data_5ONJ # _entry.id 5ONJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5ONJ pdb_00005onj 10.2210/pdb5onj/pdb WWPDB D_1200006084 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-08-29 2 'Structure model' 1 1 2019-03-20 3 'Structure model' 1 2 2019-10-16 4 'Structure model' 1 3 2024-01-17 5 'Structure model' 1 4 2024-11-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' 'Derived calculations' 7 4 'Structure model' 'Refinement description' 8 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp 2 2 'Structure model' citation 3 2 'Structure model' citation_author 4 2 'Structure model' pdbx_contact_author 5 2 'Structure model' pdbx_database_proc 6 3 'Structure model' chem_comp 7 3 'Structure model' reflns_shell 8 4 'Structure model' chem_comp_atom 9 4 'Structure model' chem_comp_bond 10 4 'Structure model' database_2 11 4 'Structure model' pdbx_initial_refinement_model 12 4 'Structure model' struct_conn 13 4 'Structure model' struct_conn_type 14 5 'Structure model' pdbx_entry_details 15 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_chem_comp.type' 2 2 'Structure model' '_citation.country' 3 2 'Structure model' '_citation.journal_abbrev' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 2 'Structure model' '_citation_author.identifier_ORCID' 14 2 'Structure model' '_citation_author.name' 15 3 'Structure model' '_chem_comp.type' 16 4 'Structure model' '_database_2.pdbx_DOI' 17 4 'Structure model' '_database_2.pdbx_database_accession' 18 4 'Structure model' '_struct_conn.conn_type_id' 19 4 'Structure model' '_struct_conn.id' 20 4 'Structure model' '_struct_conn.pdbx_dist_value' 21 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 22 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 23 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 24 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 25 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 26 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 27 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 28 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 29 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 30 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 31 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 32 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 33 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 34 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 35 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 36 4 'Structure model' '_struct_conn_type.id' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5ONJ _pdbx_database_status.recvd_initial_deposition_date 2017-08-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Ramaswamy, S.' 1 ? 'Rasheed, M.' 2 ? 'Morelli, C.' 3 ? 'Calvio, C.' 4 ? 'Sutton, B.' 5 ? 'Pastore, A.' 6 ? # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.unpublished_flag ? ? ? ? ? ? ? UK ? ? primary 'Febs J.' ? ? 1742-464X ? ? 285 ? 4575 4589 'The structure of PghL hydrolase bound to its substrate poly-gamma-glutamate.' 2018 ? 10.1111/febs.14688 30387270 ? ? ? ? ? ? ? ? ? ? ? 1 'To Be Published' ? 0353 ? ? ? ? ? ? ? 'Poly-gamma-glutamate hydrolases structure: a potential strategy against Staphylococcus infectivity' ? ? ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ramaswamy, S.' 1 ? primary 'Rasheed, M.' 2 ? primary 'Morelli, C.F.' 3 ? primary 'Calvio, C.' 4 0000-0003-1631-0452 primary 'Sutton, B.J.' 5 0000-0002-4363-7568 primary 'Pastore, A.' 6 0000-0002-3047-654X 1 'Ramaswamy, S.' 7 ? 1 'Rasheed, M.' 8 ? 1 'Morelli, C.' 9 ? 1 'Calvio, C.' 10 ? 1 'Sutton, B.' 11 ? 1 'Pastore, A.' 12 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man YndL 23985.703 1 ? ? ? ? 2 polymer syn '(2R,3S,4R,5R,6R)-6-((1R,2R,3S,4R,6S)-4,6-DIAMINO-2,3-DIHYDROXYCYCLOHEXYLOXY)-5-AMINO-2-(AMINOMETHYL)-TETRAHYDRO-2H-PYRAN-3,4-DIOL' 792.698 1 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 4 water nat water 18.015 228 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;SSIYAEDVYQNFEELKNNEDPSDYGVVTKETGSPVLVLAIHGGGIEGGTSEVARELSKEYSMYLFEGLKSAGNSVLHITS THFDEPRALKMTGNHEYVISLHGYAEEDQQIEVGGTDRVRAADLVEKLQHAGFPAVLLNMDHPHAGVSPNNIANKSKTGL SIQIEMSTGFRKSLFGIFSLKSRAVTQNERFYEFTEVMFRFLKNSYLEHHHHHH ; ;SSIYAEDVYQNFEELKNNEDPSDYGVVTKETGSPVLVLAIHGGGIEGGTSEVARELSKEYSMYLFEGLKSAGNSVLHITS THFDEPRALKMTGNHEYVISLHGYAEEDQQIEVGGTDRVRAADLVEKLQHAGFPAVLLNMDHPHAGVSPNNIANKSKTGL SIQIEMSTGFRKSLFGIFSLKSRAVTQNERFYEFTEVMFRFLKNSYLEHHHHHH ; A ? 2 'polypeptide(L)' no yes 'E(GGL)(GGL)(GGL)(GGL)(GGL)' EEEEEE D ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'ZINC ION' ZN 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 SER n 1 3 ILE n 1 4 TYR n 1 5 ALA n 1 6 GLU n 1 7 ASP n 1 8 VAL n 1 9 TYR n 1 10 GLN n 1 11 ASN n 1 12 PHE n 1 13 GLU n 1 14 GLU n 1 15 LEU n 1 16 LYS n 1 17 ASN n 1 18 ASN n 1 19 GLU n 1 20 ASP n 1 21 PRO n 1 22 SER n 1 23 ASP n 1 24 TYR n 1 25 GLY n 1 26 VAL n 1 27 VAL n 1 28 THR n 1 29 LYS n 1 30 GLU n 1 31 THR n 1 32 GLY n 1 33 SER n 1 34 PRO n 1 35 VAL n 1 36 LEU n 1 37 VAL n 1 38 LEU n 1 39 ALA n 1 40 ILE n 1 41 HIS n 1 42 GLY n 1 43 GLY n 1 44 GLY n 1 45 ILE n 1 46 GLU n 1 47 GLY n 1 48 GLY n 1 49 THR n 1 50 SER n 1 51 GLU n 1 52 VAL n 1 53 ALA n 1 54 ARG n 1 55 GLU n 1 56 LEU n 1 57 SER n 1 58 LYS n 1 59 GLU n 1 60 TYR n 1 61 SER n 1 62 MET n 1 63 TYR n 1 64 LEU n 1 65 PHE n 1 66 GLU n 1 67 GLY n 1 68 LEU n 1 69 LYS n 1 70 SER n 1 71 ALA n 1 72 GLY n 1 73 ASN n 1 74 SER n 1 75 VAL n 1 76 LEU n 1 77 HIS n 1 78 ILE n 1 79 THR n 1 80 SER n 1 81 THR n 1 82 HIS n 1 83 PHE n 1 84 ASP n 1 85 GLU n 1 86 PRO n 1 87 ARG n 1 88 ALA n 1 89 LEU n 1 90 LYS n 1 91 MET n 1 92 THR n 1 93 GLY n 1 94 ASN n 1 95 HIS n 1 96 GLU n 1 97 TYR n 1 98 VAL n 1 99 ILE n 1 100 SER n 1 101 LEU n 1 102 HIS n 1 103 GLY n 1 104 TYR n 1 105 ALA n 1 106 GLU n 1 107 GLU n 1 108 ASP n 1 109 GLN n 1 110 GLN n 1 111 ILE n 1 112 GLU n 1 113 VAL n 1 114 GLY n 1 115 GLY n 1 116 THR n 1 117 ASP n 1 118 ARG n 1 119 VAL n 1 120 ARG n 1 121 ALA n 1 122 ALA n 1 123 ASP n 1 124 LEU n 1 125 VAL n 1 126 GLU n 1 127 LYS n 1 128 LEU n 1 129 GLN n 1 130 HIS n 1 131 ALA n 1 132 GLY n 1 133 PHE n 1 134 PRO n 1 135 ALA n 1 136 VAL n 1 137 LEU n 1 138 LEU n 1 139 ASN n 1 140 MET n 1 141 ASP n 1 142 HIS n 1 143 PRO n 1 144 HIS n 1 145 ALA n 1 146 GLY n 1 147 VAL n 1 148 SER n 1 149 PRO n 1 150 ASN n 1 151 ASN n 1 152 ILE n 1 153 ALA n 1 154 ASN n 1 155 LYS n 1 156 SER n 1 157 LYS n 1 158 THR n 1 159 GLY n 1 160 LEU n 1 161 SER n 1 162 ILE n 1 163 GLN n 1 164 ILE n 1 165 GLU n 1 166 MET n 1 167 SER n 1 168 THR n 1 169 GLY n 1 170 PHE n 1 171 ARG n 1 172 LYS n 1 173 SER n 1 174 LEU n 1 175 PHE n 1 176 GLY n 1 177 ILE n 1 178 PHE n 1 179 SER n 1 180 LEU n 1 181 LYS n 1 182 SER n 1 183 ARG n 1 184 ALA n 1 185 VAL n 1 186 THR n 1 187 GLN n 1 188 ASN n 1 189 GLU n 1 190 ARG n 1 191 PHE n 1 192 TYR n 1 193 GLU n 1 194 PHE n 1 195 THR n 1 196 GLU n 1 197 VAL n 1 198 MET n 1 199 PHE n 1 200 ARG n 1 201 PHE n 1 202 LEU n 1 203 LYS n 1 204 ASN n 1 205 SER n 1 206 TYR n 1 207 LEU n 1 208 GLU n 1 209 HIS n 1 210 HIS n 1 211 HIS n 1 212 HIS n 1 213 HIS n 1 214 HIS n 2 1 GLU n 2 2 GGL n 2 3 GGL n 2 4 GGL n 2 5 GGL n 2 6 GGL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 214 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene B4417_0239 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus subtilis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1423 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 6 _pdbx_entity_src_syn.organism_scientific 'synthetic construct' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 32630 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GGL 'L-gamma-peptide, C-delta linking' . 'GAMMA-L-GLUTAMIC ACID' 'L-GLUTAMIC ACID' 'C5 H9 N O4' 147.129 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 ILE 3 3 ? ? ? A . n A 1 4 TYR 4 4 ? ? ? A . n A 1 5 ALA 5 5 ? ? ? A . n A 1 6 GLU 6 6 6 GLU ALA A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 HIS 41 41 41 HIS HIS A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 TYR 60 60 60 TYR TYR A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 MET 62 62 62 MET MET A . n A 1 63 TYR 63 63 63 TYR TYR A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 HIS 77 77 77 HIS HIS A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 HIS 82 82 82 HIS HIS A . n A 1 83 PHE 83 83 83 PHE PHE A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 PRO 86 86 86 PRO PRO A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 MET 91 91 91 MET MET A . n A 1 92 THR 92 92 92 THR THR A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 ASN 94 94 94 ASN ASN A . n A 1 95 HIS 95 95 95 HIS HIS A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 TYR 97 97 97 TYR TYR A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 HIS 102 102 102 HIS HIS A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 TYR 104 104 104 TYR TYR A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 ASP 108 108 108 ASP ASP A . n A 1 109 GLN 109 109 109 GLN GLN A . n A 1 110 GLN 110 110 110 GLN GLN A . n A 1 111 ILE 111 111 111 ILE ILE A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 VAL 113 113 113 VAL VAL A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 GLY 115 115 115 GLY GLY A . n A 1 116 THR 116 116 116 THR THR A . n A 1 117 ASP 117 117 117 ASP ASP A . n A 1 118 ARG 118 118 118 ARG ARG A . n A 1 119 VAL 119 119 119 VAL VAL A . n A 1 120 ARG 120 120 120 ARG ARG A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 ASP 123 123 123 ASP ASP A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 VAL 125 125 125 VAL VAL A . n A 1 126 GLU 126 126 126 GLU GLU A . n A 1 127 LYS 127 127 127 LYS LYS A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 GLN 129 129 129 GLN GLN A . n A 1 130 HIS 130 130 130 HIS HIS A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 GLY 132 132 132 GLY GLY A . n A 1 133 PHE 133 133 133 PHE PHE A . n A 1 134 PRO 134 134 134 PRO PRO A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 ASN 139 139 139 ASN ASN A . n A 1 140 MET 140 140 140 MET MET A . n A 1 141 ASP 141 141 141 ASP ASP A . n A 1 142 HIS 142 142 142 HIS HIS A . n A 1 143 PRO 143 143 143 PRO PRO A . n A 1 144 HIS 144 144 144 HIS HIS A . n A 1 145 ALA 145 145 145 ALA ALA A . n A 1 146 GLY 146 146 146 GLY GLY A . n A 1 147 VAL 147 147 147 VAL VAL A . n A 1 148 SER 148 148 148 SER SER A . n A 1 149 PRO 149 149 149 PRO PRO A . n A 1 150 ASN 150 150 150 ASN ASN A . n A 1 151 ASN 151 151 151 ASN ASN A . n A 1 152 ILE 152 152 152 ILE ILE A . n A 1 153 ALA 153 153 153 ALA ALA A . n A 1 154 ASN 154 154 154 ASN ASN A . n A 1 155 LYS 155 155 155 LYS LYS A . n A 1 156 SER 156 156 156 SER SER A . n A 1 157 LYS 157 157 157 LYS LYS A . n A 1 158 THR 158 158 158 THR THR A . n A 1 159 GLY 159 159 159 GLY GLY A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 SER 161 161 161 SER SER A . n A 1 162 ILE 162 162 162 ILE ILE A . n A 1 163 GLN 163 163 163 GLN GLN A . n A 1 164 ILE 164 164 164 ILE ILE A . n A 1 165 GLU 165 165 165 GLU GLU A . n A 1 166 MET 166 166 166 MET MET A . n A 1 167 SER 167 167 167 SER SER A . n A 1 168 THR 168 168 168 THR THR A . n A 1 169 GLY 169 169 169 GLY GLY A . n A 1 170 PHE 170 170 170 PHE PHE A . n A 1 171 ARG 171 171 171 ARG ARG A . n A 1 172 LYS 172 172 172 LYS LYS A . n A 1 173 SER 173 173 173 SER SER A . n A 1 174 LEU 174 174 174 LEU LEU A . n A 1 175 PHE 175 175 175 PHE PHE A . n A 1 176 GLY 176 176 176 GLY GLY A . n A 1 177 ILE 177 177 177 ILE ILE A . n A 1 178 PHE 178 178 178 PHE PHE A . n A 1 179 SER 179 179 179 SER SER A . n A 1 180 LEU 180 180 180 LEU LEU A . n A 1 181 LYS 181 181 181 LYS LYS A . n A 1 182 SER 182 182 182 SER SER A . n A 1 183 ARG 183 183 183 ARG ARG A . n A 1 184 ALA 184 184 184 ALA ALA A . n A 1 185 VAL 185 185 185 VAL VAL A . n A 1 186 THR 186 186 186 THR THR A . n A 1 187 GLN 187 187 187 GLN GLN A . n A 1 188 ASN 188 188 188 ASN ASN A . n A 1 189 GLU 189 189 189 GLU GLU A . n A 1 190 ARG 190 190 190 ARG ARG A . n A 1 191 PHE 191 191 191 PHE PHE A . n A 1 192 TYR 192 192 192 TYR TYR A . n A 1 193 GLU 193 193 193 GLU GLU A . n A 1 194 PHE 194 194 194 PHE PHE A . n A 1 195 THR 195 195 195 THR THR A . n A 1 196 GLU 196 196 196 GLU GLU A . n A 1 197 VAL 197 197 197 VAL VAL A . n A 1 198 MET 198 198 198 MET MET A . n A 1 199 PHE 199 199 199 PHE PHE A . n A 1 200 ARG 200 200 200 ARG ARG A . n A 1 201 PHE 201 201 201 PHE PHE A . n A 1 202 LEU 202 202 202 LEU LEU A . n A 1 203 LYS 203 203 203 LYS LYS A . n A 1 204 ASN 204 204 204 ASN ASN A . n A 1 205 SER 205 205 205 SER SER A . n A 1 206 TYR 206 206 206 TYR TYR A . n A 1 207 LEU 207 207 207 LEU LEU A . n A 1 208 GLU 208 208 ? ? ? A . n A 1 209 HIS 209 209 ? ? ? A . n A 1 210 HIS 210 210 ? ? ? A . n A 1 211 HIS 211 211 ? ? ? A . n A 1 212 HIS 212 212 ? ? ? A . n A 1 213 HIS 213 213 ? ? ? A . n A 1 214 HIS 214 214 ? ? ? A . n B 2 1 GLU 1 1 1 GLU XXX D . n B 2 2 GGL 2 2 1 GGL XXX D . n B 2 3 GGL 3 3 1 GGL XXX D . n B 2 4 GGL 4 4 1 GGL XXX D . n B 2 5 GGL 5 5 1 GGL XXX D . n B 2 6 GGL 6 6 1 GGL XXX D . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 ZN 1 301 1 ZN ZN A . D 4 HOH 1 401 220 HOH HOH A . D 4 HOH 2 402 176 HOH HOH A . D 4 HOH 3 403 139 HOH HOH A . D 4 HOH 4 404 129 HOH HOH A . D 4 HOH 5 405 197 HOH HOH A . D 4 HOH 6 406 97 HOH HOH A . D 4 HOH 7 407 173 HOH HOH A . D 4 HOH 8 408 170 HOH HOH A . D 4 HOH 9 409 53 HOH HOH A . D 4 HOH 10 410 238 HOH HOH A . D 4 HOH 11 411 126 HOH HOH A . D 4 HOH 12 412 51 HOH HOH A . D 4 HOH 13 413 134 HOH HOH A . D 4 HOH 14 414 8 HOH HOH A . D 4 HOH 15 415 177 HOH HOH A . D 4 HOH 16 416 212 HOH HOH A . D 4 HOH 17 417 233 HOH HOH A . D 4 HOH 18 418 89 HOH HOH A . D 4 HOH 19 419 112 HOH HOH A . D 4 HOH 20 420 101 HOH HOH A . D 4 HOH 21 421 98 HOH HOH A . D 4 HOH 22 422 199 HOH HOH A . D 4 HOH 23 423 136 HOH HOH A . D 4 HOH 24 424 200 HOH HOH A . D 4 HOH 25 425 196 HOH HOH A . D 4 HOH 26 426 2 HOH HOH A . D 4 HOH 27 427 237 HOH HOH A . D 4 HOH 28 428 81 HOH HOH A . D 4 HOH 29 429 151 HOH HOH A . D 4 HOH 30 430 116 HOH HOH A . D 4 HOH 31 431 35 HOH HOH A . D 4 HOH 32 432 110 HOH HOH A . D 4 HOH 33 433 47 HOH HOH A . D 4 HOH 34 434 91 HOH HOH A . D 4 HOH 35 435 218 HOH HOH A . D 4 HOH 36 436 11 HOH HOH A . D 4 HOH 37 437 37 HOH HOH A . D 4 HOH 38 438 103 HOH HOH A . D 4 HOH 39 439 66 HOH HOH A . D 4 HOH 40 440 85 HOH HOH A . D 4 HOH 41 441 83 HOH HOH A . D 4 HOH 42 442 146 HOH HOH A . D 4 HOH 43 443 118 HOH HOH A . D 4 HOH 44 444 31 HOH HOH A . D 4 HOH 45 445 108 HOH HOH A . D 4 HOH 46 446 82 HOH HOH A . D 4 HOH 47 447 3 HOH HOH A . D 4 HOH 48 448 92 HOH HOH A . D 4 HOH 49 449 57 HOH HOH A . D 4 HOH 50 450 106 HOH HOH A . D 4 HOH 51 451 87 HOH HOH A . D 4 HOH 52 452 59 HOH HOH A . D 4 HOH 53 453 244 HOH HOH A . D 4 HOH 54 454 178 HOH HOH A . D 4 HOH 55 455 241 HOH HOH A . D 4 HOH 56 456 154 HOH HOH A . D 4 HOH 57 457 77 HOH HOH A . D 4 HOH 58 458 189 HOH HOH A . D 4 HOH 59 459 61 HOH HOH A . D 4 HOH 60 460 65 HOH HOH A . D 4 HOH 61 461 12 HOH HOH A . D 4 HOH 62 462 74 HOH HOH A . D 4 HOH 63 463 122 HOH HOH A . D 4 HOH 64 464 16 HOH HOH A . D 4 HOH 65 465 79 HOH HOH A . D 4 HOH 66 466 20 HOH HOH A . D 4 HOH 67 467 221 HOH HOH A . D 4 HOH 68 468 88 HOH HOH A . D 4 HOH 69 469 115 HOH HOH A . D 4 HOH 70 470 248 HOH HOH A . D 4 HOH 71 471 104 HOH HOH A . D 4 HOH 72 472 128 HOH HOH A . D 4 HOH 73 473 188 HOH HOH A . D 4 HOH 74 474 34 HOH HOH A . D 4 HOH 75 475 26 HOH HOH A . D 4 HOH 76 476 10 HOH HOH A . D 4 HOH 77 477 32 HOH HOH A . D 4 HOH 78 478 63 HOH HOH A . D 4 HOH 79 479 19 HOH HOH A . D 4 HOH 80 480 164 HOH HOH A . D 4 HOH 81 481 123 HOH HOH A . D 4 HOH 82 482 5 HOH HOH A . D 4 HOH 83 483 119 HOH HOH A . D 4 HOH 84 484 1 HOH HOH A . D 4 HOH 85 485 67 HOH HOH A . D 4 HOH 86 486 56 HOH HOH A . D 4 HOH 87 487 96 HOH HOH A . D 4 HOH 88 488 38 HOH HOH A . D 4 HOH 89 489 43 HOH HOH A . D 4 HOH 90 490 73 HOH HOH A . D 4 HOH 91 491 52 HOH HOH A . D 4 HOH 92 492 224 HOH HOH A . D 4 HOH 93 493 4 HOH HOH A . D 4 HOH 94 494 69 HOH HOH A . D 4 HOH 95 495 23 HOH HOH A . D 4 HOH 96 496 29 HOH HOH A . D 4 HOH 97 497 250 HOH HOH A . D 4 HOH 98 498 94 HOH HOH A . D 4 HOH 99 499 28 HOH HOH A . D 4 HOH 100 500 105 HOH HOH A . D 4 HOH 101 501 30 HOH HOH A . D 4 HOH 102 502 186 HOH HOH A . D 4 HOH 103 503 125 HOH HOH A . D 4 HOH 104 504 190 HOH HOH A . D 4 HOH 105 505 33 HOH HOH A . D 4 HOH 106 506 22 HOH HOH A . D 4 HOH 107 507 231 HOH HOH A . D 4 HOH 108 508 141 HOH HOH A . D 4 HOH 109 509 21 HOH HOH A . D 4 HOH 110 510 138 HOH HOH A . D 4 HOH 111 511 9 HOH HOH A . D 4 HOH 112 512 132 HOH HOH A . D 4 HOH 113 513 36 HOH HOH A . D 4 HOH 114 514 46 HOH HOH A . D 4 HOH 115 515 39 HOH HOH A . D 4 HOH 116 516 171 HOH HOH A . D 4 HOH 117 517 114 HOH HOH A . D 4 HOH 118 518 107 HOH HOH A . D 4 HOH 119 519 135 HOH HOH A . D 4 HOH 120 520 223 HOH HOH A . D 4 HOH 121 521 40 HOH HOH A . D 4 HOH 122 522 152 HOH HOH A . D 4 HOH 123 523 93 HOH HOH A . D 4 HOH 124 524 72 HOH HOH A . D 4 HOH 125 525 45 HOH HOH A . D 4 HOH 126 526 90 HOH HOH A . D 4 HOH 127 527 100 HOH HOH A . D 4 HOH 128 528 75 HOH HOH A . D 4 HOH 129 529 71 HOH HOH A . D 4 HOH 130 530 68 HOH HOH A . D 4 HOH 131 531 195 HOH HOH A . D 4 HOH 132 532 148 HOH HOH A . D 4 HOH 133 533 249 HOH HOH A . D 4 HOH 134 534 198 HOH HOH A . D 4 HOH 135 535 240 HOH HOH A . D 4 HOH 136 536 95 HOH HOH A . D 4 HOH 137 537 222 HOH HOH A . D 4 HOH 138 538 140 HOH HOH A . D 4 HOH 139 539 113 HOH HOH A . D 4 HOH 140 540 55 HOH HOH A . D 4 HOH 141 541 121 HOH HOH A . D 4 HOH 142 542 80 HOH HOH A . D 4 HOH 143 543 137 HOH HOH A . D 4 HOH 144 544 179 HOH HOH A . D 4 HOH 145 545 166 HOH HOH A . D 4 HOH 146 546 183 HOH HOH A . D 4 HOH 147 547 181 HOH HOH A . D 4 HOH 148 548 149 HOH HOH A . D 4 HOH 149 549 174 HOH HOH A . D 4 HOH 150 550 84 HOH HOH A . D 4 HOH 151 551 187 HOH HOH A . D 4 HOH 152 552 58 HOH HOH A . D 4 HOH 153 553 70 HOH HOH A . D 4 HOH 154 554 165 HOH HOH A . D 4 HOH 155 555 145 HOH HOH A . D 4 HOH 156 556 142 HOH HOH A . D 4 HOH 157 557 239 HOH HOH A . D 4 HOH 158 558 217 HOH HOH A . D 4 HOH 159 559 230 HOH HOH A . D 4 HOH 160 560 247 HOH HOH A . D 4 HOH 161 561 211 HOH HOH A . D 4 HOH 162 562 49 HOH HOH A . D 4 HOH 163 563 202 HOH HOH A . D 4 HOH 164 564 163 HOH HOH A . D 4 HOH 165 565 243 HOH HOH A . D 4 HOH 166 566 205 HOH HOH A . D 4 HOH 167 567 175 HOH HOH A . D 4 HOH 168 568 228 HOH HOH A . D 4 HOH 169 569 48 HOH HOH A . D 4 HOH 170 570 109 HOH HOH A . D 4 HOH 171 571 184 HOH HOH A . D 4 HOH 172 572 102 HOH HOH A . D 4 HOH 173 573 172 HOH HOH A . D 4 HOH 174 574 127 HOH HOH A . D 4 HOH 175 575 191 HOH HOH A . D 4 HOH 176 576 242 HOH HOH A . D 4 HOH 177 577 236 HOH HOH A . D 4 HOH 178 578 227 HOH HOH A . D 4 HOH 179 579 208 HOH HOH A . D 4 HOH 180 580 144 HOH HOH A . D 4 HOH 181 581 215 HOH HOH A . D 4 HOH 182 582 194 HOH HOH A . D 4 HOH 183 583 225 HOH HOH A . D 4 HOH 184 584 143 HOH HOH A . D 4 HOH 185 585 124 HOH HOH A . D 4 HOH 186 586 27 HOH HOH A . D 4 HOH 187 587 162 HOH HOH A . D 4 HOH 188 588 50 HOH HOH A . D 4 HOH 189 589 86 HOH HOH A . D 4 HOH 190 590 246 HOH HOH A . D 4 HOH 191 591 133 HOH HOH A . D 4 HOH 192 592 182 HOH HOH A . D 4 HOH 193 593 213 HOH HOH A . D 4 HOH 194 594 234 HOH HOH A . D 4 HOH 195 595 155 HOH HOH A . D 4 HOH 196 596 210 HOH HOH A . D 4 HOH 197 597 207 HOH HOH A . D 4 HOH 198 598 206 HOH HOH A . D 4 HOH 199 599 214 HOH HOH A . D 4 HOH 200 600 111 HOH HOH A . D 4 HOH 201 601 153 HOH HOH A . D 4 HOH 202 602 209 HOH HOH A . D 4 HOH 203 603 226 HOH HOH A . D 4 HOH 204 604 216 HOH HOH A . D 4 HOH 205 605 160 HOH HOH A . D 4 HOH 206 606 120 HOH HOH A . D 4 HOH 207 607 204 HOH HOH A . D 4 HOH 208 608 201 HOH HOH A . D 4 HOH 209 609 99 HOH HOH A . D 4 HOH 210 610 251 HOH HOH A . D 4 HOH 211 611 180 HOH HOH A . D 4 HOH 212 612 131 HOH HOH A . D 4 HOH 213 613 167 HOH HOH A . D 4 HOH 214 614 245 HOH HOH A . D 4 HOH 215 615 203 HOH HOH A . D 4 HOH 216 616 192 HOH HOH A . D 4 HOH 217 617 147 HOH HOH A . D 4 HOH 218 618 232 HOH HOH A . D 4 HOH 219 619 219 HOH HOH A . D 4 HOH 220 620 185 HOH HOH A . E 4 HOH 1 101 42 HOH HOH D . E 4 HOH 2 102 168 HOH HOH D . E 4 HOH 3 103 150 HOH HOH D . E 4 HOH 4 104 252 HOH HOH D . E 4 HOH 5 105 229 HOH HOH D . E 4 HOH 6 106 76 HOH HOH D . E 4 HOH 7 107 255 HOH HOH D . E 4 HOH 8 108 254 HOH HOH D . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 6 ? CG ? A GLU 6 CG 2 1 Y 1 A GLU 6 ? CD ? A GLU 6 CD 3 1 Y 1 A GLU 6 ? OE1 ? A GLU 6 OE1 4 1 Y 1 A GLU 6 ? OE2 ? A GLU 6 OE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.10.1_2155: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5ONJ _cell.details ? _cell.formula_units_Z ? _cell.length_a 38.592 _cell.length_a_esd ? _cell.length_b 47.651 _cell.length_b_esd ? _cell.length_c 99.328 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5ONJ _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5ONJ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.86 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 33.94 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1M Sodium Acetate, 5% gamma-PGA, 20% PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-07-10 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I03' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.00000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I03 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate 14.34 _reflns.entry_id 5ONJ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.7 _reflns.d_resolution_low 15.75 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 20613 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 1.9 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 24.58 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5ONJ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.700 _refine.ls_d_res_low 15.75 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 20609 _refine.ls_number_reflns_R_free 1087 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.05 _refine.ls_percent_reflns_R_free 5.27 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1690 _refine.ls_R_factor_R_free 0.2035 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1670 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3A9L _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 20.28 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.17 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1581 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 56 _refine_hist.number_atoms_solvent 228 _refine_hist.number_atoms_total 1865 _refine_hist.d_res_high 1.700 _refine_hist.d_res_low 15.75 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 ? 1709 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.784 ? 2311 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 16.416 ? 1029 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.060 ? 248 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 310 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.7000 1.7773 . . 112 2322 96.00 . . . 0.2452 . 0.1815 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7773 1.8709 . . 142 2354 98.00 . . . 0.2355 . 0.1855 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8709 1.9880 . . 141 2399 99.00 . . . 0.2637 . 0.1857 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9880 2.1412 . . 139 2429 100.00 . . . 0.1871 . 0.1647 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1412 2.3562 . . 135 2445 100.00 . . . 0.1978 . 0.1691 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3562 2.6961 . . 133 2471 100.00 . . . 0.2013 . 0.1656 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6961 3.3925 . . 145 2494 100.00 . . . 0.2106 . 0.1723 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.3925 17.2904 . . 140 2608 100.00 . . . 0.1758 . 0.1524 . . . . . . . . . . # _struct.entry_id 5ONJ _struct.title 'YnDL in Complex with 5 amino acid (PGA) complex' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5ONJ _struct_keywords.text 'PGA-HYDROLASE, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP A0A164XNU3_BACIU A0A164XNU3 ? 1 ;SSIYAEDVYQNFEELKNNEDPSDYGVVTKETGSPVLVLAIHGGGIEGGTSEVARELSKEYSMYLFEGLKSAGNSVLHITS THFDEPRALKMTGNHEYVISLHGYAEEDQQIEVGGTDRVRAADLVEKLQHAGFPAVLLNMDHPHAGVSPNNIANKSKTGL SIQIEMSTGFRKSLFGIFSLKSRAVTQNERFYEFTEVMFRFLKNSY ; 47 2 PDB 5ONJ 5ONJ ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5ONJ A 1 ? 206 ? A0A164XNU3 47 ? 252 ? 1 206 2 2 5ONJ D 1 ? 6 ? 5ONJ 1 ? 6 ? 1 6 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5ONJ LEU A 207 ? UNP A0A164XNU3 ? ? 'expression tag' 207 1 1 5ONJ GLU A 208 ? UNP A0A164XNU3 ? ? 'expression tag' 208 2 1 5ONJ HIS A 209 ? UNP A0A164XNU3 ? ? 'expression tag' 209 3 1 5ONJ HIS A 210 ? UNP A0A164XNU3 ? ? 'expression tag' 210 4 1 5ONJ HIS A 211 ? UNP A0A164XNU3 ? ? 'expression tag' 211 5 1 5ONJ HIS A 212 ? UNP A0A164XNU3 ? ? 'expression tag' 212 6 1 5ONJ HIS A 213 ? UNP A0A164XNU3 ? ? 'expression tag' 213 7 1 5ONJ HIS A 214 ? UNP A0A164XNU3 ? ? 'expression tag' 214 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1390 ? 1 MORE -39 ? 1 'SSA (A^2)' 8950 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 11 ? GLU A 19 ? ASN A 11 GLU A 19 1 ? 9 HELX_P HELX_P2 AA2 ASP A 20 ? SER A 22 ? ASP A 20 SER A 22 5 ? 3 HELX_P HELX_P3 AA3 GLY A 48 ? SER A 57 ? GLY A 48 SER A 57 1 ? 10 HELX_P HELX_P4 AA4 GLY A 72 ? HIS A 77 ? GLY A 72 HIS A 77 5 ? 6 HELX_P HELX_P5 AA5 THR A 79 ? PHE A 83 ? THR A 79 PHE A 83 5 ? 5 HELX_P HELX_P6 AA6 GLU A 85 ? ASN A 94 ? GLU A 85 ASN A 94 1 ? 10 HELX_P HELX_P7 AA7 ASP A 117 ? ALA A 131 ? ASP A 117 ALA A 131 1 ? 15 HELX_P HELX_P8 AA8 ASN A 151 ? LYS A 155 ? ASN A 151 LYS A 155 5 ? 5 HELX_P HELX_P9 AA9 THR A 168 ? SER A 173 ? THR A 168 SER A 173 1 ? 6 HELX_P HELX_P10 AB1 ARG A 183 ? GLN A 187 ? ARG A 183 GLN A 187 5 ? 5 HELX_P HELX_P11 AB2 ASN A 188 ? TYR A 206 ? ASN A 188 TYR A 206 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale one ? B GLU 1 CD ? ? ? 1_555 B GGL 2 N ? ? D GLU 1 D GGL 2 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale2 covale both ? B GGL 2 CD ? ? ? 1_555 B GGL 3 N ? ? D GGL 2 D GGL 3 1_555 ? ? ? ? ? ? ? 1.336 ? ? covale3 covale both ? B GGL 3 CD ? ? ? 1_555 B GGL 4 N ? ? D GGL 3 D GGL 4 1_555 ? ? ? ? ? ? ? 1.339 ? ? covale4 covale both ? B GGL 4 CD ? ? ? 1_555 B GGL 5 N ? ? D GGL 4 D GGL 5 1_555 ? ? ? ? ? ? ? 1.347 ? ? covale5 covale both ? B GGL 5 CD ? ? ? 1_555 B GGL 6 N ? ? D GGL 5 D GGL 6 1_555 ? ? ? ? ? ? ? 1.339 ? ? metalc1 metalc ? ? A HIS 41 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 41 A ZN 301 1_555 ? ? ? ? ? ? ? 1.972 ? ? metalc2 metalc ? ? A GLU 46 OE1 ? ? ? 1_555 C ZN . ZN ? ? A GLU 46 A ZN 301 1_555 ? ? ? ? ? ? ? 2.028 ? ? metalc3 metalc ? ? A GLU 46 OE2 ? ? ? 1_555 C ZN . ZN ? ? A GLU 46 A ZN 301 1_555 ? ? ? ? ? ? ? 2.604 ? ? metalc4 metalc ? ? A HIS 102 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 102 A ZN 301 1_555 ? ? ? ? ? ? ? 2.152 ? ? metalc5 metalc ? ? C ZN . ZN ? ? ? 1_555 B GGL 4 OE1 ? ? A ZN 301 D GGL 4 1_555 ? ? ? ? ? ? ? 2.109 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 ? A HIS 41 ? A HIS 41 ? 1_555 ZN ? C ZN . ? A ZN 301 ? 1_555 OE1 ? A GLU 46 ? A GLU 46 ? 1_555 113.8 ? 2 ND1 ? A HIS 41 ? A HIS 41 ? 1_555 ZN ? C ZN . ? A ZN 301 ? 1_555 OE2 ? A GLU 46 ? A GLU 46 ? 1_555 89.5 ? 3 OE1 ? A GLU 46 ? A GLU 46 ? 1_555 ZN ? C ZN . ? A ZN 301 ? 1_555 OE2 ? A GLU 46 ? A GLU 46 ? 1_555 55.0 ? 4 ND1 ? A HIS 41 ? A HIS 41 ? 1_555 ZN ? C ZN . ? A ZN 301 ? 1_555 ND1 ? A HIS 102 ? A HIS 102 ? 1_555 96.2 ? 5 OE1 ? A GLU 46 ? A GLU 46 ? 1_555 ZN ? C ZN . ? A ZN 301 ? 1_555 ND1 ? A HIS 102 ? A HIS 102 ? 1_555 117.4 ? 6 OE2 ? A GLU 46 ? A GLU 46 ? 1_555 ZN ? C ZN . ? A ZN 301 ? 1_555 ND1 ? A HIS 102 ? A HIS 102 ? 1_555 172.1 ? 7 ND1 ? A HIS 41 ? A HIS 41 ? 1_555 ZN ? C ZN . ? A ZN 301 ? 1_555 OE1 ? B GGL 4 ? D GGL 4 ? 1_555 100.3 ? 8 OE1 ? A GLU 46 ? A GLU 46 ? 1_555 ZN ? C ZN . ? A ZN 301 ? 1_555 OE1 ? B GGL 4 ? D GGL 4 ? 1_555 121.0 ? 9 OE2 ? A GLU 46 ? A GLU 46 ? 1_555 ZN ? C ZN . ? A ZN 301 ? 1_555 OE1 ? B GGL 4 ? D GGL 4 ? 1_555 80.2 ? 10 ND1 ? A HIS 102 ? A HIS 102 ? 1_555 ZN ? C ZN . ? A ZN 301 ? 1_555 OE1 ? B GGL 4 ? D GGL 4 ? 1_555 104.1 ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 GGL B 2 ? . . . . GGL D 2 ? 1_555 . . . . . . . ? 1 GGL None 'Non-standard residue' 2 GGL B 3 ? . . . . GGL D 3 ? 1_555 . . . . . . . ? 1 GGL None 'Non-standard residue' 3 GGL B 4 ? . . . . GGL D 4 ? 1_555 . . . . . . . ? 1 GGL None 'Non-standard residue' 4 GGL B 5 ? . . . . GGL D 5 ? 1_555 . . . . . . . ? 1 GGL None 'Non-standard residue' 5 GGL B 6 ? . . . . GGL D 6 ? 1_555 . . . . . . . ? 1 GGL None 'Non-standard residue' 6 GLU B 1 ? GGL B 2 ? GLU D 1 ? 1_555 GGL D 2 ? 1_555 CD N . . . None 'Isopeptide bond' 7 GGL B 2 ? GGL B 3 ? GGL D 2 ? 1_555 GGL D 3 ? 1_555 CD N . . . None 'Non-standard linkage' 8 GGL B 3 ? GGL B 4 ? GGL D 3 ? 1_555 GGL D 4 ? 1_555 CD N . . . None 'Non-standard linkage' 9 GGL B 4 ? GGL B 5 ? GGL D 4 ? 1_555 GGL D 5 ? 1_555 CD N . . . None 'Non-standard linkage' 10 GGL B 5 ? GGL B 6 ? GGL D 5 ? 1_555 GGL D 6 ? 1_555 CD N . . . None 'Non-standard linkage' # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? anti-parallel AA1 6 7 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 24 ? LYS A 29 ? TYR A 24 LYS A 29 AA1 2 SER A 61 ? GLY A 67 ? SER A 61 GLY A 67 AA1 3 VAL A 35 ? GLY A 43 ? VAL A 35 GLY A 43 AA1 4 TYR A 97 ? TYR A 104 ? TYR A 97 TYR A 104 AA1 5 LEU A 160 ? SER A 167 ? LEU A 160 SER A 167 AA1 6 ILE A 111 ? GLY A 114 ? ILE A 111 GLY A 114 AA1 7 ALA A 135 ? LEU A 137 ? ALA A 135 LEU A 137 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 27 ? N VAL A 27 O LEU A 64 ? O LEU A 64 AA1 2 3 O SER A 61 ? O SER A 61 N VAL A 37 ? N VAL A 37 AA1 3 4 N LEU A 38 ? N LEU A 38 O ILE A 99 ? O ILE A 99 AA1 4 5 N SER A 100 ? N SER A 100 O ILE A 162 ? O ILE A 162 AA1 5 6 O GLU A 165 ? O GLU A 165 N GLU A 112 ? N GLU A 112 AA1 6 7 N VAL A 113 ? N VAL A 113 O VAL A 136 ? O VAL A 136 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 301 ? 4 'binding site for residue ZN A 301' AC2 Software D GGL 2 ? 18 'binding site for residues GGL D 2 and GGL D 3' AC3 Software D GGL 3 ? 16 'binding site for residues GGL D 3 and GGL D 4' AC4 Software D GGL 4 ? 20 'binding site for residues GGL D 4 and GGL D 5' AC5 Software D GGL 5 ? 19 'binding site for residues GGL D 5 and GGL D 6' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 HIS A 41 ? HIS A 41 . ? 1_555 ? 2 AC1 4 GLU A 46 ? GLU A 46 . ? 1_555 ? 3 AC1 4 HIS A 102 ? HIS A 102 . ? 1_555 ? 4 AC1 4 GGL B 4 ? GGL D 4 . ? 1_555 ? 5 AC2 18 GLY A 44 ? GLY A 44 . ? 1_555 ? 6 AC2 18 ILE A 45 ? ILE A 45 . ? 1_555 ? 7 AC2 18 GLU A 46 ? GLU A 46 . ? 1_555 ? 8 AC2 18 GLY A 47 ? GLY A 47 . ? 1_555 ? 9 AC2 18 GLY A 72 ? GLY A 72 . ? 1_555 ? 10 AC2 18 ASN A 73 ? ASN A 73 . ? 1_555 ? 11 AC2 18 SER A 74 ? SER A 74 . ? 1_555 ? 12 AC2 18 GLY A 103 ? GLY A 103 . ? 1_555 ? 13 AC2 18 TYR A 104 ? TYR A 104 . ? 1_555 ? 14 AC2 18 THR A 168 ? THR A 168 . ? 1_555 ? 15 AC2 18 ARG A 171 ? ARG A 171 . ? 1_555 ? 16 AC2 18 LYS A 181 ? LYS A 181 . ? 3_555 ? 17 AC2 18 VAL A 185 ? VAL A 185 . ? 3_555 ? 18 AC2 18 GLU B 1 ? GLU D 1 . ? 1_555 ? 19 AC2 18 GGL B 4 ? GGL D 4 . ? 1_555 ? 20 AC2 18 HOH E . ? HOH D 102 . ? 1_555 ? 21 AC2 18 HOH E . ? HOH D 106 . ? 1_555 ? 22 AC2 18 HOH E . ? HOH D 107 . ? 1_555 ? 23 AC3 16 HIS A 41 ? HIS A 41 . ? 1_555 ? 24 AC3 16 ILE A 45 ? ILE A 45 . ? 1_555 ? 25 AC3 16 GLU A 46 ? GLU A 46 . ? 1_555 ? 26 AC3 16 GLY A 47 ? GLY A 47 . ? 1_555 ? 27 AC3 16 HIS A 77 ? HIS A 77 . ? 1_555 ? 28 AC3 16 HIS A 102 ? HIS A 102 . ? 1_555 ? 29 AC3 16 GLY A 103 ? GLY A 103 . ? 1_555 ? 30 AC3 16 TYR A 104 ? TYR A 104 . ? 1_555 ? 31 AC3 16 ALA A 105 ? ALA A 105 . ? 1_555 ? 32 AC3 16 THR A 168 ? THR A 168 . ? 1_555 ? 33 AC3 16 ARG A 171 ? ARG A 171 . ? 1_555 ? 34 AC3 16 LYS A 181 ? LYS A 181 . ? 3_555 ? 35 AC3 16 ZN C . ? ZN A 301 . ? 1_555 ? 36 AC3 16 GGL B 2 ? GGL D 2 . ? 1_555 ? 37 AC3 16 GGL B 5 ? GGL D 5 . ? 1_555 ? 38 AC3 16 HOH E . ? HOH D 106 . ? 1_555 ? 39 AC4 20 HIS A 41 ? HIS A 41 . ? 1_555 ? 40 AC4 20 GLU A 46 ? GLU A 46 . ? 1_555 ? 41 AC4 20 HIS A 77 ? HIS A 77 . ? 1_555 ? 42 AC4 20 THR A 79 ? THR A 79 . ? 1_555 ? 43 AC4 20 SER A 80 ? SER A 80 . ? 1_555 ? 44 AC4 20 HIS A 102 ? HIS A 102 . ? 1_555 ? 45 AC4 20 GLY A 103 ? GLY A 103 . ? 1_555 ? 46 AC4 20 TYR A 104 ? TYR A 104 . ? 1_555 ? 47 AC4 20 ALA A 105 ? ALA A 105 . ? 1_555 ? 48 AC4 20 HIS A 144 ? HIS A 144 . ? 1_555 ? 49 AC4 20 ALA A 145 ? ALA A 145 . ? 1_555 ? 50 AC4 20 GLY A 146 ? GLY A 146 . ? 1_555 ? 51 AC4 20 ASN A 151 ? ASN A 151 . ? 1_555 ? 52 AC4 20 GLN A 163 ? GLN A 163 . ? 1_555 ? 53 AC4 20 GLU A 165 ? GLU A 165 . ? 1_555 ? 54 AC4 20 LYS A 181 ? LYS A 181 . ? 3_555 ? 55 AC4 20 ZN C . ? ZN A 301 . ? 1_555 ? 56 AC4 20 GGL B 3 ? GGL D 3 . ? 1_555 ? 57 AC4 20 GGL B 6 ? GGL D 6 . ? 1_555 ? 58 AC4 20 HOH E . ? HOH D 105 . ? 1_555 ? 59 AC5 19 HIS A 41 ? HIS A 41 . ? 1_555 ? 60 AC5 19 HIS A 77 ? HIS A 77 . ? 1_555 ? 61 AC5 19 THR A 79 ? THR A 79 . ? 1_555 ? 62 AC5 19 SER A 80 ? SER A 80 . ? 1_555 ? 63 AC5 19 HIS A 102 ? HIS A 102 . ? 1_555 ? 64 AC5 19 HIS A 144 ? HIS A 144 . ? 1_555 ? 65 AC5 19 ALA A 145 ? ALA A 145 . ? 1_555 ? 66 AC5 19 GLY A 146 ? GLY A 146 . ? 1_555 ? 67 AC5 19 VAL A 147 ? VAL A 147 . ? 1_555 ? 68 AC5 19 SER A 148 ? SER A 148 . ? 1_555 ? 69 AC5 19 ASN A 151 ? ASN A 151 . ? 1_555 ? 70 AC5 19 GLN A 163 ? GLN A 163 . ? 1_555 ? 71 AC5 19 GLU A 165 ? GLU A 165 . ? 1_555 ? 72 AC5 19 HOH D . ? HOH A 476 . ? 1_555 ? 73 AC5 19 HOH D . ? HOH A 518 . ? 4_575 ? 74 AC5 19 GGL B 4 ? GGL D 4 . ? 1_555 ? 75 AC5 19 HOH E . ? HOH D 103 . ? 1_555 ? 76 AC5 19 HOH E . ? HOH D 104 . ? 1_555 ? 77 AC5 19 HOH E . ? HOH D 105 . ? 1_555 ? # _pdbx_entry_details.entry_id 5ONJ _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE1 A GLN 109 ? ? NH2 A ARG 190 ? B 2.14 2 1 OE1 A GLU 196 ? ? O A HOH 401 ? ? 2.18 3 1 OE1 A GLN 110 ? ? O A HOH 402 ? ? 2.19 4 1 NH1 A ARG 190 ? B O A HOH 403 ? ? 2.19 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 106 ? ? -176.16 131.30 2 1 TYR A 206 ? ? -116.07 72.66 # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 620 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 6.46 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 1 ? A SER 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A ILE 3 ? A ILE 3 4 1 Y 1 A TYR 4 ? A TYR 4 5 1 Y 1 A ALA 5 ? A ALA 5 6 1 Y 1 A GLU 208 ? A GLU 208 7 1 Y 1 A HIS 209 ? A HIS 209 8 1 Y 1 A HIS 210 ? A HIS 210 9 1 Y 1 A HIS 211 ? A HIS 211 10 1 Y 1 A HIS 212 ? A HIS 212 11 1 Y 1 A HIS 213 ? A HIS 213 12 1 Y 1 A HIS 214 ? A HIS 214 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GGL N N N N 74 GGL CA C N S 75 GGL C C N N 76 GGL O O N N 77 GGL CB C N N 78 GGL CG C N N 79 GGL CD C N N 80 GGL OE1 O N N 81 GGL OE2 O N N 82 GGL OXT O N N 83 GGL H H N N 84 GGL H2 H N N 85 GGL HA H N N 86 GGL HB2 H N N 87 GGL HB3 H N N 88 GGL HG2 H N N 89 GGL HG3 H N N 90 GGL HE2 H N N 91 GGL HXT H N N 92 GLN N N N N 93 GLN CA C N S 94 GLN C C N N 95 GLN O O N N 96 GLN CB C N N 97 GLN CG C N N 98 GLN CD C N N 99 GLN OE1 O N N 100 GLN NE2 N N N 101 GLN OXT O N N 102 GLN H H N N 103 GLN H2 H N N 104 GLN HA H N N 105 GLN HB2 H N N 106 GLN HB3 H N N 107 GLN HG2 H N N 108 GLN HG3 H N N 109 GLN HE21 H N N 110 GLN HE22 H N N 111 GLN HXT H N N 112 GLU N N N N 113 GLU CA C N S 114 GLU C C N N 115 GLU O O N N 116 GLU CB C N N 117 GLU CG C N N 118 GLU CD C N N 119 GLU OE1 O N N 120 GLU OE2 O N N 121 GLU OXT O N N 122 GLU H H N N 123 GLU H2 H N N 124 GLU HA H N N 125 GLU HB2 H N N 126 GLU HB3 H N N 127 GLU HG2 H N N 128 GLU HG3 H N N 129 GLU HE2 H N N 130 GLU HXT H N N 131 GLY N N N N 132 GLY CA C N N 133 GLY C C N N 134 GLY O O N N 135 GLY OXT O N N 136 GLY H H N N 137 GLY H2 H N N 138 GLY HA2 H N N 139 GLY HA3 H N N 140 GLY HXT H N N 141 HIS N N N N 142 HIS CA C N S 143 HIS C C N N 144 HIS O O N N 145 HIS CB C N N 146 HIS CG C Y N 147 HIS ND1 N Y N 148 HIS CD2 C Y N 149 HIS CE1 C Y N 150 HIS NE2 N Y N 151 HIS OXT O N N 152 HIS H H N N 153 HIS H2 H N N 154 HIS HA H N N 155 HIS HB2 H N N 156 HIS HB3 H N N 157 HIS HD1 H N N 158 HIS HD2 H N N 159 HIS HE1 H N N 160 HIS HE2 H N N 161 HIS HXT H N N 162 HOH O O N N 163 HOH H1 H N N 164 HOH H2 H N N 165 ILE N N N N 166 ILE CA C N S 167 ILE C C N N 168 ILE O O N N 169 ILE CB C N S 170 ILE CG1 C N N 171 ILE CG2 C N N 172 ILE CD1 C N N 173 ILE OXT O N N 174 ILE H H N N 175 ILE H2 H N N 176 ILE HA H N N 177 ILE HB H N N 178 ILE HG12 H N N 179 ILE HG13 H N N 180 ILE HG21 H N N 181 ILE HG22 H N N 182 ILE HG23 H N N 183 ILE HD11 H N N 184 ILE HD12 H N N 185 ILE HD13 H N N 186 ILE HXT H N N 187 LEU N N N N 188 LEU CA C N S 189 LEU C C N N 190 LEU O O N N 191 LEU CB C N N 192 LEU CG C N N 193 LEU CD1 C N N 194 LEU CD2 C N N 195 LEU OXT O N N 196 LEU H H N N 197 LEU H2 H N N 198 LEU HA H N N 199 LEU HB2 H N N 200 LEU HB3 H N N 201 LEU HG H N N 202 LEU HD11 H N N 203 LEU HD12 H N N 204 LEU HD13 H N N 205 LEU HD21 H N N 206 LEU HD22 H N N 207 LEU HD23 H N N 208 LEU HXT H N N 209 LYS N N N N 210 LYS CA C N S 211 LYS C C N N 212 LYS O O N N 213 LYS CB C N N 214 LYS CG C N N 215 LYS CD C N N 216 LYS CE C N N 217 LYS NZ N N N 218 LYS OXT O N N 219 LYS H H N N 220 LYS H2 H N N 221 LYS HA H N N 222 LYS HB2 H N N 223 LYS HB3 H N N 224 LYS HG2 H N N 225 LYS HG3 H N N 226 LYS HD2 H N N 227 LYS HD3 H N N 228 LYS HE2 H N N 229 LYS HE3 H N N 230 LYS HZ1 H N N 231 LYS HZ2 H N N 232 LYS HZ3 H N N 233 LYS HXT H N N 234 MET N N N N 235 MET CA C N S 236 MET C C N N 237 MET O O N N 238 MET CB C N N 239 MET CG C N N 240 MET SD S N N 241 MET CE C N N 242 MET OXT O N N 243 MET H H N N 244 MET H2 H N N 245 MET HA H N N 246 MET HB2 H N N 247 MET HB3 H N N 248 MET HG2 H N N 249 MET HG3 H N N 250 MET HE1 H N N 251 MET HE2 H N N 252 MET HE3 H N N 253 MET HXT H N N 254 PHE N N N N 255 PHE CA C N S 256 PHE C C N N 257 PHE O O N N 258 PHE CB C N N 259 PHE CG C Y N 260 PHE CD1 C Y N 261 PHE CD2 C Y N 262 PHE CE1 C Y N 263 PHE CE2 C Y N 264 PHE CZ C Y N 265 PHE OXT O N N 266 PHE H H N N 267 PHE H2 H N N 268 PHE HA H N N 269 PHE HB2 H N N 270 PHE HB3 H N N 271 PHE HD1 H N N 272 PHE HD2 H N N 273 PHE HE1 H N N 274 PHE HE2 H N N 275 PHE HZ H N N 276 PHE HXT H N N 277 PRO N N N N 278 PRO CA C N S 279 PRO C C N N 280 PRO O O N N 281 PRO CB C N N 282 PRO CG C N N 283 PRO CD C N N 284 PRO OXT O N N 285 PRO H H N N 286 PRO HA H N N 287 PRO HB2 H N N 288 PRO HB3 H N N 289 PRO HG2 H N N 290 PRO HG3 H N N 291 PRO HD2 H N N 292 PRO HD3 H N N 293 PRO HXT H N N 294 SER N N N N 295 SER CA C N S 296 SER C C N N 297 SER O O N N 298 SER CB C N N 299 SER OG O N N 300 SER OXT O N N 301 SER H H N N 302 SER H2 H N N 303 SER HA H N N 304 SER HB2 H N N 305 SER HB3 H N N 306 SER HG H N N 307 SER HXT H N N 308 THR N N N N 309 THR CA C N S 310 THR C C N N 311 THR O O N N 312 THR CB C N R 313 THR OG1 O N N 314 THR CG2 C N N 315 THR OXT O N N 316 THR H H N N 317 THR H2 H N N 318 THR HA H N N 319 THR HB H N N 320 THR HG1 H N N 321 THR HG21 H N N 322 THR HG22 H N N 323 THR HG23 H N N 324 THR HXT H N N 325 TYR N N N N 326 TYR CA C N S 327 TYR C C N N 328 TYR O O N N 329 TYR CB C N N 330 TYR CG C Y N 331 TYR CD1 C Y N 332 TYR CD2 C Y N 333 TYR CE1 C Y N 334 TYR CE2 C Y N 335 TYR CZ C Y N 336 TYR OH O N N 337 TYR OXT O N N 338 TYR H H N N 339 TYR H2 H N N 340 TYR HA H N N 341 TYR HB2 H N N 342 TYR HB3 H N N 343 TYR HD1 H N N 344 TYR HD2 H N N 345 TYR HE1 H N N 346 TYR HE2 H N N 347 TYR HH H N N 348 TYR HXT H N N 349 VAL N N N N 350 VAL CA C N S 351 VAL C C N N 352 VAL O O N N 353 VAL CB C N N 354 VAL CG1 C N N 355 VAL CG2 C N N 356 VAL OXT O N N 357 VAL H H N N 358 VAL H2 H N N 359 VAL HA H N N 360 VAL HB H N N 361 VAL HG11 H N N 362 VAL HG12 H N N 363 VAL HG13 H N N 364 VAL HG21 H N N 365 VAL HG22 H N N 366 VAL HG23 H N N 367 VAL HXT H N N 368 ZN ZN ZN N N 369 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GGL N CA sing N N 70 GGL N H sing N N 71 GGL N H2 sing N N 72 GGL CA C sing N N 73 GGL CA CB sing N N 74 GGL CA HA sing N N 75 GGL C O doub N N 76 GGL C OXT sing N N 77 GGL CB CG sing N N 78 GGL CB HB2 sing N N 79 GGL CB HB3 sing N N 80 GGL CG CD sing N N 81 GGL CG HG2 sing N N 82 GGL CG HG3 sing N N 83 GGL CD OE1 doub N N 84 GGL CD OE2 sing N N 85 GGL OE2 HE2 sing N N 86 GGL OXT HXT sing N N 87 GLN N CA sing N N 88 GLN N H sing N N 89 GLN N H2 sing N N 90 GLN CA C sing N N 91 GLN CA CB sing N N 92 GLN CA HA sing N N 93 GLN C O doub N N 94 GLN C OXT sing N N 95 GLN CB CG sing N N 96 GLN CB HB2 sing N N 97 GLN CB HB3 sing N N 98 GLN CG CD sing N N 99 GLN CG HG2 sing N N 100 GLN CG HG3 sing N N 101 GLN CD OE1 doub N N 102 GLN CD NE2 sing N N 103 GLN NE2 HE21 sing N N 104 GLN NE2 HE22 sing N N 105 GLN OXT HXT sing N N 106 GLU N CA sing N N 107 GLU N H sing N N 108 GLU N H2 sing N N 109 GLU CA C sing N N 110 GLU CA CB sing N N 111 GLU CA HA sing N N 112 GLU C O doub N N 113 GLU C OXT sing N N 114 GLU CB CG sing N N 115 GLU CB HB2 sing N N 116 GLU CB HB3 sing N N 117 GLU CG CD sing N N 118 GLU CG HG2 sing N N 119 GLU CG HG3 sing N N 120 GLU CD OE1 doub N N 121 GLU CD OE2 sing N N 122 GLU OE2 HE2 sing N N 123 GLU OXT HXT sing N N 124 GLY N CA sing N N 125 GLY N H sing N N 126 GLY N H2 sing N N 127 GLY CA C sing N N 128 GLY CA HA2 sing N N 129 GLY CA HA3 sing N N 130 GLY C O doub N N 131 GLY C OXT sing N N 132 GLY OXT HXT sing N N 133 HIS N CA sing N N 134 HIS N H sing N N 135 HIS N H2 sing N N 136 HIS CA C sing N N 137 HIS CA CB sing N N 138 HIS CA HA sing N N 139 HIS C O doub N N 140 HIS C OXT sing N N 141 HIS CB CG sing N N 142 HIS CB HB2 sing N N 143 HIS CB HB3 sing N N 144 HIS CG ND1 sing Y N 145 HIS CG CD2 doub Y N 146 HIS ND1 CE1 doub Y N 147 HIS ND1 HD1 sing N N 148 HIS CD2 NE2 sing Y N 149 HIS CD2 HD2 sing N N 150 HIS CE1 NE2 sing Y N 151 HIS CE1 HE1 sing N N 152 HIS NE2 HE2 sing N N 153 HIS OXT HXT sing N N 154 HOH O H1 sing N N 155 HOH O H2 sing N N 156 ILE N CA sing N N 157 ILE N H sing N N 158 ILE N H2 sing N N 159 ILE CA C sing N N 160 ILE CA CB sing N N 161 ILE CA HA sing N N 162 ILE C O doub N N 163 ILE C OXT sing N N 164 ILE CB CG1 sing N N 165 ILE CB CG2 sing N N 166 ILE CB HB sing N N 167 ILE CG1 CD1 sing N N 168 ILE CG1 HG12 sing N N 169 ILE CG1 HG13 sing N N 170 ILE CG2 HG21 sing N N 171 ILE CG2 HG22 sing N N 172 ILE CG2 HG23 sing N N 173 ILE CD1 HD11 sing N N 174 ILE CD1 HD12 sing N N 175 ILE CD1 HD13 sing N N 176 ILE OXT HXT sing N N 177 LEU N CA sing N N 178 LEU N H sing N N 179 LEU N H2 sing N N 180 LEU CA C sing N N 181 LEU CA CB sing N N 182 LEU CA HA sing N N 183 LEU C O doub N N 184 LEU C OXT sing N N 185 LEU CB CG sing N N 186 LEU CB HB2 sing N N 187 LEU CB HB3 sing N N 188 LEU CG CD1 sing N N 189 LEU CG CD2 sing N N 190 LEU CG HG sing N N 191 LEU CD1 HD11 sing N N 192 LEU CD1 HD12 sing N N 193 LEU CD1 HD13 sing N N 194 LEU CD2 HD21 sing N N 195 LEU CD2 HD22 sing N N 196 LEU CD2 HD23 sing N N 197 LEU OXT HXT sing N N 198 LYS N CA sing N N 199 LYS N H sing N N 200 LYS N H2 sing N N 201 LYS CA C sing N N 202 LYS CA CB sing N N 203 LYS CA HA sing N N 204 LYS C O doub N N 205 LYS C OXT sing N N 206 LYS CB CG sing N N 207 LYS CB HB2 sing N N 208 LYS CB HB3 sing N N 209 LYS CG CD sing N N 210 LYS CG HG2 sing N N 211 LYS CG HG3 sing N N 212 LYS CD CE sing N N 213 LYS CD HD2 sing N N 214 LYS CD HD3 sing N N 215 LYS CE NZ sing N N 216 LYS CE HE2 sing N N 217 LYS CE HE3 sing N N 218 LYS NZ HZ1 sing N N 219 LYS NZ HZ2 sing N N 220 LYS NZ HZ3 sing N N 221 LYS OXT HXT sing N N 222 MET N CA sing N N 223 MET N H sing N N 224 MET N H2 sing N N 225 MET CA C sing N N 226 MET CA CB sing N N 227 MET CA HA sing N N 228 MET C O doub N N 229 MET C OXT sing N N 230 MET CB CG sing N N 231 MET CB HB2 sing N N 232 MET CB HB3 sing N N 233 MET CG SD sing N N 234 MET CG HG2 sing N N 235 MET CG HG3 sing N N 236 MET SD CE sing N N 237 MET CE HE1 sing N N 238 MET CE HE2 sing N N 239 MET CE HE3 sing N N 240 MET OXT HXT sing N N 241 PHE N CA sing N N 242 PHE N H sing N N 243 PHE N H2 sing N N 244 PHE CA C sing N N 245 PHE CA CB sing N N 246 PHE CA HA sing N N 247 PHE C O doub N N 248 PHE C OXT sing N N 249 PHE CB CG sing N N 250 PHE CB HB2 sing N N 251 PHE CB HB3 sing N N 252 PHE CG CD1 doub Y N 253 PHE CG CD2 sing Y N 254 PHE CD1 CE1 sing Y N 255 PHE CD1 HD1 sing N N 256 PHE CD2 CE2 doub Y N 257 PHE CD2 HD2 sing N N 258 PHE CE1 CZ doub Y N 259 PHE CE1 HE1 sing N N 260 PHE CE2 CZ sing Y N 261 PHE CE2 HE2 sing N N 262 PHE CZ HZ sing N N 263 PHE OXT HXT sing N N 264 PRO N CA sing N N 265 PRO N CD sing N N 266 PRO N H sing N N 267 PRO CA C sing N N 268 PRO CA CB sing N N 269 PRO CA HA sing N N 270 PRO C O doub N N 271 PRO C OXT sing N N 272 PRO CB CG sing N N 273 PRO CB HB2 sing N N 274 PRO CB HB3 sing N N 275 PRO CG CD sing N N 276 PRO CG HG2 sing N N 277 PRO CG HG3 sing N N 278 PRO CD HD2 sing N N 279 PRO CD HD3 sing N N 280 PRO OXT HXT sing N N 281 SER N CA sing N N 282 SER N H sing N N 283 SER N H2 sing N N 284 SER CA C sing N N 285 SER CA CB sing N N 286 SER CA HA sing N N 287 SER C O doub N N 288 SER C OXT sing N N 289 SER CB OG sing N N 290 SER CB HB2 sing N N 291 SER CB HB3 sing N N 292 SER OG HG sing N N 293 SER OXT HXT sing N N 294 THR N CA sing N N 295 THR N H sing N N 296 THR N H2 sing N N 297 THR CA C sing N N 298 THR CA CB sing N N 299 THR CA HA sing N N 300 THR C O doub N N 301 THR C OXT sing N N 302 THR CB OG1 sing N N 303 THR CB CG2 sing N N 304 THR CB HB sing N N 305 THR OG1 HG1 sing N N 306 THR CG2 HG21 sing N N 307 THR CG2 HG22 sing N N 308 THR CG2 HG23 sing N N 309 THR OXT HXT sing N N 310 TYR N CA sing N N 311 TYR N H sing N N 312 TYR N H2 sing N N 313 TYR CA C sing N N 314 TYR CA CB sing N N 315 TYR CA HA sing N N 316 TYR C O doub N N 317 TYR C OXT sing N N 318 TYR CB CG sing N N 319 TYR CB HB2 sing N N 320 TYR CB HB3 sing N N 321 TYR CG CD1 doub Y N 322 TYR CG CD2 sing Y N 323 TYR CD1 CE1 sing Y N 324 TYR CD1 HD1 sing N N 325 TYR CD2 CE2 doub Y N 326 TYR CD2 HD2 sing N N 327 TYR CE1 CZ doub Y N 328 TYR CE1 HE1 sing N N 329 TYR CE2 CZ sing Y N 330 TYR CE2 HE2 sing N N 331 TYR CZ OH sing N N 332 TYR OH HH sing N N 333 TYR OXT HXT sing N N 334 VAL N CA sing N N 335 VAL N H sing N N 336 VAL N H2 sing N N 337 VAL CA C sing N N 338 VAL CA CB sing N N 339 VAL CA HA sing N N 340 VAL C O doub N N 341 VAL C OXT sing N N 342 VAL CB CG1 sing N N 343 VAL CB CG2 sing N N 344 VAL CB HB sing N N 345 VAL CG1 HG11 sing N N 346 VAL CG1 HG12 sing N N 347 VAL CG1 HG13 sing N N 348 VAL CG2 HG21 sing N N 349 VAL CG2 HG22 sing N N 350 VAL CG2 HG23 sing N N 351 VAL OXT HXT sing N N 352 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3A9L _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 5ONJ _atom_sites.fract_transf_matrix[1][1] 0.025912 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020986 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010068 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S ZN # loop_