data_5OWR # _entry.id 5OWR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5OWR pdb_00005owr 10.2210/pdb5owr/pdb WWPDB D_1200006492 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-09-13 2 'Structure model' 1 1 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5OWR _pdbx_database_status.recvd_initial_deposition_date 2017-09-04 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Szklarz, M.' 1 ? 'Muniz, J.R.C.' 2 ? 'Vollmar, M.' 3 ? 'von Delft, F.' 4 ? 'Bountra, C.' 5 ? 'Knapp, S.' 6 ? 'Edwards, A.M.' 7 ? 'Arrowsmith, C.' 8 ? 'Elkins, J.M.' 9 0000-0003-2858-8929 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Human STK10 bound to dasatinib' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # _citation_author.citation_id primary _citation_author.name 'Elkins, J.M.' _citation_author.ordinal 1 _citation_author.identifier_ORCID ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Serine/threonine-protein kinase 10' 34298.605 1 2.7.11.1 ? ? ? 2 non-polymer syn 'N-(2-CHLORO-6-METHYLPHENYL)-2-({6-[4-(2-HYDROXYETHYL)PIPERAZIN-1-YL]-2-METHYLPYRIMIDIN-4-YL}AMINO)-1,3-THIAZOLE-5-CARBOXAMIDE' 488.006 1 ? ? ? ? 3 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 4 water nat water 18.015 84 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Lymphocyte-oriented kinase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SMRKSREYEHVRRDLDPNEVWEIVGELGDGAFGKVYKAKNKETGALAAAKVIETKSEEELEDYIVEIEILATCDHPYIVK LLGAYYHDGKLWIMIEFCPGGAVDAIMLELDRGLTEPQIQVVCRQMLEALNFLHSKRIIHRDLKAGNVLMTLEGDIRLAD FGVSAKNLKTLQKRDSFIGTPYWMAPEVVMCETMKDTPYDYKADIWSLGITLIEMAQIEPPHHELNPMRVLLKIAKSDPP TLLTPSKWSVEFRDFLKIALDKNPETRPSAAQLLEHPFVSSITSNKALRELVAEAKAEVMEE ; _entity_poly.pdbx_seq_one_letter_code_can ;SMRKSREYEHVRRDLDPNEVWEIVGELGDGAFGKVYKAKNKETGALAAAKVIETKSEEELEDYIVEIEILATCDHPYIVK LLGAYYHDGKLWIMIEFCPGGAVDAIMLELDRGLTEPQIQVVCRQMLEALNFLHSKRIIHRDLKAGNVLMTLEGDIRLAD FGVSAKNLKTLQKRDSFIGTPYWMAPEVVMCETMKDTPYDYKADIWSLGITLIEMAQIEPPHHELNPMRVLLKIAKSDPP TLLTPSKWSVEFRDFLKIALDKNPETRPSAAQLLEHPFVSSITSNKALRELVAEAKAEVMEE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'N-(2-CHLORO-6-METHYLPHENYL)-2-({6-[4-(2-HYDROXYETHYL)PIPERAZIN-1-YL]-2-METHYLPYRIMIDIN-4-YL}AMINO)-1,3-THIAZOLE-5-CARBOXAMIDE' 1N1 3 'CALCIUM ION' CA 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 MET n 1 3 ARG n 1 4 LYS n 1 5 SER n 1 6 ARG n 1 7 GLU n 1 8 TYR n 1 9 GLU n 1 10 HIS n 1 11 VAL n 1 12 ARG n 1 13 ARG n 1 14 ASP n 1 15 LEU n 1 16 ASP n 1 17 PRO n 1 18 ASN n 1 19 GLU n 1 20 VAL n 1 21 TRP n 1 22 GLU n 1 23 ILE n 1 24 VAL n 1 25 GLY n 1 26 GLU n 1 27 LEU n 1 28 GLY n 1 29 ASP n 1 30 GLY n 1 31 ALA n 1 32 PHE n 1 33 GLY n 1 34 LYS n 1 35 VAL n 1 36 TYR n 1 37 LYS n 1 38 ALA n 1 39 LYS n 1 40 ASN n 1 41 LYS n 1 42 GLU n 1 43 THR n 1 44 GLY n 1 45 ALA n 1 46 LEU n 1 47 ALA n 1 48 ALA n 1 49 ALA n 1 50 LYS n 1 51 VAL n 1 52 ILE n 1 53 GLU n 1 54 THR n 1 55 LYS n 1 56 SER n 1 57 GLU n 1 58 GLU n 1 59 GLU n 1 60 LEU n 1 61 GLU n 1 62 ASP n 1 63 TYR n 1 64 ILE n 1 65 VAL n 1 66 GLU n 1 67 ILE n 1 68 GLU n 1 69 ILE n 1 70 LEU n 1 71 ALA n 1 72 THR n 1 73 CYS n 1 74 ASP n 1 75 HIS n 1 76 PRO n 1 77 TYR n 1 78 ILE n 1 79 VAL n 1 80 LYS n 1 81 LEU n 1 82 LEU n 1 83 GLY n 1 84 ALA n 1 85 TYR n 1 86 TYR n 1 87 HIS n 1 88 ASP n 1 89 GLY n 1 90 LYS n 1 91 LEU n 1 92 TRP n 1 93 ILE n 1 94 MET n 1 95 ILE n 1 96 GLU n 1 97 PHE n 1 98 CYS n 1 99 PRO n 1 100 GLY n 1 101 GLY n 1 102 ALA n 1 103 VAL n 1 104 ASP n 1 105 ALA n 1 106 ILE n 1 107 MET n 1 108 LEU n 1 109 GLU n 1 110 LEU n 1 111 ASP n 1 112 ARG n 1 113 GLY n 1 114 LEU n 1 115 THR n 1 116 GLU n 1 117 PRO n 1 118 GLN n 1 119 ILE n 1 120 GLN n 1 121 VAL n 1 122 VAL n 1 123 CYS n 1 124 ARG n 1 125 GLN n 1 126 MET n 1 127 LEU n 1 128 GLU n 1 129 ALA n 1 130 LEU n 1 131 ASN n 1 132 PHE n 1 133 LEU n 1 134 HIS n 1 135 SER n 1 136 LYS n 1 137 ARG n 1 138 ILE n 1 139 ILE n 1 140 HIS n 1 141 ARG n 1 142 ASP n 1 143 LEU n 1 144 LYS n 1 145 ALA n 1 146 GLY n 1 147 ASN n 1 148 VAL n 1 149 LEU n 1 150 MET n 1 151 THR n 1 152 LEU n 1 153 GLU n 1 154 GLY n 1 155 ASP n 1 156 ILE n 1 157 ARG n 1 158 LEU n 1 159 ALA n 1 160 ASP n 1 161 PHE n 1 162 GLY n 1 163 VAL n 1 164 SER n 1 165 ALA n 1 166 LYS n 1 167 ASN n 1 168 LEU n 1 169 LYS n 1 170 THR n 1 171 LEU n 1 172 GLN n 1 173 LYS n 1 174 ARG n 1 175 ASP n 1 176 SER n 1 177 PHE n 1 178 ILE n 1 179 GLY n 1 180 THR n 1 181 PRO n 1 182 TYR n 1 183 TRP n 1 184 MET n 1 185 ALA n 1 186 PRO n 1 187 GLU n 1 188 VAL n 1 189 VAL n 1 190 MET n 1 191 CYS n 1 192 GLU n 1 193 THR n 1 194 MET n 1 195 LYS n 1 196 ASP n 1 197 THR n 1 198 PRO n 1 199 TYR n 1 200 ASP n 1 201 TYR n 1 202 LYS n 1 203 ALA n 1 204 ASP n 1 205 ILE n 1 206 TRP n 1 207 SER n 1 208 LEU n 1 209 GLY n 1 210 ILE n 1 211 THR n 1 212 LEU n 1 213 ILE n 1 214 GLU n 1 215 MET n 1 216 ALA n 1 217 GLN n 1 218 ILE n 1 219 GLU n 1 220 PRO n 1 221 PRO n 1 222 HIS n 1 223 HIS n 1 224 GLU n 1 225 LEU n 1 226 ASN n 1 227 PRO n 1 228 MET n 1 229 ARG n 1 230 VAL n 1 231 LEU n 1 232 LEU n 1 233 LYS n 1 234 ILE n 1 235 ALA n 1 236 LYS n 1 237 SER n 1 238 ASP n 1 239 PRO n 1 240 PRO n 1 241 THR n 1 242 LEU n 1 243 LEU n 1 244 THR n 1 245 PRO n 1 246 SER n 1 247 LYS n 1 248 TRP n 1 249 SER n 1 250 VAL n 1 251 GLU n 1 252 PHE n 1 253 ARG n 1 254 ASP n 1 255 PHE n 1 256 LEU n 1 257 LYS n 1 258 ILE n 1 259 ALA n 1 260 LEU n 1 261 ASP n 1 262 LYS n 1 263 ASN n 1 264 PRO n 1 265 GLU n 1 266 THR n 1 267 ARG n 1 268 PRO n 1 269 SER n 1 270 ALA n 1 271 ALA n 1 272 GLN n 1 273 LEU n 1 274 LEU n 1 275 GLU n 1 276 HIS n 1 277 PRO n 1 278 PHE n 1 279 VAL n 1 280 SER n 1 281 SER n 1 282 ILE n 1 283 THR n 1 284 SER n 1 285 ASN n 1 286 LYS n 1 287 ALA n 1 288 LEU n 1 289 ARG n 1 290 GLU n 1 291 LEU n 1 292 VAL n 1 293 ALA n 1 294 GLU n 1 295 ALA n 1 296 LYS n 1 297 ALA n 1 298 GLU n 1 299 VAL n 1 300 MET n 1 301 GLU n 1 302 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 302 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'STK10, LOK' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pNIC28-Bsa4 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 1N1 non-polymer . 'N-(2-CHLORO-6-METHYLPHENYL)-2-({6-[4-(2-HYDROXYETHYL)PIPERAZIN-1-YL]-2-METHYLPYRIMIDIN-4-YL}AMINO)-1,3-THIAZOLE-5-CARBOXAMIDE' Dasatinib 'C22 H26 Cl N7 O2 S' 488.006 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 16 ? ? ? A . n A 1 2 MET 2 17 ? ? ? A . n A 1 3 ARG 3 18 ? ? ? A . n A 1 4 LYS 4 19 ? ? ? A . n A 1 5 SER 5 20 ? ? ? A . n A 1 6 ARG 6 21 ? ? ? A . n A 1 7 GLU 7 22 ? ? ? A . n A 1 8 TYR 8 23 23 TYR TYR A . n A 1 9 GLU 9 24 24 GLU GLU A . n A 1 10 HIS 10 25 25 HIS HIS A . n A 1 11 VAL 11 26 26 VAL VAL A . n A 1 12 ARG 12 27 27 ARG ARG A . n A 1 13 ARG 13 28 28 ARG ARG A . n A 1 14 ASP 14 29 29 ASP ASP A . n A 1 15 LEU 15 30 30 LEU LEU A . n A 1 16 ASP 16 31 31 ASP ASP A . n A 1 17 PRO 17 32 32 PRO PRO A . n A 1 18 ASN 18 33 33 ASN ASN A . n A 1 19 GLU 19 34 34 GLU GLU A . n A 1 20 VAL 20 35 35 VAL VAL A . n A 1 21 TRP 21 36 36 TRP TRP A . n A 1 22 GLU 22 37 37 GLU GLU A . n A 1 23 ILE 23 38 38 ILE ILE A . n A 1 24 VAL 24 39 39 VAL VAL A . n A 1 25 GLY 25 40 40 GLY GLY A . n A 1 26 GLU 26 41 41 GLU GLU A . n A 1 27 LEU 27 42 42 LEU LEU A . n A 1 28 GLY 28 43 43 GLY GLY A . n A 1 29 ASP 29 44 ? ? ? A . n A 1 30 GLY 30 45 ? ? ? A . n A 1 31 ALA 31 46 ? ? ? A . n A 1 32 PHE 32 47 ? ? ? A . n A 1 33 GLY 33 48 48 GLY GLY A . n A 1 34 LYS 34 49 49 LYS LYS A . n A 1 35 VAL 35 50 50 VAL VAL A . n A 1 36 TYR 36 51 51 TYR TYR A . n A 1 37 LYS 37 52 52 LYS LYS A . n A 1 38 ALA 38 53 53 ALA ALA A . n A 1 39 LYS 39 54 54 LYS LYS A . n A 1 40 ASN 40 55 55 ASN ASN A . n A 1 41 LYS 41 56 56 LYS LYS A . n A 1 42 GLU 42 57 57 GLU GLU A . n A 1 43 THR 43 58 58 THR THR A . n A 1 44 GLY 44 59 59 GLY GLY A . n A 1 45 ALA 45 60 60 ALA ALA A . n A 1 46 LEU 46 61 61 LEU LEU A . n A 1 47 ALA 47 62 62 ALA ALA A . n A 1 48 ALA 48 63 63 ALA ALA A . n A 1 49 ALA 49 64 64 ALA ALA A . n A 1 50 LYS 50 65 65 LYS LYS A . n A 1 51 VAL 51 66 66 VAL VAL A . n A 1 52 ILE 52 67 67 ILE ILE A . n A 1 53 GLU 53 68 68 GLU GLU A . n A 1 54 THR 54 69 69 THR THR A . n A 1 55 LYS 55 70 70 LYS LYS A . n A 1 56 SER 56 71 ? ? ? A . n A 1 57 GLU 57 72 ? ? ? A . n A 1 58 GLU 58 73 73 GLU GLU A . n A 1 59 GLU 59 74 74 GLU GLU A . n A 1 60 LEU 60 75 75 LEU LEU A . n A 1 61 GLU 61 76 76 GLU GLU A . n A 1 62 ASP 62 77 77 ASP ASP A . n A 1 63 TYR 63 78 78 TYR TYR A . n A 1 64 ILE 64 79 79 ILE ILE A . n A 1 65 VAL 65 80 80 VAL VAL A . n A 1 66 GLU 66 81 81 GLU GLU A . n A 1 67 ILE 67 82 82 ILE ILE A . n A 1 68 GLU 68 83 83 GLU GLU A . n A 1 69 ILE 69 84 84 ILE ILE A . n A 1 70 LEU 70 85 85 LEU LEU A . n A 1 71 ALA 71 86 86 ALA ALA A . n A 1 72 THR 72 87 87 THR THR A . n A 1 73 CYS 73 88 88 CYS CYS A . n A 1 74 ASP 74 89 89 ASP ASP A . n A 1 75 HIS 75 90 90 HIS HIS A . n A 1 76 PRO 76 91 91 PRO PRO A . n A 1 77 TYR 77 92 92 TYR TYR A . n A 1 78 ILE 78 93 93 ILE ILE A . n A 1 79 VAL 79 94 94 VAL VAL A . n A 1 80 LYS 80 95 95 LYS LYS A . n A 1 81 LEU 81 96 96 LEU LEU A . n A 1 82 LEU 82 97 97 LEU LEU A . n A 1 83 GLY 83 98 98 GLY GLY A . n A 1 84 ALA 84 99 99 ALA ALA A . n A 1 85 TYR 85 100 100 TYR TYR A . n A 1 86 TYR 86 101 101 TYR TYR A . n A 1 87 HIS 87 102 102 HIS HIS A . n A 1 88 ASP 88 103 103 ASP ASP A . n A 1 89 GLY 89 104 104 GLY GLY A . n A 1 90 LYS 90 105 105 LYS LYS A . n A 1 91 LEU 91 106 106 LEU LEU A . n A 1 92 TRP 92 107 107 TRP TRP A . n A 1 93 ILE 93 108 108 ILE ILE A . n A 1 94 MET 94 109 109 MET MET A . n A 1 95 ILE 95 110 110 ILE ILE A . n A 1 96 GLU 96 111 111 GLU GLU A . n A 1 97 PHE 97 112 112 PHE PHE A . n A 1 98 CYS 98 113 113 CYS CYS A . n A 1 99 PRO 99 114 114 PRO PRO A . n A 1 100 GLY 100 115 115 GLY GLY A . n A 1 101 GLY 101 116 116 GLY GLY A . n A 1 102 ALA 102 117 117 ALA ALA A . n A 1 103 VAL 103 118 118 VAL VAL A . n A 1 104 ASP 104 119 119 ASP ASP A . n A 1 105 ALA 105 120 120 ALA ALA A . n A 1 106 ILE 106 121 121 ILE ILE A . n A 1 107 MET 107 122 122 MET MET A . n A 1 108 LEU 108 123 123 LEU LEU A . n A 1 109 GLU 109 124 124 GLU GLU A . n A 1 110 LEU 110 125 125 LEU LEU A . n A 1 111 ASP 111 126 126 ASP ASP A . n A 1 112 ARG 112 127 127 ARG ARG A . n A 1 113 GLY 113 128 128 GLY GLY A . n A 1 114 LEU 114 129 129 LEU LEU A . n A 1 115 THR 115 130 130 THR THR A . n A 1 116 GLU 116 131 131 GLU GLU A . n A 1 117 PRO 117 132 132 PRO PRO A . n A 1 118 GLN 118 133 133 GLN GLN A . n A 1 119 ILE 119 134 134 ILE ILE A . n A 1 120 GLN 120 135 135 GLN GLN A . n A 1 121 VAL 121 136 136 VAL VAL A . n A 1 122 VAL 122 137 137 VAL VAL A . n A 1 123 CYS 123 138 138 CYS CYS A . n A 1 124 ARG 124 139 139 ARG ARG A . n A 1 125 GLN 125 140 140 GLN GLN A . n A 1 126 MET 126 141 141 MET MET A . n A 1 127 LEU 127 142 142 LEU LEU A . n A 1 128 GLU 128 143 143 GLU GLU A . n A 1 129 ALA 129 144 144 ALA ALA A . n A 1 130 LEU 130 145 145 LEU LEU A . n A 1 131 ASN 131 146 146 ASN ASN A . n A 1 132 PHE 132 147 147 PHE PHE A . n A 1 133 LEU 133 148 148 LEU LEU A . n A 1 134 HIS 134 149 149 HIS HIS A . n A 1 135 SER 135 150 150 SER SER A . n A 1 136 LYS 136 151 151 LYS LYS A . n A 1 137 ARG 137 152 152 ARG ARG A . n A 1 138 ILE 138 153 153 ILE ILE A . n A 1 139 ILE 139 154 154 ILE ILE A . n A 1 140 HIS 140 155 155 HIS HIS A . n A 1 141 ARG 141 156 156 ARG ARG A . n A 1 142 ASP 142 157 157 ASP ASP A . n A 1 143 LEU 143 158 158 LEU LEU A . n A 1 144 LYS 144 159 159 LYS LYS A . n A 1 145 ALA 145 160 160 ALA ALA A . n A 1 146 GLY 146 161 161 GLY GLY A . n A 1 147 ASN 147 162 162 ASN ASN A . n A 1 148 VAL 148 163 163 VAL VAL A . n A 1 149 LEU 149 164 164 LEU LEU A . n A 1 150 MET 150 165 165 MET MET A . n A 1 151 THR 151 166 166 THR THR A . n A 1 152 LEU 152 167 167 LEU LEU A . n A 1 153 GLU 153 168 168 GLU GLU A . n A 1 154 GLY 154 169 169 GLY GLY A . n A 1 155 ASP 155 170 170 ASP ASP A . n A 1 156 ILE 156 171 171 ILE ILE A . n A 1 157 ARG 157 172 172 ARG ARG A . n A 1 158 LEU 158 173 173 LEU LEU A . n A 1 159 ALA 159 174 174 ALA ALA A . n A 1 160 ASP 160 175 175 ASP ASP A . n A 1 161 PHE 161 176 176 PHE PHE A . n A 1 162 GLY 162 177 177 GLY GLY A . n A 1 163 VAL 163 178 178 VAL VAL A . n A 1 164 SER 164 179 179 SER SER A . n A 1 165 ALA 165 180 180 ALA ALA A . n A 1 166 LYS 166 181 181 LYS LYS A . n A 1 167 ASN 167 182 182 ASN ASN A . n A 1 168 LEU 168 183 183 LEU LEU A . n A 1 169 LYS 169 184 184 LYS LYS A . n A 1 170 THR 170 185 185 THR THR A . n A 1 171 LEU 171 186 186 LEU LEU A . n A 1 172 GLN 172 187 187 GLN GLN A . n A 1 173 LYS 173 188 188 LYS LYS A . n A 1 174 ARG 174 189 ? ? ? A . n A 1 175 ASP 175 190 ? ? ? A . n A 1 176 SER 176 191 ? ? ? A . n A 1 177 PHE 177 192 ? ? ? A . n A 1 178 ILE 178 193 ? ? ? A . n A 1 179 GLY 179 194 ? ? ? A . n A 1 180 THR 180 195 ? ? ? A . n A 1 181 PRO 181 196 196 PRO PRO A . n A 1 182 TYR 182 197 197 TYR TYR A . n A 1 183 TRP 183 198 198 TRP TRP A . n A 1 184 MET 184 199 199 MET MET A . n A 1 185 ALA 185 200 200 ALA ALA A . n A 1 186 PRO 186 201 201 PRO PRO A . n A 1 187 GLU 187 202 202 GLU GLU A . n A 1 188 VAL 188 203 203 VAL VAL A . n A 1 189 VAL 189 204 204 VAL VAL A . n A 1 190 MET 190 205 205 MET MET A . n A 1 191 CYS 191 206 206 CYS CYS A . n A 1 192 GLU 192 207 207 GLU GLU A . n A 1 193 THR 193 208 208 THR THR A . n A 1 194 MET 194 209 209 MET MET A . n A 1 195 LYS 195 210 210 LYS LYS A . n A 1 196 ASP 196 211 211 ASP ASP A . n A 1 197 THR 197 212 212 THR THR A . n A 1 198 PRO 198 213 213 PRO PRO A . n A 1 199 TYR 199 214 214 TYR TYR A . n A 1 200 ASP 200 215 215 ASP ASP A . n A 1 201 TYR 201 216 216 TYR TYR A . n A 1 202 LYS 202 217 217 LYS LYS A . n A 1 203 ALA 203 218 218 ALA ALA A . n A 1 204 ASP 204 219 219 ASP ASP A . n A 1 205 ILE 205 220 220 ILE ILE A . n A 1 206 TRP 206 221 221 TRP TRP A . n A 1 207 SER 207 222 222 SER SER A . n A 1 208 LEU 208 223 223 LEU LEU A . n A 1 209 GLY 209 224 224 GLY GLY A . n A 1 210 ILE 210 225 225 ILE ILE A . n A 1 211 THR 211 226 226 THR THR A . n A 1 212 LEU 212 227 227 LEU LEU A . n A 1 213 ILE 213 228 228 ILE ILE A . n A 1 214 GLU 214 229 229 GLU GLU A . n A 1 215 MET 215 230 230 MET MET A . n A 1 216 ALA 216 231 231 ALA ALA A . n A 1 217 GLN 217 232 232 GLN GLN A . n A 1 218 ILE 218 233 233 ILE ILE A . n A 1 219 GLU 219 234 234 GLU GLU A . n A 1 220 PRO 220 235 235 PRO PRO A . n A 1 221 PRO 221 236 236 PRO PRO A . n A 1 222 HIS 222 237 237 HIS HIS A . n A 1 223 HIS 223 238 238 HIS HIS A . n A 1 224 GLU 224 239 239 GLU GLU A . n A 1 225 LEU 225 240 240 LEU LEU A . n A 1 226 ASN 226 241 241 ASN ASN A . n A 1 227 PRO 227 242 242 PRO PRO A . n A 1 228 MET 228 243 243 MET MET A . n A 1 229 ARG 229 244 244 ARG ARG A . n A 1 230 VAL 230 245 245 VAL VAL A . n A 1 231 LEU 231 246 246 LEU LEU A . n A 1 232 LEU 232 247 247 LEU LEU A . n A 1 233 LYS 233 248 248 LYS LYS A . n A 1 234 ILE 234 249 249 ILE ILE A . n A 1 235 ALA 235 250 250 ALA ALA A . n A 1 236 LYS 236 251 251 LYS LYS A . n A 1 237 SER 237 252 252 SER SER A . n A 1 238 ASP 238 253 253 ASP ASP A . n A 1 239 PRO 239 254 254 PRO PRO A . n A 1 240 PRO 240 255 255 PRO PRO A . n A 1 241 THR 241 256 256 THR THR A . n A 1 242 LEU 242 257 257 LEU LEU A . n A 1 243 LEU 243 258 258 LEU LEU A . n A 1 244 THR 244 259 259 THR THR A . n A 1 245 PRO 245 260 260 PRO PRO A . n A 1 246 SER 246 261 261 SER SER A . n A 1 247 LYS 247 262 262 LYS LYS A . n A 1 248 TRP 248 263 263 TRP TRP A . n A 1 249 SER 249 264 264 SER SER A . n A 1 250 VAL 250 265 265 VAL VAL A . n A 1 251 GLU 251 266 266 GLU GLU A . n A 1 252 PHE 252 267 267 PHE PHE A . n A 1 253 ARG 253 268 268 ARG ARG A . n A 1 254 ASP 254 269 269 ASP ASP A . n A 1 255 PHE 255 270 270 PHE PHE A . n A 1 256 LEU 256 271 271 LEU LEU A . n A 1 257 LYS 257 272 272 LYS LYS A . n A 1 258 ILE 258 273 273 ILE ILE A . n A 1 259 ALA 259 274 274 ALA ALA A . n A 1 260 LEU 260 275 275 LEU LEU A . n A 1 261 ASP 261 276 276 ASP ASP A . n A 1 262 LYS 262 277 277 LYS LYS A . n A 1 263 ASN 263 278 278 ASN ASN A . n A 1 264 PRO 264 279 279 PRO PRO A . n A 1 265 GLU 265 280 280 GLU GLU A . n A 1 266 THR 266 281 281 THR THR A . n A 1 267 ARG 267 282 282 ARG ARG A . n A 1 268 PRO 268 283 283 PRO PRO A . n A 1 269 SER 269 284 284 SER SER A . n A 1 270 ALA 270 285 285 ALA ALA A . n A 1 271 ALA 271 286 286 ALA ALA A . n A 1 272 GLN 272 287 287 GLN GLN A . n A 1 273 LEU 273 288 288 LEU LEU A . n A 1 274 LEU 274 289 289 LEU LEU A . n A 1 275 GLU 275 290 290 GLU GLU A . n A 1 276 HIS 276 291 291 HIS HIS A . n A 1 277 PRO 277 292 292 PRO PRO A . n A 1 278 PHE 278 293 293 PHE PHE A . n A 1 279 VAL 279 294 294 VAL VAL A . n A 1 280 SER 280 295 295 SER SER A . n A 1 281 SER 281 296 296 SER SER A . n A 1 282 ILE 282 297 297 ILE ILE A . n A 1 283 THR 283 298 298 THR THR A . n A 1 284 SER 284 299 299 SER SER A . n A 1 285 ASN 285 300 300 ASN ASN A . n A 1 286 LYS 286 301 301 LYS LYS A . n A 1 287 ALA 287 302 302 ALA ALA A . n A 1 288 LEU 288 303 303 LEU LEU A . n A 1 289 ARG 289 304 304 ARG ARG A . n A 1 290 GLU 290 305 305 GLU GLU A . n A 1 291 LEU 291 306 306 LEU LEU A . n A 1 292 VAL 292 307 307 VAL VAL A . n A 1 293 ALA 293 308 308 ALA ALA A . n A 1 294 GLU 294 309 309 GLU GLU A . n A 1 295 ALA 295 310 310 ALA ALA A . n A 1 296 LYS 296 311 311 LYS LYS A . n A 1 297 ALA 297 312 312 ALA ALA A . n A 1 298 GLU 298 313 313 GLU GLU A . n A 1 299 VAL 299 314 314 VAL VAL A . n A 1 300 MET 300 315 315 MET MET A . n A 1 301 GLU 301 316 316 GLU GLU A . n A 1 302 GLU 302 317 317 GLU GLU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 1N1 1 401 500 1N1 DRG A . C 3 CA 1 402 1 CA CA A . D 4 HOH 1 501 90 HOH HOH A . D 4 HOH 2 502 76 HOH HOH A . D 4 HOH 3 503 1 HOH HOH A . D 4 HOH 4 504 52 HOH HOH A . D 4 HOH 5 505 68 HOH HOH A . D 4 HOH 6 506 10 HOH HOH A . D 4 HOH 7 507 85 HOH HOH A . D 4 HOH 8 508 65 HOH HOH A . D 4 HOH 9 509 64 HOH HOH A . D 4 HOH 10 510 49 HOH HOH A . D 4 HOH 11 511 84 HOH HOH A . D 4 HOH 12 512 81 HOH HOH A . D 4 HOH 13 513 11 HOH HOH A . D 4 HOH 14 514 2 HOH HOH A . D 4 HOH 15 515 87 HOH HOH A . D 4 HOH 16 516 58 HOH HOH A . D 4 HOH 17 517 83 HOH HOH A . D 4 HOH 18 518 46 HOH HOH A . D 4 HOH 19 519 88 HOH HOH A . D 4 HOH 20 520 5 HOH HOH A . D 4 HOH 21 521 15 HOH HOH A . D 4 HOH 22 522 26 HOH HOH A . D 4 HOH 23 523 62 HOH HOH A . D 4 HOH 24 524 63 HOH HOH A . D 4 HOH 25 525 89 HOH HOH A . D 4 HOH 26 526 59 HOH HOH A . D 4 HOH 27 527 86 HOH HOH A . D 4 HOH 28 528 18 HOH HOH A . D 4 HOH 29 529 39 HOH HOH A . D 4 HOH 30 530 24 HOH HOH A . D 4 HOH 31 531 35 HOH HOH A . D 4 HOH 32 532 8 HOH HOH A . D 4 HOH 33 533 28 HOH HOH A . D 4 HOH 34 534 25 HOH HOH A . D 4 HOH 35 535 14 HOH HOH A . D 4 HOH 36 536 40 HOH HOH A . D 4 HOH 37 537 67 HOH HOH A . D 4 HOH 38 538 4 HOH HOH A . D 4 HOH 39 539 55 HOH HOH A . D 4 HOH 40 540 13 HOH HOH A . D 4 HOH 41 541 17 HOH HOH A . D 4 HOH 42 542 41 HOH HOH A . D 4 HOH 43 543 33 HOH HOH A . D 4 HOH 44 544 22 HOH HOH A . D 4 HOH 45 545 20 HOH HOH A . D 4 HOH 46 546 75 HOH HOH A . D 4 HOH 47 547 50 HOH HOH A . D 4 HOH 48 548 56 HOH HOH A . D 4 HOH 49 549 9 HOH HOH A . D 4 HOH 50 550 27 HOH HOH A . D 4 HOH 51 551 37 HOH HOH A . D 4 HOH 52 552 38 HOH HOH A . D 4 HOH 53 553 61 HOH HOH A . D 4 HOH 54 554 47 HOH HOH A . D 4 HOH 55 555 42 HOH HOH A . D 4 HOH 56 556 69 HOH HOH A . D 4 HOH 57 557 31 HOH HOH A . D 4 HOH 58 558 82 HOH HOH A . D 4 HOH 59 559 60 HOH HOH A . D 4 HOH 60 560 21 HOH HOH A . D 4 HOH 61 561 66 HOH HOH A . D 4 HOH 62 562 23 HOH HOH A . D 4 HOH 63 563 54 HOH HOH A . D 4 HOH 64 564 77 HOH HOH A . D 4 HOH 65 565 6 HOH HOH A . D 4 HOH 66 566 44 HOH HOH A . D 4 HOH 67 567 36 HOH HOH A . D 4 HOH 68 568 3 HOH HOH A . D 4 HOH 69 569 45 HOH HOH A . D 4 HOH 70 570 72 HOH HOH A . D 4 HOH 71 571 34 HOH HOH A . D 4 HOH 72 572 7 HOH HOH A . D 4 HOH 73 573 57 HOH HOH A . D 4 HOH 74 574 19 HOH HOH A . D 4 HOH 75 575 43 HOH HOH A . D 4 HOH 76 576 12 HOH HOH A . D 4 HOH 77 577 70 HOH HOH A . D 4 HOH 78 578 79 HOH HOH A . D 4 HOH 79 579 16 HOH HOH A . D 4 HOH 80 580 53 HOH HOH A . D 4 HOH 81 581 32 HOH HOH A . D 4 HOH 82 582 51 HOH HOH A . D 4 HOH 83 583 71 HOH HOH A . D 4 HOH 84 584 78 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A TYR 23 ? CG ? A TYR 8 CG 2 1 Y 1 A TYR 23 ? CD1 ? A TYR 8 CD1 3 1 Y 1 A TYR 23 ? CD2 ? A TYR 8 CD2 4 1 Y 1 A TYR 23 ? CE1 ? A TYR 8 CE1 5 1 Y 1 A TYR 23 ? CE2 ? A TYR 8 CE2 6 1 Y 1 A TYR 23 ? CZ ? A TYR 8 CZ 7 1 Y 1 A TYR 23 ? OH ? A TYR 8 OH 8 1 Y 1 A GLU 24 ? CG ? A GLU 9 CG 9 1 Y 1 A GLU 24 ? CD ? A GLU 9 CD 10 1 Y 1 A GLU 24 ? OE1 ? A GLU 9 OE1 11 1 Y 1 A GLU 24 ? OE2 ? A GLU 9 OE2 12 1 Y 1 A ARG 27 ? CD ? A ARG 12 CD 13 1 Y 1 A ARG 27 ? NE ? A ARG 12 NE 14 1 Y 1 A ARG 27 ? CZ ? A ARG 12 CZ 15 1 Y 1 A ARG 27 ? NH1 ? A ARG 12 NH1 16 1 Y 1 A ARG 27 ? NH2 ? A ARG 12 NH2 17 1 Y 1 A LEU 30 ? CG ? A LEU 15 CG 18 1 Y 1 A LEU 30 ? CD1 ? A LEU 15 CD1 19 1 Y 1 A LEU 30 ? CD2 ? A LEU 15 CD2 20 1 Y 1 A GLU 34 ? CG ? A GLU 19 CG 21 1 Y 1 A GLU 34 ? CD ? A GLU 19 CD 22 1 Y 1 A GLU 34 ? OE1 ? A GLU 19 OE1 23 1 Y 1 A GLU 34 ? OE2 ? A GLU 19 OE2 24 1 Y 1 A LYS 49 ? CG ? A LYS 34 CG 25 1 Y 1 A LYS 49 ? CD ? A LYS 34 CD 26 1 Y 1 A LYS 49 ? CE ? A LYS 34 CE 27 1 Y 1 A LYS 49 ? NZ ? A LYS 34 NZ 28 1 Y 1 A VAL 50 ? CG1 ? A VAL 35 CG1 29 1 Y 1 A VAL 50 ? CG2 ? A VAL 35 CG2 30 1 Y 1 A TYR 51 ? CG ? A TYR 36 CG 31 1 Y 1 A TYR 51 ? CD1 ? A TYR 36 CD1 32 1 Y 1 A TYR 51 ? CD2 ? A TYR 36 CD2 33 1 Y 1 A TYR 51 ? CE1 ? A TYR 36 CE1 34 1 Y 1 A TYR 51 ? CE2 ? A TYR 36 CE2 35 1 Y 1 A TYR 51 ? CZ ? A TYR 36 CZ 36 1 Y 1 A TYR 51 ? OH ? A TYR 36 OH 37 1 Y 1 A LYS 54 ? CG ? A LYS 39 CG 38 1 Y 1 A LYS 54 ? CD ? A LYS 39 CD 39 1 Y 1 A LYS 54 ? CE ? A LYS 39 CE 40 1 Y 1 A LYS 54 ? NZ ? A LYS 39 NZ 41 1 Y 1 A GLU 68 ? CG ? A GLU 53 CG 42 1 Y 1 A GLU 68 ? CD ? A GLU 53 CD 43 1 Y 1 A GLU 68 ? OE1 ? A GLU 53 OE1 44 1 Y 1 A GLU 68 ? OE2 ? A GLU 53 OE2 45 1 Y 1 A LYS 70 ? CG ? A LYS 55 CG 46 1 Y 1 A LYS 70 ? CD ? A LYS 55 CD 47 1 Y 1 A LYS 70 ? CE ? A LYS 55 CE 48 1 Y 1 A LYS 70 ? NZ ? A LYS 55 NZ 49 1 Y 1 A GLU 73 ? CG ? A GLU 58 CG 50 1 Y 1 A GLU 73 ? CD ? A GLU 58 CD 51 1 Y 1 A GLU 73 ? OE1 ? A GLU 58 OE1 52 1 Y 1 A GLU 73 ? OE2 ? A GLU 58 OE2 53 1 Y 1 A ILE 79 ? CD1 ? A ILE 64 CD1 54 1 Y 1 A ARG 152 ? CD ? A ARG 137 CD 55 1 Y 1 A ARG 152 ? NE ? A ARG 137 NE 56 1 Y 1 A ARG 152 ? CZ ? A ARG 137 CZ 57 1 Y 1 A ARG 152 ? NH1 ? A ARG 137 NH1 58 1 Y 1 A ARG 152 ? NH2 ? A ARG 137 NH2 59 1 Y 1 A ILE 154 ? CD1 ? A ILE 139 CD1 60 1 Y 1 A LYS 181 ? CE ? A LYS 166 CE 61 1 Y 1 A LYS 181 ? NZ ? A LYS 166 NZ 62 1 Y 1 A LYS 184 ? CG ? A LYS 169 CG 63 1 Y 1 A LYS 184 ? CD ? A LYS 169 CD 64 1 Y 1 A LYS 184 ? CE ? A LYS 169 CE 65 1 Y 1 A LYS 184 ? NZ ? A LYS 169 NZ 66 1 Y 1 A LYS 188 ? CG ? A LYS 173 CG 67 1 Y 1 A LYS 188 ? CD ? A LYS 173 CD 68 1 Y 1 A LYS 188 ? CE ? A LYS 173 CE 69 1 Y 1 A LYS 188 ? NZ ? A LYS 173 NZ 70 1 Y 1 A MET 205 ? CE ? A MET 190 CE 71 1 Y 1 A LYS 210 ? CE ? A LYS 195 CE 72 1 Y 1 A LYS 210 ? NZ ? A LYS 195 NZ 73 1 Y 1 A ASP 211 ? CG ? A ASP 196 CG 74 1 Y 1 A ASP 211 ? OD1 ? A ASP 196 OD1 75 1 Y 1 A ASP 211 ? OD2 ? A ASP 196 OD2 76 1 Y 1 A THR 212 ? OG1 ? A THR 197 OG1 77 1 Y 1 A THR 212 ? CG2 ? A THR 197 CG2 78 1 Y 1 A MET 243 ? CG ? A MET 228 CG 79 1 Y 1 A MET 243 ? SD ? A MET 228 SD 80 1 Y 1 A MET 243 ? CE ? A MET 228 CE 81 1 Y 1 A LYS 248 ? NZ ? A LYS 233 NZ 82 1 Y 1 A LYS 251 ? CD ? A LYS 236 CD 83 1 Y 1 A LYS 251 ? CE ? A LYS 236 CE 84 1 Y 1 A LYS 251 ? NZ ? A LYS 236 NZ 85 1 Y 1 A LYS 272 ? CE ? A LYS 257 CE 86 1 Y 1 A LYS 272 ? NZ ? A LYS 257 NZ 87 1 Y 1 A GLU 317 ? CG ? A GLU 302 CG 88 1 Y 1 A GLU 317 ? CD ? A GLU 302 CD 89 1 Y 1 A GLU 317 ? OE1 ? A GLU 302 OE1 90 1 Y 1 A GLU 317 ? OE2 ? A GLU 302 OE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0158 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5OWR _cell.details ? _cell.formula_units_Z ? _cell.length_a 49.740 _cell.length_a_esd ? _cell.length_b 111.720 _cell.length_b_esd ? _cell.length_c 133.150 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5OWR _symmetry.cell_setting ? _symmetry.Int_Tables_number 23 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5OWR _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.7 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 54.48 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '40% PEG 300, 0.20M Ca(ac)2, 0.1M cacodylate pH 6.5' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2011-10-05 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9795 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I02' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9795 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I02 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5OWR _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.3 _reflns.d_resolution_low 85.58 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 16890 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.3 _reflns.pdbx_Rmerge_I_obs 0.1 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 37.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.3 _reflns_shell.d_res_low 2.38 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.7 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all 1643 _reflns_shell.number_unique_obs 7139 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.03 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 4.3 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.667 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -0.66 _refine.aniso_B[1][2] -0.00 _refine.aniso_B[1][3] -0.00 _refine.aniso_B[2][2] 3.80 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] -3.14 _refine.B_iso_max ? _refine.B_iso_mean 52.702 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.941 _refine.correlation_coeff_Fo_to_Fc_free 0.927 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5OWR _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.30 _refine.ls_d_res_low 85.58 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 16084 _refine.ls_number_reflns_R_free 786 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.64 _refine.ls_percent_reflns_R_free 4.7 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.22146 _refine.ls_R_factor_R_free 0.25362 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.21986 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model STK10 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.294 _refine.pdbx_overall_ESU_R_Free 0.223 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 9.103 _refine.overall_SU_ML 0.208 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 2157 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 34 _refine_hist.number_atoms_solvent 84 _refine_hist.number_atoms_total 2275 _refine_hist.d_res_high 2.30 _refine_hist.d_res_low 85.58 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 0.019 2237 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 2081 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.180 1.967 3043 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.902 2.978 4815 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.622 5.000 278 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 34.131 24.667 90 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 14.210 15.000 369 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 14.658 15.000 9 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.066 0.200 351 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 0.021 2453 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 410 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 2.180 5.446 1124 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 2.177 5.445 1123 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 3.624 8.142 1398 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 3.623 8.143 1399 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 2.132 5.617 1112 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 2.132 5.617 1112 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 3.660 8.359 1645 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 5.870 62.335 2455 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 5.847 62.303 2447 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.300 _refine_ls_shell.d_res_low 2.360 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 52 _refine_ls_shell.number_reflns_R_work 1157 _refine_ls_shell.percent_reflns_obs 99.59 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.374 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.340 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5OWR _struct.title 'Human STK10 bound to dasatinib' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5OWR _struct_keywords.text 'Kinase, Structural Genomics Consortium, SGC, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code STK10_HUMAN _struct_ref.pdbx_db_accession O94804 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;RKSREYEHVRRDLDPNEVWEIVGELGDGAFGKVYKAKNKETGALAAAKVIETKSEEELEDYIVEIEILATCDHPYIVKLL GAYYHDGKLWIMIEFCPGGAVDAIMLELDRGLTEPQIQVVCRQMLEALNFLHSKRIIHRDLKAGNVLMTLEGDIRLADFG VSAKNLKTLQKRDSFIGTPYWMAPEVVMCETMKDTPYDYKADIWSLGITLIEMAQIEPPHHELNPMRVLLKIAKSDPPTL LTPSKWSVEFRDFLKIALDKNPETRPSAAQLLEHPFVSSITSNKALRELVAEAKAEVMEE ; _struct_ref.pdbx_align_begin 18 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5OWR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 302 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O94804 _struct_ref_seq.db_align_beg 18 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 317 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 18 _struct_ref_seq.pdbx_auth_seq_align_end 317 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5OWR SER A 1 ? UNP O94804 ? ? 'expression tag' 16 1 1 5OWR MET A 2 ? UNP O94804 ? ? 'expression tag' 17 2 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 910 ? 1 MORE -5 ? 1 'SSA (A^2)' 15130 ? 2 'ABSA (A^2)' 4880 ? 2 MORE -39 ? 2 'SSA (A^2)' 27210 ? # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D 2 1,2 A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 3_455 -x-1,y,-z -1.0000000000 0.0000000000 0.0000000000 -49.7400000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 16 ? VAL A 20 ? ASP A 31 VAL A 35 1 ? 5 HELX_P HELX_P2 AA2 LEU A 60 ? CYS A 73 ? LEU A 75 CYS A 88 1 ? 14 HELX_P HELX_P3 AA3 VAL A 103 ? ASP A 111 ? VAL A 118 ASP A 126 1 ? 9 HELX_P HELX_P4 AA4 THR A 115 ? LYS A 136 ? THR A 130 LYS A 151 1 ? 22 HELX_P HELX_P5 AA5 LYS A 144 ? GLY A 146 ? LYS A 159 GLY A 161 5 ? 3 HELX_P HELX_P6 AA6 PHE A 161 ? LYS A 173 ? PHE A 176 LYS A 188 1 ? 13 HELX_P HELX_P7 AA7 ALA A 185 ? MET A 194 ? ALA A 200 MET A 209 1 ? 10 HELX_P HELX_P8 AA8 TYR A 201 ? ILE A 218 ? TYR A 216 ILE A 233 1 ? 18 HELX_P HELX_P9 AA9 ASN A 226 ? SER A 237 ? ASN A 241 SER A 252 1 ? 12 HELX_P HELX_P10 AB1 THR A 244 ? TRP A 248 ? THR A 259 TRP A 263 5 ? 5 HELX_P HELX_P11 AB2 SER A 249 ? LEU A 260 ? SER A 264 LEU A 275 1 ? 12 HELX_P HELX_P12 AB3 SER A 269 ? LEU A 274 ? SER A 284 LEU A 289 1 ? 6 HELX_P HELX_P13 AB4 ASN A 285 ? GLU A 301 ? ASN A 300 GLU A 316 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 191 SG ? ? ? 1_555 A CYS 191 SG ? ? A CYS 206 A CYS 206 3_455 ? ? ? ? ? ? ? 2.434 ? ? metalc1 metalc ? ? C CA . CA ? ? ? 1_555 D HOH . O ? ? A CA 402 A HOH 542 1_555 ? ? ? ? ? ? ? 3.189 ? ? metalc2 metalc ? ? C CA . CA ? ? ? 1_555 D HOH . O ? ? A CA 402 A HOH 575 1_555 ? ? ? ? ? ? ? 2.988 ? ? metalc3 metalc ? ? C CA . CA ? ? ? 1_555 D HOH . O ? ? A CA 402 A HOH 577 1_555 ? ? ? ? ? ? ? 3.100 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? D HOH . ? A HOH 542 ? 1_555 CA ? C CA . ? A CA 402 ? 1_555 O ? D HOH . ? A HOH 575 ? 1_555 96.2 ? 2 O ? D HOH . ? A HOH 542 ? 1_555 CA ? C CA . ? A CA 402 ? 1_555 O ? D HOH . ? A HOH 577 ? 1_555 145.2 ? 3 O ? D HOH . ? A HOH 575 ? 1_555 CA ? C CA . ? A CA 402 ? 1_555 O ? D HOH . ? A HOH 577 ? 1_555 70.0 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id THR _struct_mon_prot_cis.label_seq_id 197 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id THR _struct_mon_prot_cis.auth_seq_id 212 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 198 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 213 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -0.58 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 11 ? ARG A 12 ? VAL A 26 ARG A 27 AA1 2 LEU A 81 ? HIS A 87 ? LEU A 96 HIS A 102 AA1 3 LYS A 90 ? GLU A 96 ? LYS A 105 GLU A 111 AA1 4 LEU A 46 ? GLU A 53 ? LEU A 61 GLU A 68 AA1 5 TYR A 36 ? ASN A 40 ? TYR A 51 ASN A 55 AA1 6 TRP A 21 ? GLU A 26 ? TRP A 36 GLU A 41 AA2 1 GLY A 101 ? ALA A 102 ? GLY A 116 ALA A 117 AA2 2 VAL A 148 ? MET A 150 ? VAL A 163 MET A 165 AA2 3 ILE A 156 ? LEU A 158 ? ILE A 171 LEU A 173 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ARG A 12 ? N ARG A 27 O ALA A 84 ? O ALA A 99 AA1 2 3 N TYR A 85 ? N TYR A 100 O TRP A 92 ? O TRP A 107 AA1 3 4 O ILE A 95 ? O ILE A 110 N ALA A 48 ? N ALA A 63 AA1 4 5 O ALA A 49 ? O ALA A 64 N TYR A 36 ? N TYR A 51 AA1 5 6 O LYS A 37 ? O LYS A 52 N VAL A 24 ? N VAL A 39 AA2 1 2 N GLY A 101 ? N GLY A 116 O MET A 150 ? O MET A 165 AA2 2 3 N LEU A 149 ? N LEU A 164 O ARG A 157 ? O ARG A 172 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A 1N1 401 ? 11 'binding site for residue 1N1 A 401' AC2 Software A CA 402 ? 1 'binding site for residue CA A 402' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 11 ALA A 48 ? ALA A 63 . ? 1_555 ? 2 AC1 11 LYS A 50 ? LYS A 65 . ? 1_555 ? 3 AC1 11 ILE A 95 ? ILE A 110 . ? 1_555 ? 4 AC1 11 GLU A 96 ? GLU A 111 . ? 1_555 ? 5 AC1 11 PHE A 97 ? PHE A 112 . ? 1_555 ? 6 AC1 11 CYS A 98 ? CYS A 113 . ? 1_555 ? 7 AC1 11 PRO A 99 ? PRO A 114 . ? 1_555 ? 8 AC1 11 LEU A 149 ? LEU A 164 . ? 1_555 ? 9 AC1 11 ASP A 160 ? ASP A 175 . ? 1_555 ? 10 AC1 11 VAL A 299 ? VAL A 314 . ? 1_555 ? 11 AC1 11 HOH D . ? HOH A 541 . ? 1_555 ? 12 AC2 1 HOH D . ? HOH A 575 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 39 ? ? -142.35 33.54 2 1 LEU A 42 ? ? -125.50 -54.11 3 1 THR A 69 ? ? -137.45 -66.56 4 1 ASP A 103 ? ? 31.63 74.23 5 1 ASP A 157 ? ? -154.43 41.84 6 1 ASP A 175 ? ? 57.39 79.01 7 1 PRO A 213 ? ? -97.82 38.20 8 1 ILE A 233 ? ? 76.78 -53.09 9 1 THR A 259 ? ? -119.26 70.20 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 16 ? A SER 1 2 1 Y 1 A MET 17 ? A MET 2 3 1 Y 1 A ARG 18 ? A ARG 3 4 1 Y 1 A LYS 19 ? A LYS 4 5 1 Y 1 A SER 20 ? A SER 5 6 1 Y 1 A ARG 21 ? A ARG 6 7 1 Y 1 A GLU 22 ? A GLU 7 8 1 Y 1 A ASP 44 ? A ASP 29 9 1 Y 1 A GLY 45 ? A GLY 30 10 1 Y 1 A ALA 46 ? A ALA 31 11 1 Y 1 A PHE 47 ? A PHE 32 12 1 Y 1 A SER 71 ? A SER 56 13 1 Y 1 A GLU 72 ? A GLU 57 14 1 Y 1 A ARG 189 ? A ARG 174 15 1 Y 1 A ASP 190 ? A ASP 175 16 1 Y 1 A SER 191 ? A SER 176 17 1 Y 1 A PHE 192 ? A PHE 177 18 1 Y 1 A ILE 193 ? A ILE 178 19 1 Y 1 A GLY 194 ? A GLY 179 20 1 Y 1 A THR 195 ? A THR 180 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 1N1 C1 C Y N 1 1N1 C2 C Y N 2 1N1 C3 C N N 3 1N1 N6 N N N 4 1N1 C7 C Y N 5 1N1 C8 C Y N 6 1N1 C9 C Y N 7 1N1 C10 C N N 8 1N1 C11 C Y N 9 1N1 C12 C Y N 10 1N1 C13 C Y N 11 1N1 C14 C Y N 12 1N1 C15 C N N 13 1N1 C16 C N N 14 1N1 C19 C N N 15 1N1 C20 C N N 16 1N1 C21 C N N 17 1N1 N N N N 18 1N1 C C Y N 19 1N1 N1 N Y N 20 1N1 S S Y N 21 1N1 N2 N N N 22 1N1 C4 C Y N 23 1N1 C5 C Y N 24 1N1 C6 C Y N 25 1N1 CL CL N N 26 1N1 O O N N 27 1N1 N3 N Y N 28 1N1 N4 N Y N 29 1N1 N5 N N N 30 1N1 C17 C N N 31 1N1 C18 C N N 32 1N1 O1 O N N 33 1N1 H1 H N N 34 1N1 H7 H N N 35 1N1 H8 H N N 36 1N1 H101 H N N 37 1N1 H102 H N N 38 1N1 H103 H N N 39 1N1 H12 H N N 40 1N1 H151 H N N 41 1N1 H152 H N N 42 1N1 H153 H N N 43 1N1 H161 H N N 44 1N1 H162 H N N 45 1N1 H191 H N N 46 1N1 H192 H N N 47 1N1 H201 H N N 48 1N1 H202 H N N 49 1N1 H211 H N N 50 1N1 H212 H N N 51 1N1 HN H N N 52 1N1 HN2 H N N 53 1N1 H6 H N N 54 1N1 H171 H N N 55 1N1 H172 H N N 56 1N1 H181 H N N 57 1N1 H182 H N N 58 1N1 HO1 H N N 59 ALA N N N N 60 ALA CA C N S 61 ALA C C N N 62 ALA O O N N 63 ALA CB C N N 64 ALA OXT O N N 65 ALA H H N N 66 ALA H2 H N N 67 ALA HA H N N 68 ALA HB1 H N N 69 ALA HB2 H N N 70 ALA HB3 H N N 71 ALA HXT H N N 72 ARG N N N N 73 ARG CA C N S 74 ARG C C N N 75 ARG O O N N 76 ARG CB C N N 77 ARG CG C N N 78 ARG CD C N N 79 ARG NE N N N 80 ARG CZ C N N 81 ARG NH1 N N N 82 ARG NH2 N N N 83 ARG OXT O N N 84 ARG H H N N 85 ARG H2 H N N 86 ARG HA H N N 87 ARG HB2 H N N 88 ARG HB3 H N N 89 ARG HG2 H N N 90 ARG HG3 H N N 91 ARG HD2 H N N 92 ARG HD3 H N N 93 ARG HE H N N 94 ARG HH11 H N N 95 ARG HH12 H N N 96 ARG HH21 H N N 97 ARG HH22 H N N 98 ARG HXT H N N 99 ASN N N N N 100 ASN CA C N S 101 ASN C C N N 102 ASN O O N N 103 ASN CB C N N 104 ASN CG C N N 105 ASN OD1 O N N 106 ASN ND2 N N N 107 ASN OXT O N N 108 ASN H H N N 109 ASN H2 H N N 110 ASN HA H N N 111 ASN HB2 H N N 112 ASN HB3 H N N 113 ASN HD21 H N N 114 ASN HD22 H N N 115 ASN HXT H N N 116 ASP N N N N 117 ASP CA C N S 118 ASP C C N N 119 ASP O O N N 120 ASP CB C N N 121 ASP CG C N N 122 ASP OD1 O N N 123 ASP OD2 O N N 124 ASP OXT O N N 125 ASP H H N N 126 ASP H2 H N N 127 ASP HA H N N 128 ASP HB2 H N N 129 ASP HB3 H N N 130 ASP HD2 H N N 131 ASP HXT H N N 132 CA CA CA N N 133 CYS N N N N 134 CYS CA C N R 135 CYS C C N N 136 CYS O O N N 137 CYS CB C N N 138 CYS SG S N N 139 CYS OXT O N N 140 CYS H H N N 141 CYS H2 H N N 142 CYS HA H N N 143 CYS HB2 H N N 144 CYS HB3 H N N 145 CYS HG H N N 146 CYS HXT H N N 147 GLN N N N N 148 GLN CA C N S 149 GLN C C N N 150 GLN O O N N 151 GLN CB C N N 152 GLN CG C N N 153 GLN CD C N N 154 GLN OE1 O N N 155 GLN NE2 N N N 156 GLN OXT O N N 157 GLN H H N N 158 GLN H2 H N N 159 GLN HA H N N 160 GLN HB2 H N N 161 GLN HB3 H N N 162 GLN HG2 H N N 163 GLN HG3 H N N 164 GLN HE21 H N N 165 GLN HE22 H N N 166 GLN HXT H N N 167 GLU N N N N 168 GLU CA C N S 169 GLU C C N N 170 GLU O O N N 171 GLU CB C N N 172 GLU CG C N N 173 GLU CD C N N 174 GLU OE1 O N N 175 GLU OE2 O N N 176 GLU OXT O N N 177 GLU H H N N 178 GLU H2 H N N 179 GLU HA H N N 180 GLU HB2 H N N 181 GLU HB3 H N N 182 GLU HG2 H N N 183 GLU HG3 H N N 184 GLU HE2 H N N 185 GLU HXT H N N 186 GLY N N N N 187 GLY CA C N N 188 GLY C C N N 189 GLY O O N N 190 GLY OXT O N N 191 GLY H H N N 192 GLY H2 H N N 193 GLY HA2 H N N 194 GLY HA3 H N N 195 GLY HXT H N N 196 HIS N N N N 197 HIS CA C N S 198 HIS C C N N 199 HIS O O N N 200 HIS CB C N N 201 HIS CG C Y N 202 HIS ND1 N Y N 203 HIS CD2 C Y N 204 HIS CE1 C Y N 205 HIS NE2 N Y N 206 HIS OXT O N N 207 HIS H H N N 208 HIS H2 H N N 209 HIS HA H N N 210 HIS HB2 H N N 211 HIS HB3 H N N 212 HIS HD1 H N N 213 HIS HD2 H N N 214 HIS HE1 H N N 215 HIS HE2 H N N 216 HIS HXT H N N 217 HOH O O N N 218 HOH H1 H N N 219 HOH H2 H N N 220 ILE N N N N 221 ILE CA C N S 222 ILE C C N N 223 ILE O O N N 224 ILE CB C N S 225 ILE CG1 C N N 226 ILE CG2 C N N 227 ILE CD1 C N N 228 ILE OXT O N N 229 ILE H H N N 230 ILE H2 H N N 231 ILE HA H N N 232 ILE HB H N N 233 ILE HG12 H N N 234 ILE HG13 H N N 235 ILE HG21 H N N 236 ILE HG22 H N N 237 ILE HG23 H N N 238 ILE HD11 H N N 239 ILE HD12 H N N 240 ILE HD13 H N N 241 ILE HXT H N N 242 LEU N N N N 243 LEU CA C N S 244 LEU C C N N 245 LEU O O N N 246 LEU CB C N N 247 LEU CG C N N 248 LEU CD1 C N N 249 LEU CD2 C N N 250 LEU OXT O N N 251 LEU H H N N 252 LEU H2 H N N 253 LEU HA H N N 254 LEU HB2 H N N 255 LEU HB3 H N N 256 LEU HG H N N 257 LEU HD11 H N N 258 LEU HD12 H N N 259 LEU HD13 H N N 260 LEU HD21 H N N 261 LEU HD22 H N N 262 LEU HD23 H N N 263 LEU HXT H N N 264 LYS N N N N 265 LYS CA C N S 266 LYS C C N N 267 LYS O O N N 268 LYS CB C N N 269 LYS CG C N N 270 LYS CD C N N 271 LYS CE C N N 272 LYS NZ N N N 273 LYS OXT O N N 274 LYS H H N N 275 LYS H2 H N N 276 LYS HA H N N 277 LYS HB2 H N N 278 LYS HB3 H N N 279 LYS HG2 H N N 280 LYS HG3 H N N 281 LYS HD2 H N N 282 LYS HD3 H N N 283 LYS HE2 H N N 284 LYS HE3 H N N 285 LYS HZ1 H N N 286 LYS HZ2 H N N 287 LYS HZ3 H N N 288 LYS HXT H N N 289 MET N N N N 290 MET CA C N S 291 MET C C N N 292 MET O O N N 293 MET CB C N N 294 MET CG C N N 295 MET SD S N N 296 MET CE C N N 297 MET OXT O N N 298 MET H H N N 299 MET H2 H N N 300 MET HA H N N 301 MET HB2 H N N 302 MET HB3 H N N 303 MET HG2 H N N 304 MET HG3 H N N 305 MET HE1 H N N 306 MET HE2 H N N 307 MET HE3 H N N 308 MET HXT H N N 309 PHE N N N N 310 PHE CA C N S 311 PHE C C N N 312 PHE O O N N 313 PHE CB C N N 314 PHE CG C Y N 315 PHE CD1 C Y N 316 PHE CD2 C Y N 317 PHE CE1 C Y N 318 PHE CE2 C Y N 319 PHE CZ C Y N 320 PHE OXT O N N 321 PHE H H N N 322 PHE H2 H N N 323 PHE HA H N N 324 PHE HB2 H N N 325 PHE HB3 H N N 326 PHE HD1 H N N 327 PHE HD2 H N N 328 PHE HE1 H N N 329 PHE HE2 H N N 330 PHE HZ H N N 331 PHE HXT H N N 332 PRO N N N N 333 PRO CA C N S 334 PRO C C N N 335 PRO O O N N 336 PRO CB C N N 337 PRO CG C N N 338 PRO CD C N N 339 PRO OXT O N N 340 PRO H H N N 341 PRO HA H N N 342 PRO HB2 H N N 343 PRO HB3 H N N 344 PRO HG2 H N N 345 PRO HG3 H N N 346 PRO HD2 H N N 347 PRO HD3 H N N 348 PRO HXT H N N 349 SER N N N N 350 SER CA C N S 351 SER C C N N 352 SER O O N N 353 SER CB C N N 354 SER OG O N N 355 SER OXT O N N 356 SER H H N N 357 SER H2 H N N 358 SER HA H N N 359 SER HB2 H N N 360 SER HB3 H N N 361 SER HG H N N 362 SER HXT H N N 363 THR N N N N 364 THR CA C N S 365 THR C C N N 366 THR O O N N 367 THR CB C N R 368 THR OG1 O N N 369 THR CG2 C N N 370 THR OXT O N N 371 THR H H N N 372 THR H2 H N N 373 THR HA H N N 374 THR HB H N N 375 THR HG1 H N N 376 THR HG21 H N N 377 THR HG22 H N N 378 THR HG23 H N N 379 THR HXT H N N 380 TRP N N N N 381 TRP CA C N S 382 TRP C C N N 383 TRP O O N N 384 TRP CB C N N 385 TRP CG C Y N 386 TRP CD1 C Y N 387 TRP CD2 C Y N 388 TRP NE1 N Y N 389 TRP CE2 C Y N 390 TRP CE3 C Y N 391 TRP CZ2 C Y N 392 TRP CZ3 C Y N 393 TRP CH2 C Y N 394 TRP OXT O N N 395 TRP H H N N 396 TRP H2 H N N 397 TRP HA H N N 398 TRP HB2 H N N 399 TRP HB3 H N N 400 TRP HD1 H N N 401 TRP HE1 H N N 402 TRP HE3 H N N 403 TRP HZ2 H N N 404 TRP HZ3 H N N 405 TRP HH2 H N N 406 TRP HXT H N N 407 TYR N N N N 408 TYR CA C N S 409 TYR C C N N 410 TYR O O N N 411 TYR CB C N N 412 TYR CG C Y N 413 TYR CD1 C Y N 414 TYR CD2 C Y N 415 TYR CE1 C Y N 416 TYR CE2 C Y N 417 TYR CZ C Y N 418 TYR OH O N N 419 TYR OXT O N N 420 TYR H H N N 421 TYR H2 H N N 422 TYR HA H N N 423 TYR HB2 H N N 424 TYR HB3 H N N 425 TYR HD1 H N N 426 TYR HD2 H N N 427 TYR HE1 H N N 428 TYR HE2 H N N 429 TYR HH H N N 430 TYR HXT H N N 431 VAL N N N N 432 VAL CA C N S 433 VAL C C N N 434 VAL O O N N 435 VAL CB C N N 436 VAL CG1 C N N 437 VAL CG2 C N N 438 VAL OXT O N N 439 VAL H H N N 440 VAL H2 H N N 441 VAL HA H N N 442 VAL HB H N N 443 VAL HG11 H N N 444 VAL HG12 H N N 445 VAL HG13 H N N 446 VAL HG21 H N N 447 VAL HG22 H N N 448 VAL HG23 H N N 449 VAL HXT H N N 450 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 1N1 C1 C2 doub Y N 1 1N1 C1 N1 sing Y N 2 1N1 C1 H1 sing N N 3 1N1 C2 C3 sing N N 4 1N1 C2 S sing Y N 5 1N1 C3 N2 sing N N 6 1N1 C3 O doub N N 7 1N1 N6 C20 sing N N 8 1N1 N6 C17 sing N N 9 1N1 N6 C18 sing N N 10 1N1 C7 C8 doub Y N 11 1N1 C7 C6 sing Y N 12 1N1 C7 H7 sing N N 13 1N1 C8 C9 sing Y N 14 1N1 C8 H8 sing N N 15 1N1 C9 C10 sing N N 16 1N1 C9 C4 doub Y N 17 1N1 C10 H101 sing N N 18 1N1 C10 H102 sing N N 19 1N1 C10 H103 sing N N 20 1N1 C11 C12 sing Y N 21 1N1 C11 N sing N N 22 1N1 C11 N4 doub Y N 23 1N1 C12 C13 doub Y N 24 1N1 C12 H12 sing N N 25 1N1 C13 N3 sing Y N 26 1N1 C13 N5 sing N N 27 1N1 C14 C15 sing N N 28 1N1 C14 N3 doub Y N 29 1N1 C14 N4 sing Y N 30 1N1 C15 H151 sing N N 31 1N1 C15 H152 sing N N 32 1N1 C15 H153 sing N N 33 1N1 C16 N5 sing N N 34 1N1 C16 C17 sing N N 35 1N1 C16 H161 sing N N 36 1N1 C16 H162 sing N N 37 1N1 C19 N5 sing N N 38 1N1 C19 C18 sing N N 39 1N1 C19 H191 sing N N 40 1N1 C19 H192 sing N N 41 1N1 C20 C21 sing N N 42 1N1 C20 H201 sing N N 43 1N1 C20 H202 sing N N 44 1N1 C21 O1 sing N N 45 1N1 C21 H211 sing N N 46 1N1 C21 H212 sing N N 47 1N1 N C sing N N 48 1N1 N HN sing N N 49 1N1 C N1 doub Y N 50 1N1 C S sing Y N 51 1N1 N2 C4 sing N N 52 1N1 N2 HN2 sing N N 53 1N1 C4 C5 sing Y N 54 1N1 C5 C6 doub Y N 55 1N1 C5 CL sing N N 56 1N1 C6 H6 sing N N 57 1N1 C17 H171 sing N N 58 1N1 C17 H172 sing N N 59 1N1 C18 H181 sing N N 60 1N1 C18 H182 sing N N 61 1N1 O1 HO1 sing N N 62 ALA N CA sing N N 63 ALA N H sing N N 64 ALA N H2 sing N N 65 ALA CA C sing N N 66 ALA CA CB sing N N 67 ALA CA HA sing N N 68 ALA C O doub N N 69 ALA C OXT sing N N 70 ALA CB HB1 sing N N 71 ALA CB HB2 sing N N 72 ALA CB HB3 sing N N 73 ALA OXT HXT sing N N 74 ARG N CA sing N N 75 ARG N H sing N N 76 ARG N H2 sing N N 77 ARG CA C sing N N 78 ARG CA CB sing N N 79 ARG CA HA sing N N 80 ARG C O doub N N 81 ARG C OXT sing N N 82 ARG CB CG sing N N 83 ARG CB HB2 sing N N 84 ARG CB HB3 sing N N 85 ARG CG CD sing N N 86 ARG CG HG2 sing N N 87 ARG CG HG3 sing N N 88 ARG CD NE sing N N 89 ARG CD HD2 sing N N 90 ARG CD HD3 sing N N 91 ARG NE CZ sing N N 92 ARG NE HE sing N N 93 ARG CZ NH1 sing N N 94 ARG CZ NH2 doub N N 95 ARG NH1 HH11 sing N N 96 ARG NH1 HH12 sing N N 97 ARG NH2 HH21 sing N N 98 ARG NH2 HH22 sing N N 99 ARG OXT HXT sing N N 100 ASN N CA sing N N 101 ASN N H sing N N 102 ASN N H2 sing N N 103 ASN CA C sing N N 104 ASN CA CB sing N N 105 ASN CA HA sing N N 106 ASN C O doub N N 107 ASN C OXT sing N N 108 ASN CB CG sing N N 109 ASN CB HB2 sing N N 110 ASN CB HB3 sing N N 111 ASN CG OD1 doub N N 112 ASN CG ND2 sing N N 113 ASN ND2 HD21 sing N N 114 ASN ND2 HD22 sing N N 115 ASN OXT HXT sing N N 116 ASP N CA sing N N 117 ASP N H sing N N 118 ASP N H2 sing N N 119 ASP CA C sing N N 120 ASP CA CB sing N N 121 ASP CA HA sing N N 122 ASP C O doub N N 123 ASP C OXT sing N N 124 ASP CB CG sing N N 125 ASP CB HB2 sing N N 126 ASP CB HB3 sing N N 127 ASP CG OD1 doub N N 128 ASP CG OD2 sing N N 129 ASP OD2 HD2 sing N N 130 ASP OXT HXT sing N N 131 CYS N CA sing N N 132 CYS N H sing N N 133 CYS N H2 sing N N 134 CYS CA C sing N N 135 CYS CA CB sing N N 136 CYS CA HA sing N N 137 CYS C O doub N N 138 CYS C OXT sing N N 139 CYS CB SG sing N N 140 CYS CB HB2 sing N N 141 CYS CB HB3 sing N N 142 CYS SG HG sing N N 143 CYS OXT HXT sing N N 144 GLN N CA sing N N 145 GLN N H sing N N 146 GLN N H2 sing N N 147 GLN CA C sing N N 148 GLN CA CB sing N N 149 GLN CA HA sing N N 150 GLN C O doub N N 151 GLN C OXT sing N N 152 GLN CB CG sing N N 153 GLN CB HB2 sing N N 154 GLN CB HB3 sing N N 155 GLN CG CD sing N N 156 GLN CG HG2 sing N N 157 GLN CG HG3 sing N N 158 GLN CD OE1 doub N N 159 GLN CD NE2 sing N N 160 GLN NE2 HE21 sing N N 161 GLN NE2 HE22 sing N N 162 GLN OXT HXT sing N N 163 GLU N CA sing N N 164 GLU N H sing N N 165 GLU N H2 sing N N 166 GLU CA C sing N N 167 GLU CA CB sing N N 168 GLU CA HA sing N N 169 GLU C O doub N N 170 GLU C OXT sing N N 171 GLU CB CG sing N N 172 GLU CB HB2 sing N N 173 GLU CB HB3 sing N N 174 GLU CG CD sing N N 175 GLU CG HG2 sing N N 176 GLU CG HG3 sing N N 177 GLU CD OE1 doub N N 178 GLU CD OE2 sing N N 179 GLU OE2 HE2 sing N N 180 GLU OXT HXT sing N N 181 GLY N CA sing N N 182 GLY N H sing N N 183 GLY N H2 sing N N 184 GLY CA C sing N N 185 GLY CA HA2 sing N N 186 GLY CA HA3 sing N N 187 GLY C O doub N N 188 GLY C OXT sing N N 189 GLY OXT HXT sing N N 190 HIS N CA sing N N 191 HIS N H sing N N 192 HIS N H2 sing N N 193 HIS CA C sing N N 194 HIS CA CB sing N N 195 HIS CA HA sing N N 196 HIS C O doub N N 197 HIS C OXT sing N N 198 HIS CB CG sing N N 199 HIS CB HB2 sing N N 200 HIS CB HB3 sing N N 201 HIS CG ND1 sing Y N 202 HIS CG CD2 doub Y N 203 HIS ND1 CE1 doub Y N 204 HIS ND1 HD1 sing N N 205 HIS CD2 NE2 sing Y N 206 HIS CD2 HD2 sing N N 207 HIS CE1 NE2 sing Y N 208 HIS CE1 HE1 sing N N 209 HIS NE2 HE2 sing N N 210 HIS OXT HXT sing N N 211 HOH O H1 sing N N 212 HOH O H2 sing N N 213 ILE N CA sing N N 214 ILE N H sing N N 215 ILE N H2 sing N N 216 ILE CA C sing N N 217 ILE CA CB sing N N 218 ILE CA HA sing N N 219 ILE C O doub N N 220 ILE C OXT sing N N 221 ILE CB CG1 sing N N 222 ILE CB CG2 sing N N 223 ILE CB HB sing N N 224 ILE CG1 CD1 sing N N 225 ILE CG1 HG12 sing N N 226 ILE CG1 HG13 sing N N 227 ILE CG2 HG21 sing N N 228 ILE CG2 HG22 sing N N 229 ILE CG2 HG23 sing N N 230 ILE CD1 HD11 sing N N 231 ILE CD1 HD12 sing N N 232 ILE CD1 HD13 sing N N 233 ILE OXT HXT sing N N 234 LEU N CA sing N N 235 LEU N H sing N N 236 LEU N H2 sing N N 237 LEU CA C sing N N 238 LEU CA CB sing N N 239 LEU CA HA sing N N 240 LEU C O doub N N 241 LEU C OXT sing N N 242 LEU CB CG sing N N 243 LEU CB HB2 sing N N 244 LEU CB HB3 sing N N 245 LEU CG CD1 sing N N 246 LEU CG CD2 sing N N 247 LEU CG HG sing N N 248 LEU CD1 HD11 sing N N 249 LEU CD1 HD12 sing N N 250 LEU CD1 HD13 sing N N 251 LEU CD2 HD21 sing N N 252 LEU CD2 HD22 sing N N 253 LEU CD2 HD23 sing N N 254 LEU OXT HXT sing N N 255 LYS N CA sing N N 256 LYS N H sing N N 257 LYS N H2 sing N N 258 LYS CA C sing N N 259 LYS CA CB sing N N 260 LYS CA HA sing N N 261 LYS C O doub N N 262 LYS C OXT sing N N 263 LYS CB CG sing N N 264 LYS CB HB2 sing N N 265 LYS CB HB3 sing N N 266 LYS CG CD sing N N 267 LYS CG HG2 sing N N 268 LYS CG HG3 sing N N 269 LYS CD CE sing N N 270 LYS CD HD2 sing N N 271 LYS CD HD3 sing N N 272 LYS CE NZ sing N N 273 LYS CE HE2 sing N N 274 LYS CE HE3 sing N N 275 LYS NZ HZ1 sing N N 276 LYS NZ HZ2 sing N N 277 LYS NZ HZ3 sing N N 278 LYS OXT HXT sing N N 279 MET N CA sing N N 280 MET N H sing N N 281 MET N H2 sing N N 282 MET CA C sing N N 283 MET CA CB sing N N 284 MET CA HA sing N N 285 MET C O doub N N 286 MET C OXT sing N N 287 MET CB CG sing N N 288 MET CB HB2 sing N N 289 MET CB HB3 sing N N 290 MET CG SD sing N N 291 MET CG HG2 sing N N 292 MET CG HG3 sing N N 293 MET SD CE sing N N 294 MET CE HE1 sing N N 295 MET CE HE2 sing N N 296 MET CE HE3 sing N N 297 MET OXT HXT sing N N 298 PHE N CA sing N N 299 PHE N H sing N N 300 PHE N H2 sing N N 301 PHE CA C sing N N 302 PHE CA CB sing N N 303 PHE CA HA sing N N 304 PHE C O doub N N 305 PHE C OXT sing N N 306 PHE CB CG sing N N 307 PHE CB HB2 sing N N 308 PHE CB HB3 sing N N 309 PHE CG CD1 doub Y N 310 PHE CG CD2 sing Y N 311 PHE CD1 CE1 sing Y N 312 PHE CD1 HD1 sing N N 313 PHE CD2 CE2 doub Y N 314 PHE CD2 HD2 sing N N 315 PHE CE1 CZ doub Y N 316 PHE CE1 HE1 sing N N 317 PHE CE2 CZ sing Y N 318 PHE CE2 HE2 sing N N 319 PHE CZ HZ sing N N 320 PHE OXT HXT sing N N 321 PRO N CA sing N N 322 PRO N CD sing N N 323 PRO N H sing N N 324 PRO CA C sing N N 325 PRO CA CB sing N N 326 PRO CA HA sing N N 327 PRO C O doub N N 328 PRO C OXT sing N N 329 PRO CB CG sing N N 330 PRO CB HB2 sing N N 331 PRO CB HB3 sing N N 332 PRO CG CD sing N N 333 PRO CG HG2 sing N N 334 PRO CG HG3 sing N N 335 PRO CD HD2 sing N N 336 PRO CD HD3 sing N N 337 PRO OXT HXT sing N N 338 SER N CA sing N N 339 SER N H sing N N 340 SER N H2 sing N N 341 SER CA C sing N N 342 SER CA CB sing N N 343 SER CA HA sing N N 344 SER C O doub N N 345 SER C OXT sing N N 346 SER CB OG sing N N 347 SER CB HB2 sing N N 348 SER CB HB3 sing N N 349 SER OG HG sing N N 350 SER OXT HXT sing N N 351 THR N CA sing N N 352 THR N H sing N N 353 THR N H2 sing N N 354 THR CA C sing N N 355 THR CA CB sing N N 356 THR CA HA sing N N 357 THR C O doub N N 358 THR C OXT sing N N 359 THR CB OG1 sing N N 360 THR CB CG2 sing N N 361 THR CB HB sing N N 362 THR OG1 HG1 sing N N 363 THR CG2 HG21 sing N N 364 THR CG2 HG22 sing N N 365 THR CG2 HG23 sing N N 366 THR OXT HXT sing N N 367 TRP N CA sing N N 368 TRP N H sing N N 369 TRP N H2 sing N N 370 TRP CA C sing N N 371 TRP CA CB sing N N 372 TRP CA HA sing N N 373 TRP C O doub N N 374 TRP C OXT sing N N 375 TRP CB CG sing N N 376 TRP CB HB2 sing N N 377 TRP CB HB3 sing N N 378 TRP CG CD1 doub Y N 379 TRP CG CD2 sing Y N 380 TRP CD1 NE1 sing Y N 381 TRP CD1 HD1 sing N N 382 TRP CD2 CE2 doub Y N 383 TRP CD2 CE3 sing Y N 384 TRP NE1 CE2 sing Y N 385 TRP NE1 HE1 sing N N 386 TRP CE2 CZ2 sing Y N 387 TRP CE3 CZ3 doub Y N 388 TRP CE3 HE3 sing N N 389 TRP CZ2 CH2 doub Y N 390 TRP CZ2 HZ2 sing N N 391 TRP CZ3 CH2 sing Y N 392 TRP CZ3 HZ3 sing N N 393 TRP CH2 HH2 sing N N 394 TRP OXT HXT sing N N 395 TYR N CA sing N N 396 TYR N H sing N N 397 TYR N H2 sing N N 398 TYR CA C sing N N 399 TYR CA CB sing N N 400 TYR CA HA sing N N 401 TYR C O doub N N 402 TYR C OXT sing N N 403 TYR CB CG sing N N 404 TYR CB HB2 sing N N 405 TYR CB HB3 sing N N 406 TYR CG CD1 doub Y N 407 TYR CG CD2 sing Y N 408 TYR CD1 CE1 sing Y N 409 TYR CD1 HD1 sing N N 410 TYR CD2 CE2 doub Y N 411 TYR CD2 HD2 sing N N 412 TYR CE1 CZ doub Y N 413 TYR CE1 HE1 sing N N 414 TYR CE2 CZ sing Y N 415 TYR CE2 HE2 sing N N 416 TYR CZ OH sing N N 417 TYR OH HH sing N N 418 TYR OXT HXT sing N N 419 VAL N CA sing N N 420 VAL N H sing N N 421 VAL N H2 sing N N 422 VAL CA C sing N N 423 VAL CA CB sing N N 424 VAL CA HA sing N N 425 VAL C O doub N N 426 VAL C OXT sing N N 427 VAL CB CG1 sing N N 428 VAL CB CG2 sing N N 429 VAL CB HB sing N N 430 VAL CG1 HG11 sing N N 431 VAL CG1 HG12 sing N N 432 VAL CG1 HG13 sing N N 433 VAL CG2 HG21 sing N N 434 VAL CG2 HG22 sing N N 435 VAL CG2 HG23 sing N N 436 VAL OXT HXT sing N N 437 # _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type other _pdbx_initial_refinement_model.source_name ? _pdbx_initial_refinement_model.details STK10 # _atom_sites.entry_id 5OWR _atom_sites.fract_transf_matrix[1][1] 0.020105 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008951 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007510 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA CL N O S # loop_