 148 LEU n 1 149 LYS n 1 150 GLN n 1 151 VAL n 1 152 GLU n 1 153 GLU n 1 154 PHE n 1 155 GLU n 1 156 SER n 1 157 VAL n 1 158 SER n 1 159 GLU n 1 160 ARG n 1 161 GLY n 1 162 GLU n 1 163 LYS n 1 164 GLY n 1 165 PHE n 1 166 GLY n 1 167 SER n 1 168 SER n 1 169 GLY n 1 170 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 170 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Staphylococcus phage 80alpha' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 53369 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pet28a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 DUP non-polymer . ;2'-DEOXYURIDINE 5'-ALPHA,BETA-IMIDO-TRIPHOSPHATE ; ? 'C9 H16 N3 O13 P3' 467.157 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 GLN 6 6 6 GLN GLN A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 MET 16 16 16 MET MET A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 HIS 21 21 21 HIS HIS A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 GLN 40 40 40 GLN GLN A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 TYR 57 57 57 TYR TYR A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 HIS 72 72 72 HIS HIS A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 THR 77 77 77 THR THR A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 TYR 84 84 84 TYR TYR A . n A 1 85 HIS 85 85 85 HIS HIS A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 ASN 87 87 87 ASN ASN A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 ASN 91 91 91 ASN ASN A . n A 1 92 ILE 92 92 92 ILE ILE A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 ASN 94 94 94 ASN ASN A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 HIS 96 96 96 HIS HIS A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 MET 101 101 101 MET MET A . n A 1 102 GLN 102 102 102 GLN GLN A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 PHE 105 105 105 PHE PHE A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 ARG 107 107 107 ARG ARG A . n A 1 108 ASN 108 108 108 ASN ASN A . n A 1 109 ILE 109 109 109 ILE ILE A . n A 1 110 ASP 110 110 110 ASP ASP A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 ILE 114 114 114 ILE ILE A . n A 1 115 PHE 115 115 115 PHE PHE A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 ARG 119 119 119 ARG ARG A . n A 1 120 HIS 120 120 120 HIS HIS A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 TYR 122 122 122 TYR TYR A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 GLY 125 125 125 GLY GLY A . n A 1 126 SER 126 126 126 SER SER A . n A 1 127 TYR 127 127 127 TYR TYR A . n A 1 128 ARG 128 128 128 ARG ARG A . n A 1 129 ILE 129 129 129 ILE ILE A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 LYS 131 131 131 LYS LYS A . n A 1 132 GLY 132 132 132 GLY GLY A . n A 1 133 GLU 133 133 133 GLU GLU A . n A 1 134 ARG 134 134 134 ARG ARG A . n A 1 135 ILE 135 135 135 ILE ILE A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 GLN 137 137 137 GLN GLN A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 VAL 139 139 139 VAL VAL A . n A 1 140 ILE 140 140 140 ILE ILE A . n A 1 141 VAL 141 141 141 VAL VAL A . n A 1 142 PRO 142 142 142 PRO PRO A . n A 1 143 ILE 143 143 143 ILE ILE A . n A 1 144 TRP 144 144 144 TRP TRP A . n A 1 145 THR 145 145 145 THR THR A . n A 1 146 PRO 146 146 146 PRO PRO A . n A 1 147 GLU 147 147 147 GLU GLU A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 LYS 149 149 149 LYS LYS A . n A 1 150 GLN 150 150 150 GLN GLN A . n A 1 151 VAL 151 151 151 VAL VAL A . n A 1 152 GLU 152 152 152 GLU GLU A . n A 1 153 GLU 153 153 153 GLU GLU A . n A 1 154 PHE 154 154 154 PHE PHE A . n A 1 155 GLU 155 155 155 GLU GLU A . n A 1 156 SER 156 156 156 SER SER A . n A 1 157 VAL 157 157 ? ? ? A . n A 1 158 SER 158 158 ? ? ? A . n A 1 159 GLU 159 159 ? ? ? A . n A 1 160 ARG 160 160 ? ? ? A . n A 1 161 GLY 161 161 ? ? ? A . n A 1 162 GLU 162 162 ? ? ? A . n A 1 163 LYS 163 163 ? ? ? A . n A 1 164 GLY 164 164 ? ? ? A . n A 1 165 PHE 165 165 ? ? ? A . n A 1 166 GLY 166 166 ? ? ? A . n A 1 167 SER 167 167 ? ? ? A . n A 1 168 SER 168 168 ? ? ? A . n A 1 169 GLY 169 169 ? ? ? A . n A 1 170 VAL 170 170 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 DUP 1 201 1173 DUP DUP A . C 3 MG 1 202 1 MG MG A . D 4 HOH 1 301 14 HOH HOH A . D 4 HOH 2 302 3 HOH HOH A . D 4 HOH 3 303 20 HOH HOH A . D 4 HOH 4 304 7 HOH HOH A . D 4 HOH 5 305 9 HOH HOH A . D 4 HOH 6 306 2 HOH HOH A . D 4 HOH 7 307 1 HOH HOH A . D 4 HOH 8 308 21 HOH HOH A . D 4 HOH 9 309 10 HOH HOH A . D 4 HOH 10 310 5 HOH HOH A . D 4 HOH 11 311 12 HOH HOH A . D 4 HOH 12 312 4 HOH HOH A . D 4 HOH 13 313 8 HOH HOH A . D 4 HOH 14 314 11 HOH HOH A . D 4 HOH 15 315 15 HOH HOH A . D 4 HOH 16 316 6 HOH HOH A . D 4 HOH 17 317 19 HOH HOH A . D 4 HOH 18 318 13 HOH HOH A . D 4 HOH 19 319 18 HOH HOH A . D 4 HOH 20 320 16 HOH HOH A . D 4 HOH 21 321 17 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 22 ? CG ? A LYS 22 CG 2 1 Y 1 A LYS 22 ? CD ? A LYS 22 CD 3 1 Y 1 A LYS 22 ? CE ? A LYS 22 CE 4 1 Y 1 A LYS 22 ? NZ ? A LYS 22 NZ 5 1 Y 1 A THR 23 ? OG1 ? A THR 23 OG1 6 1 Y 1 A THR 23 ? CG2 ? A THR 23 CG2 7 1 Y 1 A GLU 55 ? CG ? A GLU 55 CG 8 1 Y 1 A GLU 55 ? CD ? A GLU 55 CD 9 1 Y 1 A GLU 55 ? OE1 ? A GLU 55 OE1 10 1 Y 1 A GLU 55 ? OE2 ? A GLU 55 OE2 11 1 Y 1 A LYS 117 ? CG ? A LYS 117 CG 12 1 Y 1 A LYS 117 ? CD ? A LYS 117 CD 13 1 Y 1 A LYS 117 ? CE ? A LYS 117 CE 14 1 Y 1 A LYS 117 ? NZ ? A LYS 117 NZ 15 1 Y 1 A GLU 118 ? CG ? A GLU 118 CG 16 1 Y 1 A GLU 118 ? CD ? A GLU 118 CD 17 1 Y 1 A GLU 118 ? OE1 ? A GLU 118 OE1 18 1 Y 1 A GLU 118 ? OE2 ? A GLU 118 OE2 19 1 Y 1 A ARG 119 ? CG ? A ARG 119 CG 20 1 Y 1 A ARG 119 ? CD ? A ARG 119 CD 21 1 Y 1 A ARG 119 ? NE ? A ARG 119 NE 22 1 Y 1 A ARG 119 ? CZ ? A ARG 119 CZ 23 1 Y 1 A ARG 119 ? NH1 ? A ARG 119 NH1 24 1 Y 1 A ARG 119 ? NH2 ? A ARG 119 NH2 25 1 Y 1 A LYS 131 ? CE ? A LYS 131 CE 26 1 Y 1 A LYS 131 ? NZ ? A LYS 131 NZ 27 1 Y 1 A GLU 147 ? CG ? A GLU 147 CG 28 1 Y 1 A GLU 147 ? CD ? A GLU 147 CD 29 1 Y 1 A GLU 147 ? OE1 ? A GLU 147 OE1 30 1 Y 1 A GLU 147 ? OE2 ? A GLU 147 OE2 31 1 Y 1 A LYS 149 ? CG ? A LYS 149 CG 32 1 Y 1 A LYS 149 ? CD ? A LYS 149 CD 33 1 Y 1 A LYS 149 ? CE ? A LYS 149 CE 34 1 Y 1 A LYS 149 ? NZ ? A LYS 149 NZ 35 1 Y 1 A GLU 155 ? CG ? A GLU 155 CG 36 1 Y 1 A GLU 155 ? CD ? A GLU 155 CD 37 1 Y 1 A GLU 155 ? OE1 ? A GLU 155 OE1 38 1 Y 1 A GLU 155 ? OE2 ? A GLU 155 OE2 39 1 Y 1 A SER 156 ? OG ? A SER 156 OG # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0135 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5NZ2 _cell.details ? _cell.formula_units_Z ? _cell.length_a 87.192 _cell.length_a_esd ? _cell.length_b 87.192 _cell.length_b_esd ? _cell.length_c 87.192 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5NZ2 _symmetry.cell_setting ? _symmetry.Int_Tables_number 198 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 3' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5NZ2 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.40 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 48.82 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.2 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 296 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '32% Etanol, 2% PEG 1000, 0.1M phosphate citrate pH 4.2' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-07-01 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97949 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97949 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5NZ2 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.85 _reflns.d_resolution_low 38.99 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 5130 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.1 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 2.2 _reflns.pdbx_Rmerge_I_obs 0.102 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 5.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.85 _reflns_shell.d_res_low 3.00 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 740 _reflns_shell.percent_possible_all 96.1 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.394 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 2.3 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 0.00 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 0.00 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] 0.00 _refine.B_iso_max ? _refine.B_iso_mean 56.224 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.914 _refine.correlation_coeff_Fo_to_Fc_free 0.869 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5NZ2 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.85 _refine.ls_d_res_low 38.99 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 4894 _refine.ls_number_reflns_R_free 235 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 95.62 _refine.ls_percent_reflns_R_free 4.6 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.23070 _refine.ls_R_factor_R_free 0.27753 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.22832 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3ZEZ _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.413 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 20.197 _refine.overall_SU_ML 0.367 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 1200 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 29 _refine_hist.number_atoms_solvent 21 _refine_hist.number_atoms_total 1250 _refine_hist.d_res_high 2.85 _refine_hist.d_res_low 38.99 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 0.019 1249 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 1194 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.040 1.986 1698 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.779 3.000 2745 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.642 5.000 154 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 32.436 25.000 54 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 14.500 15.000 215 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 21.198 15.000 6 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.062 0.200 196 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 0.020 1391 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 269 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 1.005 5.753 619 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 1.005 5.750 618 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 1.831 8.621 772 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 1.830 8.625 773 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 0.649 5.824 630 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 0.649 5.825 629 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 1.226 8.709 927 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 3.489 43.732 1251 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 3.375 43.750 1249 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.853 _refine_ls_shell.d_res_low 2.927 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 20 _refine_ls_shell.number_reflns_R_work 363 _refine_ls_shell.percent_reflns_obs 95.75 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.305 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.289 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5NZ2 _struct.title ;Twist and induce: Dissecting the link between the enzymatic activity and the SaPI inducing capacity of the phage 80 dUTPase. D95E mutant from dUTPase 80alpha phage. ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5NZ2 _struct_keywords.text 'dUTPase, 80 phage, S.aureus, hydrolase' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A4ZF98_9CAUD _struct_ref.pdbx_db_accession A4ZF98 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTNTLQVKLLSKNARMPERNHKTDAGYDIFSAETVVLEPQEKAVIKTDVAVSIPEGYVGLLTSRSGVSSKTHLVIETGKI DAGYHGNLGINIKNDHEDDKMQTIFLRNIDNEKIFEKERHLYKLGSYRIEKGERIAQLVIVPIWTPELKQVEEFESVSER GEKGFGSSGV ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5NZ2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 170 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A4ZF98 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 170 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 170 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 5NZ2 _struct_ref_seq_dif.mon_id GLU _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 95 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code A4ZF98 _struct_ref_seq_dif.db_mon_id ASP _struct_ref_seq_dif.pdbx_seq_db_seq_num 95 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 95 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 12290 ? 1 MORE -85 ? 1 'SSA (A^2)' 19730 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_555 -z+1/2,-x,y+1/2 0.0000000000 0.0000000000 -1.0000000000 43.5960000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 43.5960000000 3 'crystal symmetry operation' 10_545 -y,z-1/2,-x+1/2 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 -43.5960000000 -1.0000000000 0.0000000000 0.0000000000 43.5960000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id ARG _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 64 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id THR _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 71 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ARG _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 64 _struct_conf.end_auth_comp_id THR _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 71 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? B DUP . O2A ? ? ? 1_555 C MG . MG ? ? A DUP 201 A MG 202 1_555 ? ? ? ? ? ? ? 2.187 ? ? metalc2 metalc ? ? B DUP . O2B ? ? ? 1_555 C MG . MG ? ? A DUP 201 A MG 202 1_555 ? ? ? ? ? ? ? 2.502 ? ? metalc3 metalc ? ? B DUP . O1G ? ? ? 1_555 C MG . MG ? ? A DUP 201 A MG 202 1_555 ? ? ? ? ? ? ? 2.511 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O2A ? B DUP . ? A DUP 201 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O2B ? B DUP . ? A DUP 201 ? 1_555 68.9 ? 2 O2A ? B DUP . ? A DUP 201 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O1G ? B DUP . ? A DUP 201 ? 1_555 71.9 ? 3 O2B ? B DUP . ? A DUP 201 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O1G ? B DUP . ? A DUP 201 ? 1_555 61.6 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 4 ? AA3 ? 2 ? AA4 ? 3 ? AA5 ? 2 ? AA6 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA5 1 2 ? anti-parallel AA6 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLN A 6 ? LEU A 9 ? GLN A 6 LEU A 9 AA1 2 VAL A 49 ? SER A 52 ? VAL A 49 SER A 52 AA2 1 TYR A 27 ? PHE A 30 ? TYR A 27 PHE A 30 AA2 2 ARG A 134 ? PRO A 142 ? ARG A 134 PRO A 142 AA2 3 TYR A 57 ? SER A 63 ? TYR A 57 SER A 63 AA2 4 GLY A 78 ? ILE A 80 ? GLY A 78 ILE A 80 AA3 1 VAL A 35 ? LEU A 37 ? VAL A 35 LEU A 37 AA3 2 TYR A 127 ? ILE A 129 ? TYR A 127 ILE A 129 AA4 1 LYS A 42 ? LYS A 46 ? LYS A 42 LYS A 46 AA4 2 GLY A 89 ? ASN A 94 ? GLY A 89 ASN A 94 AA4 3 LEU A 73 ? ILE A 75 ? LEU A 73 ILE A 75 AA5 1 GLN A 102 ? THR A 103 ? GLN A 102 THR A 103 AA5 2 TYR A 122 ? LYS A 123 ? TYR A 122 LYS A 123 AA6 1 LEU A 106 ? ARG A 107 ? LEU A 106 ARG A 107 AA6 2 LYS A 113 ? ILE A 114 ? LYS A 113 ILE A 114 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LYS A 8 ? N LYS A 8 O ALA A 50 ? O ALA A 50 AA2 1 2 N TYR A 27 ? N TYR A 27 O LEU A 138 ? O LEU A 138 AA2 2 3 O GLN A 137 ? O GLN A 137 N THR A 62 ? N THR A 62 AA2 3 4 N LEU A 61 ? N LEU A 61 O GLY A 78 ? O GLY A 78 AA3 1 2 N VAL A 35 ? N VAL A 35 O ILE A 129 ? O ILE A 129 AA4 1 2 N ILE A 45 ? N ILE A 45 O ILE A 90 ? O ILE A 90 AA4 2 3 O LYS A 93 ? O LYS A 93 N VAL A 74 ? N VAL A 74 AA5 1 2 N THR A 103 ? N THR A 103 O TYR A 122 ? O TYR A 122 AA6 1 2 N LEU A 106 ? N LEU A 106 O ILE A 114 ? O ILE A 114 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A DUP 201 ? 11 'binding site for residue DUP A 201' AC2 Software A MG 202 ? 3 'binding site for residue MG A 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 11 ARG A 64 ? ARG A 64 . ? 7_555 ? 2 AC1 11 SER A 65 ? SER A 65 . ? 7_555 ? 3 AC1 11 GLY A 66 ? GLY A 66 . ? 7_555 ? 4 AC1 11 GLY A 78 ? GLY A 78 . ? 1_555 ? 5 AC1 11 LYS A 79 ? LYS A 79 . ? 1_555 ? 6 AC1 11 ASP A 81 ? ASP A 81 . ? 1_555 ? 7 AC1 11 TYR A 84 ? TYR A 84 . ? 1_555 ? 8 AC1 11 GLY A 89 ? GLY A 89 . ? 1_555 ? 9 AC1 11 GLN A 137 ? GLN A 137 . ? 7_555 ? 10 AC1 11 MG C . ? MG A 202 . ? 1_555 ? 11 AC1 11 HOH D . ? HOH A 307 . ? 1_555 ? 12 AC2 3 ASP A 28 ? ASP A 28 . ? 7_555 ? 13 AC2 3 GLN A 137 ? GLN A 137 . ? 7_555 ? 14 AC2 3 DUP B . ? DUP A 201 . ? 1_555 ? # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id GLU _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 155 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -91.38 _pdbx_validate_torsion.psi 58.03 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 313 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A VAL 157 ? A VAL 157 3 1 Y 1 A SER 158 ? A SER 158 4 1 Y 1 A GLU 159 ? A GLU 159 5 1 Y 1 A ARG 160 ? A ARG 160 6 1 Y 1 A GLY 161 ? A GLY 161 7 1 Y 1 A GLU 162 ? A GLU 162 8 1 Y 1 A LYS 163 ? A LYS 163 9 1 Y 1 A GLY 164 ? A GLY 164 10 1 Y 1 A PHE 165 ? A PHE 165 11 1 Y 1 A GLY 166 ? A GLY 166 12 1 Y 1 A SER 167 ? A SER 167 13 1 Y 1 A SER 168 ? A SER 168 14 1 Y 1 A GLY 169 ? A GLY 169 15 1 Y 1 A VAL 170 ? A VAL 170 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 DUP O4 O N N 74 DUP C4 C Y N 75 DUP C5 C Y N 76 DUP C6 C Y N 77 DUP N3 N Y N 78 DUP C2 C Y N 79 DUP O2 O N N 80 DUP N1 N Y N 81 DUP "C1'" C N R 82 DUP "C2'" C N N 83 DUP "C3'" C N S 84 DUP "O3'" O N N 85 DUP "O4'" O N N 86 DUP "C4'" C N R 87 DUP "C5'" C N N 88 DUP "O5'" O N N 89 DUP PA P N S 90 DUP O1A O N N 91 DUP O2A O N N 92 DUP N3A N N N 93 DUP PB P N R 94 DUP O1B O N N 95 DUP O2B O N N 96 DUP O3B O N N 97 DUP PG P N N 98 DUP O2G O N N 99 DUP O1G O N N 100 DUP O3G O N N 101 DUP H5 H N N 102 DUP H6 H N N 103 DUP HN3 H N N 104 DUP "H1'" H N N 105 DUP "H2'1" H N N 106 DUP "H2'2" H N N 107 DUP H1 H N N 108 DUP "H3'" H N N 109 DUP "H4'" H N N 110 DUP "H5'1" H N N 111 DUP "H5'2" H N N 112 DUP H2A H N N 113 DUP H3A H N N 114 DUP H2B H N N 115 DUP H1G H N N 116 DUP H3G H N N 117 GLN N N N N 118 GLN CA C N S 119 GLN C C N N 120 GLN O O N N 121 GLN CB C N N 122 GLN CG C N N 123 GLN CD C N N 124 GLN OE1 O N N 125 GLN NE2 N N N 126 GLN OXT O N N 127 GLN H H N N 128 GLN H2 H N N 129 GLN HA H N N 130 GLN HB2 H N N 131 GLN HB3 H N N 132 GLN HG2 H N N 133 GLN HG3 H N N 134 GLN HE21 H N N 135 GLN HE22 H N N 136 GLN HXT H N N 137 GLU N N N N 138 GLU CA C N S 139 GLU C C N N 140 GLU O O N N 141 GLU CB C N N 142 GLU CG C N N 143 GLU CD C N N 144 GLU OE1 O N N 145 GLU OE2 O N N 146 GLU OXT O N N 147 GLU H H N N 148 GLU H2 H N N 149 GLU HA H N N 150 GLU HB2 H N N 151 GLU HB3 H N N 152 GLU HG2 H N N 153 GLU HG3 H N N 154 GLU HE2 H N N 155 GLU HXT H N N 156 GLY N N N N 157 GLY CA C N N 158 GLY C C N N 159 GLY O O N N 160 GLY OXT O N N 161 GLY H H N N 162 GLY H2 H N N 163 GLY HA2 H N N 164 GLY HA3 H N N 165 GLY HXT H N N 166 HIS N N N N 167 HIS CA C N S 168 HIS C C N N 169 HIS O O N N 170 HIS CB C N N 171 HIS CG C Y N 172 HIS ND1 N Y N 173 HIS CD2 C Y N 174 HIS CE1 C Y N 175 HIS NE2 N Y N 176 HIS OXT O N N 177 HIS H H N N 178 HIS H2 H N N 179 HIS HA H N N 180 HIS HB2 H N N 181 HIS HB3 H N N 182 HIS HD1 H N N 183 HIS HD2 H N N 184 HIS HE1 H N N 185 HIS HE2 H N N 186 HIS HXT H N N 187 HOH O O N N 188 HOH H1 H N N 189 HOH H2 H N N 190 ILE N N N N 191 ILE CA C N S 192 ILE C C N N 193 ILE O O N N 194 ILE CB C N S 195 ILE CG1 C N N 196 ILE CG2 C N N 197 ILE CD1 C N N 198 ILE OXT O N N 199 ILE H H N N 200 ILE H2 H N N 201 ILE HA H N N 202 ILE HB H N N 203 ILE HG12 H N N 204 ILE HG13 H N N 205 ILE HG21 H N N 206 ILE HG22 H N N 207 ILE HG23 H N N 208 ILE HD11 H N N 209 ILE HD12 H N N 210 ILE HD13 H N N 211 ILE HXT H N N 212 LEU N N N N 213 LEU CA C N S 214 LEU C C N N 215 LEU O O N N 216 LEU CB C N N 217 LEU CG C N N 218 LEU CD1 C N N 219 LEU CD2 C N N 220 LEU OXT O N N 221 LEU H H N N 222 LEU H2 H N N 223 LEU HA H N N 224 LEU HB2 H N N 225 LEU HB3 H N N 226 LEU HG H N N 227 LEU HD11 H N N 228 LEU HD12 H N N 229 LEU HD13 H N N 230 LEU HD21 H N N 231 LEU HD22 H N N 232 LEU HD23 H N N 233 LEU HXT H N N 234 LYS N N N N 235 LYS CA C N S 236 LYS C C N N 237 LYS O O N N 238 LYS CB C N N 239 LYS CG C N N 240 LYS CD C N N 241 LYS CE C N N 242 LYS NZ N N N 243 LYS OXT O N N 244 LYS H H N N 245 LYS H2 H N N 246 LYS HA H N N 247 LYS HB2 H N N 248 LYS HB3 H N N 249 LYS HG2 H N N 250 LYS HG3 H N N 251 LYS HD2 H N N 252 LYS HD3 H N N 253 LYS HE2 H N N 254 LYS HE3 H N N 255 LYS HZ1 H N N 256 LYS HZ2 H N N 257 LYS HZ3 H N N 258 LYS HXT H N N 259 MET N N N N 260 MET CA C N S 261 MET C C N N 262 MET O O N N 263 MET CB C N N 264 MET CG C N N 265 MET SD S N N 266 MET CE C N N 267 MET OXT O N N 268 MET H H N N 269 MET H2 H N N 270 MET HA H N N 271 MET HB2 H N N 272 MET HB3 H N N 273 MET HG2 H N N 274 MET HG3 H N N 275 MET HE1 H N N 276 MET HE2 H N N 277 MET HE3 H N N 278 MET HXT H N N 279 MG MG MG N N 280 PHE N N N N 281 PHE CA C N S 282 PHE C C N N 283 PHE O O N N 284 PHE CB C N N 285 PHE CG C Y N 286 PHE CD1 C Y N 287 PHE CD2 C Y N 288 PHE CE1 C Y N 289 PHE CE2 C Y N 290 PHE CZ C Y N 291 PHE OXT O N N 292 PHE H H N N 293 PHE H2 H N N 294 PHE HA H N N 295 PHE HB2 H N N 296 PHE HB3 H N N 297 PHE HD1 H N N 298 PHE HD2 H N N 299 PHE HE1 H N N 300 PHE HE2 H N N 301 PHE HZ H N N 302 PHE HXT H N N 303 PRO N N N N 304 PRO CA C N S 305 PRO C C N N 306 PRO O O N N 307 PRO CB C N N 308 PRO CG C N N 309 PRO CD C N N 310 PRO OXT O N N 311 PRO H H N N 312 PRO HA H N N 313 PRO HB2 H N N 314 PRO HB3 H N N 315 PRO HG2 H N N 316 PRO HG3 H N N 317 PRO HD2 H N N 318 PRO HD3 H N N 319 PRO HXT H N N 320 SER N N N N 321 SER CA C N S 322 SER C C N N 323 SER O O N N 324 SER CB C N N 325 SER OG O N N 326 SER OXT O N N 327 SER H H N N 328 SER H2 H N N 329 SER HA H N N 330 SER HB2 H N N 331 SER HB3 H N N 332 SER HG H N N 333 SER HXT H N N 334 THR N N N N 335 THR CA C N S 336 THR C C N N 337 THR O O N N 338 THR CB C N R 339 THR OG1 O N N 340 THR CG2 C N N 341 THR OXT O N N 342 THR H H N N 343 THR H2 H N N 344 THR HA H N N 345 THR HB H N N 346 THR HG1 H N N 347 THR HG21 H N N 348 THR HG22 H N N 349 THR HG23 H N N 350 THR HXT H N N 351 TRP N N N N 352 TRP CA C N S 353 TRP C C N N 354 TRP O O N N 355 TRP CB C N N 356 TRP CG C Y N 357 TRP CD1 C Y N 358 TRP CD2 C Y N 359 TRP NE1 N Y N 360 TRP CE2 C Y N 361 TRP CE3 C Y N 362 TRP CZ2 C Y N 363 TRP CZ3 C Y N 364 TRP CH2 C Y N 365 TRP OXT O N N 366 TRP H H N N 367 TRP H2 H N N 368 TRP HA H N N 369 TRP HB2 H N N 370 TRP HB3 H N N 371 TRP HD1 H N N 372 TRP HE1 H N N 373 TRP HE3 H N N 374 TRP HZ2 H N N 375 TRP HZ3 H N N 376 TRP HH2 H N N 377 TRP HXT H N N 378 TYR N N N N 379 TYR CA C N S 380 TYR C C N N 381 TYR O O N N 382 TYR CB C N N 383 TYR CG C Y N 384 TYR CD1 C Y N 385 TYR CD2 C Y N 386 TYR CE1 C Y N 387 TYR CE2 C Y N 388 TYR CZ C Y N 389 TYR OH O N N 390 TYR OXT O N N 391 TYR H H N N 392 TYR H2 H N N 393 TYR HA H N N 394 TYR HB2 H N N 395 TYR HB3 H N N 396 TYR HD1 H N N 397 TYR HD2 H N N 398 TYR HE1 H N N 399 TYR HE2 H N N 400 TYR HH H N N 401 TYR HXT H N N 402 VAL N N N N 403 VAL CA C N S 404 VAL C C N N 405 VAL O O N N 406 VAL CB C N N 407 VAL CG1 C N N 408 VAL CG2 C N N 409 VAL OXT O N N 410 VAL H H N N 411 VAL H2 H N N 412 VAL HA H N N 413 VAL HB H N N 414 VAL HG11 H N N 415 VAL HG12 H N N 416 VAL HG13 H N N 417 VAL HG21 H N N 418 VAL HG22 H N N 419 VAL HG23 H N N 420 VAL HXT H N N 421 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 DUP O4 C4 doub N N 70 DUP C4 C5 sing Y N 71 DUP C4 N3 sing Y N 72 DUP C5 C6 doub Y N 73 DUP C5 H5 sing N N 74 DUP C6 N1 sing Y N 75 DUP C6 H6 sing N N 76 DUP N3 C2 sing Y N 77 DUP N3 HN3 sing N N 78 DUP C2 O2 doub N N 79 DUP C2 N1 sing Y N 80 DUP N1 "C1'" sing N N 81 DUP "C1'" "C2'" sing N N 82 DUP "C1'" "O4'" sing N N 83 DUP "C1'" "H1'" sing N N 84 DUP "C2'" "C3'" sing N N 85 DUP "C2'" "H2'1" sing N N 86 DUP "C2'" "H2'2" sing N N 87 DUP "C3'" "O3'" sing N N 88 DUP "C3'" "C4'" sing N N 89 DUP "C3'" H1 sing N N 90 DUP "O3'" "H3'" sing N N 91 DUP "O4'" "C4'" sing N N 92 DUP "C4'" "C5'" sing N N 93 DUP "C4'" "H4'" sing N N 94 DUP "C5'" "O5'" sing N N 95 DUP "C5'" "H5'1" sing N N 96 DUP "C5'" "H5'2" sing N N 97 DUP "O5'" PA sing N N 98 DUP PA O1A doub N N 99 DUP PA O2A sing N N 100 DUP PA N3A sing N N 101 DUP O2A H2A sing N N 102 DUP N3A PB sing N N 103 DUP N3A H3A sing N N 104 DUP PB O1B doub N N 105 DUP PB O2B sing N N 106 DUP PB O3B sing N N 107 DUP O2B H2B sing N N 108 DUP O3B PG sing N N 109 DUP PG O2G doub N N 110 DUP PG O1G sing N N 111 DUP PG O3G sing N N 112 DUP O1G H1G sing N N 113 DUP O3G H3G sing N N 114 GLN N CA sing N N 115 GLN N H sing N N 116 GLN N H2 sing N N 117 GLN CA C sing N N 118 GLN CA CB sing N N 119 GLN CA HA sing N N 120 GLN C O doub N N 121 GLN C OXT sing N N 122 GLN CB CG sing N N 123 GLN CB HB2 sing N N 124 GLN CB HB3 sing N N 125 GLN CG CD sing N N 126 GLN CG HG2 sing N N 127 GLN CG HG3 sing N N 128 GLN CD OE1 doub N N 129 GLN CD NE2 sing N N 130 GLN NE2 HE21 sing N N 131 GLN NE2 HE22 sing N N 132 GLN OXT HXT sing N N 133 GLU N CA sing N N 134 GLU N H sing N N 135 GLU N H2 sing N N 136 GLU CA C sing N N 137 GLU CA CB sing N N 138 GLU CA HA sing N N 139 GLU C O doub N N 140 GLU C OXT sing N N 141 GLU CB CG sing N N 142 GLU CB HB2 sing N N 143 GLU CB HB3 sing N N 144 GLU CG CD sing N N 145 GLU CG HG2 sing N N 146 GLU CG HG3 sing N N 147 GLU CD OE1 doub N N 148 GLU CD OE2 sing N N 149 GLU OE2 HE2 sing N N 150 GLU OXT HXT sing N N 151 GLY N CA sing N N 152 GLY N H sing N N 153 GLY N H2 sing N N 154 GLY CA C sing N N 155 GLY CA HA2 sing N N 156 GLY CA HA3 sing N N 157 GLY C O doub N N 158 GLY C OXT sing N N 159 GLY OXT HXT sing N N 160 HIS N CA sing N N 161 HIS N H sing N N 162 HIS N H2 sing N N 163 HIS CA C sing N N 164 HIS CA CB sing N N 165 HIS CA HA sing N N 166 HIS C O doub N N 167 HIS C OXT sing N N 168 HIS CB CG sing N N 169 HIS CB HB2 sing N N 170 HIS CB HB3 sing N N 171 HIS CG ND1 sing Y N 172 HIS CG CD2 doub Y N 173 HIS ND1 CE1 doub Y N 174 HIS ND1 HD1 sing N N 175 HIS CD2 NE2 sing Y N 176 HIS CD2 HD2 sing N N 177 HIS CE1 NE2 sing Y N 178 HIS CE1 HE1 sing N N 179 HIS NE2 HE2 sing N N 180 HIS OXT HXT sing N N 181 HOH O H1 sing N N 182 HOH O H2 sing N N 183 ILE N CA sing N N 184 ILE N H sing N N 185 ILE N H2 sing N N 186 ILE CA C sing N N 187 ILE CA CB sing N N 188 ILE CA HA sing N N 189 ILE C O doub N N 190 ILE C OXT sing N N 191 ILE CB CG1 sing N N 192 ILE CB CG2 sing N N 193 ILE CB HB sing N N 194 ILE CG1 CD1 sing N N 195 ILE CG1 HG12 sing N N 196 ILE CG1 HG13 sing N N 197 ILE CG2 HG21 sing N N 198 ILE CG2 HG22 sing N N 199 ILE CG2 HG23 sing N N 200 ILE CD1 HD11 sing N N 201 ILE CD1 HD12 sing N N 202 ILE CD1 HD13 sing N N 203 ILE OXT HXT sing N N 204 LEU N CA sing N N 205 LEU N H sing N N 206 LEU N H2 sing N N 207 LEU CA C sing N N 208 LEU CA CB sing N N 209 LEU CA HA sing N N 210 LEU C O doub N N 211 LEU C OXT sing N N 212 LEU CB CG sing N N 213 LEU CB HB2 sing N N 214 LEU CB HB3 sing N N 215 LEU CG CD1 sing N N 216 LEU CG CD2 sing N N 217 LEU CG HG sing N N 218 LEU CD1 HD11 sing N N 219 LEU CD1 HD12 sing N N 220 LEU CD1 HD13 sing N N 221 LEU CD2 HD21 sing N N 222 LEU CD2 HD22 sing N N 223 LEU CD2 HD23 sing N N 224 LEU OXT HXT sing N N 225 LYS N CA sing N N 226 LYS N H sing N N 227 LYS N H2 sing N N 228 LYS CA C sing N N 229 LYS CA CB sing N N 230 LYS CA HA sing N N 231 LYS C O doub N N 232 LYS C OXT sing N N 233 LYS CB CG sing N N 234 LYS CB HB2 sing N N 235 LYS CB HB3 sing N N 236 LYS CG CD sing N N 237 LYS CG HG2 sing N N 238 LYS CG HG3 sing N N 239 LYS CD CE sing N N 240 LYS CD HD2 sing N N 241 LYS CD HD3 sing N N 242 LYS CE NZ sing N N 243 LYS CE HE2 sing N N 244 LYS CE HE3 sing N N 245 LYS NZ HZ1 sing N N 246 LYS NZ HZ2 sing N N 247 LYS NZ HZ3 sing N N 248 LYS OXT HXT sing N N 249 MET N CA sing N N 250 MET N H sing N N 251 MET N H2 sing N N 252 MET CA C sing N N 253 MET CA CB sing N N 254 MET CA HA sing N N 255 MET C O doub N N 256 MET C OXT sing N N 257 MET CB CG sing N N 258 MET CB HB2 sing N N 259 MET CB HB3 sing N N 260 MET CG SD sing N N 261 MET CG HG2 sing N N 262 MET CG HG3 sing N N 263 MET SD CE sing N N 264 MET CE HE1 sing N N 265 MET CE HE2 sing N N 266 MET CE HE3 sing N N 267 MET OXT HXT sing N N 268 PHE N CA sing N N 269 PHE N H sing N N 270 PHE N H2 sing N N 271 PHE CA C sing N N 272 PHE CA CB sing N N 273 PHE CA HA sing N N 274 PHE C O doub N N 275 PHE C OXT sing N N 276 PHE CB CG sing N N 277 PHE CB HB2 sing N N 278 PHE CB HB3 sing N N 279 PHE CG CD1 doub Y N 280 PHE CG CD2 sing Y N 281 PHE CD1 CE1 sing Y N 282 PHE CD1 HD1 sing N N 283 PHE CD2 CE2 doub Y N 284 PHE CD2 HD2 sing N N 285 PHE CE1 CZ doub Y N 286 PHE CE1 HE1 sing N N 287 PHE CE2 CZ sing Y N 288 PHE CE2 HE2 sing N N 289 PHE CZ HZ sing N N 290 PHE OXT HXT sing N N 291 PRO N CA sing N N 292 PRO N CD sing N N 293 PRO N H sing N N 294 PRO CA C sing N N 295 PRO CA CB sing N N 296 PRO CA HA sing N N 297 PRO C O doub N N 298 PRO C OXT sing N N 299 PRO CB CG sing N N 300 PRO CB HB2 sing N N 301 PRO CB HB3 sing N N 302 PRO CG CD sing N N 303 PRO CG HG2 sing N N 304 PRO CG HG3 sing N N 305 PRO CD HD2 sing N N 306 PRO CD HD3 sing N N 307 PRO OXT HXT sing N N 308 SER N CA sing N N 309 SER N H sing N N 310 SER N H2 sing N N 311 SER CA C sing N N 312 SER CA CB sing N N 313 SER CA HA sing N N 314 SER C O doub N N 315 SER C OXT sing N N 316 SER CB OG sing N N 317 SER CB HB2 sing N N 318 SER CB HB3 sing N N 319 SER OG HG sing N N 320 SER OXT HXT sing N N 321 THR N CA sing N N 322 THR N H sing N N 323 THR N H2 sing N N 324 THR CA C sing N N 325 THR CA CB sing N N 326 THR CA HA sing N N 327 THR C O doub N N 328 THR C OXT sing N N 329 THR CB OG1 sing N N 330 THR CB CG2 sing N N 331 THR CB HB sing N N 332 THR OG1 HG1 sing N N 333 THR CG2 HG21 sing N N 334 THR CG2 HG22 sing N N 335 THR CG2 HG23 sing N N 336 THR OXT HXT sing N N 337 TRP N CA sing N N 338 TRP N H sing N N 339 TRP N H2 sing N N 340 TRP CA C sing N N 341 TRP CA CB sing N N 342 TRP CA HA sing N N 343 TRP C O doub N N 344 TRP C OXT sing N N 345 TRP CB CG sing N N 346 TRP CB HB2 sing N N 347 TRP CB HB3 sing N N 348 TRP CG CD1 doub Y N 349 TRP CG CD2 sing Y N 350 TRP CD1 NE1 sing Y N 351 TRP CD1 HD1 sing N N 352 TRP CD2 CE2 doub Y N 353 TRP CD2 CE3 sing Y N 354 TRP NE1 CE2 sing Y N 355 TRP NE1 HE1 sing N N 356 TRP CE2 CZ2 sing Y N 357 TRP CE3 CZ3 doub Y N 358 TRP CE3 HE3 sing N N 359 TRP CZ2 CH2 doub Y N 360 TRP CZ2 HZ2 sing N N 361 TRP CZ3 CH2 sing Y N 362 TRP CZ3 HZ3 sing N N 363 TRP CH2 HH2 sing N N 364 TRP OXT HXT sing N N 365 TYR N CA sing N N 366 TYR N H sing N N 367 TYR N H2 sing N N 368 TYR CA C sing N N 369 TYR CA CB sing N N 370 TYR CA HA sing N N 371 TYR C O doub N N 372 TYR C OXT sing N N 373 TYR CB CG sing N N 374 TYR CB HB2 sing N N 375 TYR CB HB3 sing N N 376 TYR CG CD1 doub Y N 377 TYR CG CD2 sing Y N 378 TYR CD1 CE1 sing Y N 379 TYR CD1 HD1 sing N N 380 TYR CD2 CE2 doub Y N 381 TYR CD2 HD2 sing N N 382 TYR CE1 CZ doub Y N 383 TYR CE1 HE1 sing N N 384 TYR CE2 CZ sing Y N 385 TYR CE2 HE2 sing N N 386 TYR CZ OH sing N N 387 TYR OH HH sing N N 388 TYR OXT HXT sing N N 389 VAL N CA sing N N 390 VAL N H sing N N 391 VAL N H2 sing N N 392 VAL CA C sing N N 393 VAL CA CB sing N N 394 VAL CA HA sing N N 395 VAL C O doub N N 396 VAL C OXT sing N N 397 VAL CB CG1 sing N N 398 VAL CB CG2 sing N N 399 VAL CB HB sing N N 400 VAL CG1 HG11 sing N N 401 VAL CG1 HG12 sing N N 402 VAL CG1 HG13 sing N N 403 VAL CG2 HG21 sing N N 404 VAL CG2 HG22 sing N N 405 VAL CG2 HG23 sing N N 406 VAL OXT HXT sing N N 407 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Spanish Ministry of Economy and Competitiveness' Spain BES2014-068617 1 'Spanish Ministry of Economy and Competitiveness' Spain BIO2013-42619-P 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3ZEZ _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 5NZ2 _atom_sites.fract_transf_matrix[1][1] 0.011469 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011469 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011469 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C MG N O P S # loop_