data_5TLQ # _entry.id 5TLQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5TLQ pdb_00005tlq 10.2210/pdb5tlq/pdb WWPDB D_1000224449 ? ? BMRB 30189 ? ? # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 2017-04-12 _pdbx_database_PDB_obs_spr.pdb_id 5TLQ _pdbx_database_PDB_obs_spr.replace_pdb_id 2MBU _pdbx_database_PDB_obs_spr.details ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type BMRB . 19414 re-refinement BMRB 'Model structure of oxidized PaDsbA1 and 3-((2-methylbenzyl)thio)-4H-1,2,4-triazol-4-amine complex' 30189 unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5TLQ _pdbx_database_status.recvd_initial_deposition_date 2016-10-11 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Mohanty, B.' 1 'Rimmer, K.A.' 2 'McMahon, R.M.' 3 'Headey, S.J.' 4 'Vazirani, M.' 5 'Shouldice, S.R.' 6 'Coincon, M.' 7 'Tay, S.' 8 'Morton, C.J.' 9 'Simpson, J.S.' 10 'Martin, J.L.' 11 'Scanlon, M.S.' 12 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'PLoS ONE' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1932-6203 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 12 _citation.language ? _citation.page_first e0173436 _citation.page_last e0173436 _citation.title 'Fragment library screening identifies hits that bind to the non-catalytic surface of Pseudomonas aeruginosa DsbA1.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1371/journal.pone.0173436 _citation.pdbx_database_id_PubMed 28346540 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mohanty, B.' 1 ? primary 'Rimmer, K.' 2 ? primary 'McMahon, R.M.' 3 ? primary 'Headey, S.J.' 4 ? primary 'Vazirani, M.' 5 ? primary 'Shouldice, S.R.' 6 ? primary 'Coincon, M.' 7 ? primary 'Tay, S.' 8 ? primary 'Morton, C.J.' 9 ? primary 'Simpson, J.S.' 10 ? primary 'Martin, J.L.' 11 ? primary 'Scanlon, M.J.' 12 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Thiol:disulfide interchange protein DsbA' 21152.260 1 ? ? ? ? 2 non-polymer syn '3-[(2-methylbenzyl)sulfanyl]-4H-1,2,4-triazol-4-amine' 220.294 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GDDYTAGKEYVELSSPVPVSQPGKIEVVELFWYGCPHCYAFEPTIVPWSEKLPADVHFVRLPALFGGIWNVHGQMFLTLE SMGVEHDVHNAVFEAIHKEHKKLATPEEMADFLAGKGVDKEKFLSTYNSFAIKGQMEKAKKLAMAYQVTGVPTMVVNGKY RFDIGSAGGPEETLKLADYLIEKERAAAKK ; _entity_poly.pdbx_seq_one_letter_code_can ;GDDYTAGKEYVELSSPVPVSQPGKIEVVELFWYGCPHCYAFEPTIVPWSEKLPADVHFVRLPALFGGIWNVHGQMFLTLE SMGVEHDVHNAVFEAIHKEHKKLATPEEMADFLAGKGVDKEKFLSTYNSFAIKGQMEKAKKLAMAYQVTGVPTMVVNGKY RFDIGSAGGPEETLKLADYLIEKERAAAKK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ASP n 1 3 ASP n 1 4 TYR n 1 5 THR n 1 6 ALA n 1 7 GLY n 1 8 LYS n 1 9 GLU n 1 10 TYR n 1 11 VAL n 1 12 GLU n 1 13 LEU n 1 14 SER n 1 15 SER n 1 16 PRO n 1 17 VAL n 1 18 PRO n 1 19 VAL n 1 20 SER n 1 21 GLN n 1 22 PRO n 1 23 GLY n 1 24 LYS n 1 25 ILE n 1 26 GLU n 1 27 VAL n 1 28 VAL n 1 29 GLU n 1 30 LEU n 1 31 PHE n 1 32 TRP n 1 33 TYR n 1 34 GLY n 1 35 CYS n 1 36 PRO n 1 37 HIS n 1 38 CYS n 1 39 TYR n 1 40 ALA n 1 41 PHE n 1 42 GLU n 1 43 PRO n 1 44 THR n 1 45 ILE n 1 46 VAL n 1 47 PRO n 1 48 TRP n 1 49 SER n 1 50 GLU n 1 51 LYS n 1 52 LEU n 1 53 PRO n 1 54 ALA n 1 55 ASP n 1 56 VAL n 1 57 HIS n 1 58 PHE n 1 59 VAL n 1 60 ARG n 1 61 LEU n 1 62 PRO n 1 63 ALA n 1 64 LEU n 1 65 PHE n 1 66 GLY n 1 67 GLY n 1 68 ILE n 1 69 TRP n 1 70 ASN n 1 71 VAL n 1 72 HIS n 1 73 GLY n 1 74 GLN n 1 75 MET n 1 76 PHE n 1 77 LEU n 1 78 THR n 1 79 LEU n 1 80 GLU n 1 81 SER n 1 82 MET n 1 83 GLY n 1 84 VAL n 1 85 GLU n 1 86 HIS n 1 87 ASP n 1 88 VAL n 1 89 HIS n 1 90 ASN n 1 91 ALA n 1 92 VAL n 1 93 PHE n 1 94 GLU n 1 95 ALA n 1 96 ILE n 1 97 HIS n 1 98 LYS n 1 99 GLU n 1 100 HIS n 1 101 LYS n 1 102 LYS n 1 103 LEU n 1 104 ALA n 1 105 THR n 1 106 PRO n 1 107 GLU n 1 108 GLU n 1 109 MET n 1 110 ALA n 1 111 ASP n 1 112 PHE n 1 113 LEU n 1 114 ALA n 1 115 GLY n 1 116 LYS n 1 117 GLY n 1 118 VAL n 1 119 ASP n 1 120 LYS n 1 121 GLU n 1 122 LYS n 1 123 PHE n 1 124 LEU n 1 125 SER n 1 126 THR n 1 127 TYR n 1 128 ASN n 1 129 SER n 1 130 PHE n 1 131 ALA n 1 132 ILE n 1 133 LYS n 1 134 GLY n 1 135 GLN n 1 136 MET n 1 137 GLU n 1 138 LYS n 1 139 ALA n 1 140 LYS n 1 141 LYS n 1 142 LEU n 1 143 ALA n 1 144 MET n 1 145 ALA n 1 146 TYR n 1 147 GLN n 1 148 VAL n 1 149 THR n 1 150 GLY n 1 151 VAL n 1 152 PRO n 1 153 THR n 1 154 MET n 1 155 VAL n 1 156 VAL n 1 157 ASN n 1 158 GLY n 1 159 LYS n 1 160 TYR n 1 161 ARG n 1 162 PHE n 1 163 ASP n 1 164 ILE n 1 165 GLY n 1 166 SER n 1 167 ALA n 1 168 GLY n 1 169 GLY n 1 170 PRO n 1 171 GLU n 1 172 GLU n 1 173 THR n 1 174 LEU n 1 175 LYS n 1 176 LEU n 1 177 ALA n 1 178 ASP n 1 179 TYR n 1 180 LEU n 1 181 ILE n 1 182 GLU n 1 183 LYS n 1 184 GLU n 1 185 ARG n 1 186 ALA n 1 187 ALA n 1 188 ALA n 1 189 LYS n 1 190 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 190 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'dsbA, PA5489' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas aeruginosa' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 208964 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli K-12' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 83333 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line 'BL21(DE3)-Gold' _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DSBA_PSEAE _struct_ref.pdbx_db_accession P0C2B2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;DDYTAGKEYVELSSPVPVSQPGKIEVVELFWYGCPHCYAFEPTIVPWSEKLPADVHFVRLPALFGGIWNVHGQMFLTLES MGVEHDVHNAVFEAIHKEHKKLATPEEMADFLAGKGVDKEKFLSTYNSFAIKGQMEKAKKLAMAYQVTGVPTMVVNGKYR FDIGSAGGPEETLKLADYLIEKERAAAKK ; _struct_ref.pdbx_align_begin 23 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5TLQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 190 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0C2B2 _struct_ref_seq.db_align_beg 23 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 211 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 192 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 5TLQ _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P0C2B2 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 3 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 1YO non-polymer . '3-[(2-methylbenzyl)sulfanyl]-4H-1,2,4-triazol-4-amine' ? 'C10 H12 N4 S' 220.294 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-13C HSQC' 1 isotropic 3 1 1 '3D F1-13C,15N filtered F3-13Cedited [1H,1H]-NOESY' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units bar _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.ionic_strength '50 mM NaCl and 50 mM sodium phosphate' _pdbx_nmr_exptl_sample_conditions.details ;300 uM PaDsbA1; 3.3 mM 3-((2-methylbenzyl)thio)-4H-1,2,4-triazol-4-amine; 1.7% D6-DMSO; 50 mM sodium phosphate; 50 mM sodium Chloride; 0.02% sodium azide ; _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units 'Not defined' _pdbx_nmr_exptl_sample_conditions.label condition_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.3 mM [U-98% 13C; U-98% 15N] PaDsbA1, 3.3 mM 3-((2-methylbenzyl)thio)-4H-1,2,4-triazol-4-amine, 97.3%D2O+1.7%D6-DMSO' _pdbx_nmr_sample_details.solvent_system 97.3%D2O+1.7%D6-DMSO _pdbx_nmr_sample_details.label '[U-13C,15N] PaDsbA1 and unlabelled 3-((2-methylbenzyl)thio)-4H-1,2,4-triazol-4-amine' _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ;300 uM PaDsbA1; 3.3 mM 3-((2-methylbenzyl)thio)-4H-1,2,4-triazol-4-amine; 1.7% D6-DMSO; 50 mM sodium Phosphate; 50 mM sodium Chloride; 0.02% sodium azide ; # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE II' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 5TLQ _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details '2MBT from the same group was used for HADDOCK model building' _pdbx_nmr_refine.software_ordinal 3 # _pdbx_nmr_ensemble.entry_id 5TLQ _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 5TLQ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 processing TopSpin ? 'Bruker Biospin' 2 'chemical shift assignment' CARA ? 'Keller and Wuthrich' 3 'structure calculation' HADDOCK ? Bonvin 4 'peak picking' XEASY ? 'Bartels et al.' 5 refinement HADDOCK ? Bonvin # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5TLQ _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 5TLQ _struct.title 'Model structure of the oxidized PaDsbA1 and 3-[(2-methylbenzyl)sulfanyl]-4H-1,2,4-triazol-4-amine complex' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5TLQ _struct_keywords.text 'oxidised PaDsbA1, oxidoreductase, 3-((2-methylbenzyl)thio)-4H-1, 2, 4-triazol-4-amine, HADDOCK docking' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 CYS A 35 ? ALA A 40 ? CYS A 37 ALA A 42 1 ? 6 HELX_P HELX_P2 AA2 PHE A 41 ? GLU A 50 ? PHE A 43 GLU A 52 1 ? 10 HELX_P HELX_P3 AA3 GLY A 67 ? GLY A 83 ? GLY A 69 GLY A 85 1 ? 17 HELX_P HELX_P4 AA4 ASN A 90 ? LYS A 98 ? ASN A 92 LYS A 100 1 ? 9 HELX_P HELX_P5 AA5 THR A 105 ? ALA A 114 ? THR A 107 ALA A 116 1 ? 10 HELX_P HELX_P6 AA6 GLY A 115 ? GLY A 117 ? GLY A 117 GLY A 119 5 ? 3 HELX_P HELX_P7 AA7 ASP A 119 ? ASN A 128 ? ASP A 121 ASN A 130 1 ? 10 HELX_P HELX_P8 AA8 SER A 129 ? TYR A 146 ? SER A 131 TYR A 148 1 ? 18 HELX_P HELX_P9 AA9 ASP A 163 ? GLY A 168 ? ASP A 165 GLY A 170 1 ? 6 HELX_P HELX_P10 AB1 GLY A 169 ? ARG A 185 ? GLY A 171 ARG A 187 1 ? 17 HELX_P HELX_P11 AB2 ALA A 186 ? ALA A 188 ? ALA A 188 ALA A 190 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 35 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 38 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 37 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 40 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.030 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 VAL 151 A . ? VAL 153 A PRO 152 A ? PRO 154 A 1 -0.22 2 VAL 151 A . ? VAL 153 A PRO 152 A ? PRO 154 A 2 -0.11 3 VAL 151 A . ? VAL 153 A PRO 152 A ? PRO 154 A 3 -0.53 4 VAL 151 A . ? VAL 153 A PRO 152 A ? PRO 154 A 4 -0.11 5 VAL 151 A . ? VAL 153 A PRO 152 A ? PRO 154 A 5 -0.16 6 VAL 151 A . ? VAL 153 A PRO 152 A ? PRO 154 A 6 -0.30 7 VAL 151 A . ? VAL 153 A PRO 152 A ? PRO 154 A 7 -0.40 8 VAL 151 A . ? VAL 153 A PRO 152 A ? PRO 154 A 8 -0.29 9 VAL 151 A . ? VAL 153 A PRO 152 A ? PRO 154 A 9 0.12 10 VAL 151 A . ? VAL 153 A PRO 152 A ? PRO 154 A 10 0.00 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 11 ? GLU A 12 ? VAL A 13 GLU A 14 AA1 2 TYR A 160 ? PHE A 162 ? TYR A 162 PHE A 164 AA1 3 THR A 153 ? VAL A 156 ? THR A 155 VAL A 158 AA1 4 ILE A 25 ? PHE A 31 ? ILE A 27 PHE A 33 AA1 5 VAL A 56 ? PRO A 62 ? VAL A 58 PRO A 64 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 11 ? N VAL A 13 O ARG A 161 ? O ARG A 163 AA1 2 3 O PHE A 162 ? O PHE A 164 N MET A 154 ? N MET A 156 AA1 3 4 O VAL A 155 ? O VAL A 157 N VAL A 28 ? N VAL A 30 AA1 4 5 N ILE A 25 ? N ILE A 27 O HIS A 57 ? O HIS A 59 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id 1YO _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 6 _struct_site.details 'binding site for residue 1YO A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 SER A 20 ? SER A 22 . ? 1_555 ? 2 AC1 6 GLN A 21 ? GLN A 23 . ? 1_555 ? 3 AC1 6 GLU A 26 ? GLU A 28 . ? 1_555 ? 4 AC1 6 HIS A 57 ? HIS A 59 . ? 1_555 ? 5 AC1 6 VAL A 59 ? VAL A 61 . ? 1_555 ? 6 AC1 6 LYS A 138 ? LYS A 140 . ? 1_555 ? # _atom_sites.entry_id 5TLQ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 3 3 GLY GLY A . n A 1 2 ASP 2 4 4 ASP ASP A . n A 1 3 ASP 3 5 5 ASP ASP A . n A 1 4 TYR 4 6 6 TYR TYR A . n A 1 5 THR 5 7 7 THR THR A . n A 1 6 ALA 6 8 8 ALA ALA A . n A 1 7 GLY 7 9 9 GLY GLY A . n A 1 8 LYS 8 10 10 LYS LYS A . n A 1 9 GLU 9 11 11 GLU GLU A . n A 1 10 TYR 10 12 12 TYR TYR A . n A 1 11 VAL 11 13 13 VAL VAL A . n A 1 12 GLU 12 14 14 GLU GLU A . n A 1 13 LEU 13 15 15 LEU LEU A . n A 1 14 SER 14 16 16 SER SER A . n A 1 15 SER 15 17 17 SER SER A . n A 1 16 PRO 16 18 18 PRO PRO A . n A 1 17 VAL 17 19 19 VAL VAL A . n A 1 18 PRO 18 20 20 PRO PRO A . n A 1 19 VAL 19 21 21 VAL VAL A . n A 1 20 SER 20 22 22 SER SER A . n A 1 21 GLN 21 23 23 GLN GLN A . n A 1 22 PRO 22 24 24 PRO PRO A . n A 1 23 GLY 23 25 25 GLY GLY A . n A 1 24 LYS 24 26 26 LYS LYS A . n A 1 25 ILE 25 27 27 ILE ILE A . n A 1 26 GLU 26 28 28 GLU GLU A . n A 1 27 VAL 27 29 29 VAL VAL A . n A 1 28 VAL 28 30 30 VAL VAL A . n A 1 29 GLU 29 31 31 GLU GLU A . n A 1 30 LEU 30 32 32 LEU LEU A . n A 1 31 PHE 31 33 33 PHE PHE A . n A 1 32 TRP 32 34 34 TRP TRP A . n A 1 33 TYR 33 35 35 TYR TYR A . n A 1 34 GLY 34 36 36 GLY GLY A . n A 1 35 CYS 35 37 37 CYS CYS A . n A 1 36 PRO 36 38 38 PRO PRO A . n A 1 37 HIS 37 39 39 HIS HIS A . n A 1 38 CYS 38 40 40 CYS CYS A . n A 1 39 TYR 39 41 41 TYR TYR A . n A 1 40 ALA 40 42 42 ALA ALA A . n A 1 41 PHE 41 43 43 PHE PHE A . n A 1 42 GLU 42 44 44 GLU GLU A . n A 1 43 PRO 43 45 45 PRO PRO A . n A 1 44 THR 44 46 46 THR THR A . n A 1 45 ILE 45 47 47 ILE ILE A . n A 1 46 VAL 46 48 48 VAL VAL A . n A 1 47 PRO 47 49 49 PRO PRO A . n A 1 48 TRP 48 50 50 TRP TRP A . n A 1 49 SER 49 51 51 SER SER A . n A 1 50 GLU 50 52 52 GLU GLU A . n A 1 51 LYS 51 53 53 LYS LYS A . n A 1 52 LEU 52 54 54 LEU LEU A . n A 1 53 PRO 53 55 55 PRO PRO A . n A 1 54 ALA 54 56 56 ALA ALA A . n A 1 55 ASP 55 57 57 ASP ASP A . n A 1 56 VAL 56 58 58 VAL VAL A . n A 1 57 HIS 57 59 59 HIS HIS A . n A 1 58 PHE 58 60 60 PHE PHE A . n A 1 59 VAL 59 61 61 VAL VAL A . n A 1 60 ARG 60 62 62 ARG ARG A . n A 1 61 LEU 61 63 63 LEU LEU A . n A 1 62 PRO 62 64 64 PRO PRO A . n A 1 63 ALA 63 65 65 ALA ALA A . n A 1 64 LEU 64 66 66 LEU LEU A . n A 1 65 PHE 65 67 67 PHE PHE A . n A 1 66 GLY 66 68 68 GLY GLY A . n A 1 67 GLY 67 69 69 GLY GLY A . n A 1 68 ILE 68 70 70 ILE ILE A . n A 1 69 TRP 69 71 71 TRP TRP A . n A 1 70 ASN 70 72 72 ASN ASN A . n A 1 71 VAL 71 73 73 VAL VAL A . n A 1 72 HIS 72 74 74 HIS HIS A . n A 1 73 GLY 73 75 75 GLY GLY A . n A 1 74 GLN 74 76 76 GLN GLN A . n A 1 75 MET 75 77 77 MET MET A . n A 1 76 PHE 76 78 78 PHE PHE A . n A 1 77 LEU 77 79 79 LEU LEU A . n A 1 78 THR 78 80 80 THR THR A . n A 1 79 LEU 79 81 81 LEU LEU A . n A 1 80 GLU 80 82 82 GLU GLU A . n A 1 81 SER 81 83 83 SER SER A . n A 1 82 MET 82 84 84 MET MET A . n A 1 83 GLY 83 85 85 GLY GLY A . n A 1 84 VAL 84 86 86 VAL VAL A . n A 1 85 GLU 85 87 87 GLU GLU A . n A 1 86 HIS 86 88 88 HIS HIS A . n A 1 87 ASP 87 89 89 ASP ASP A . n A 1 88 VAL 88 90 90 VAL VAL A . n A 1 89 HIS 89 91 91 HIS HIS A . n A 1 90 ASN 90 92 92 ASN ASN A . n A 1 91 ALA 91 93 93 ALA ALA A . n A 1 92 VAL 92 94 94 VAL VAL A . n A 1 93 PHE 93 95 95 PHE PHE A . n A 1 94 GLU 94 96 96 GLU GLU A . n A 1 95 ALA 95 97 97 ALA ALA A . n A 1 96 ILE 96 98 98 ILE ILE A . n A 1 97 HIS 97 99 99 HIS HIS A . n A 1 98 LYS 98 100 100 LYS LYS A . n A 1 99 GLU 99 101 101 GLU GLU A . n A 1 100 HIS 100 102 102 HIS HIS A . n A 1 101 LYS 101 103 103 LYS LYS A . n A 1 102 LYS 102 104 104 LYS LYS A . n A 1 103 LEU 103 105 105 LEU LEU A . n A 1 104 ALA 104 106 106 ALA ALA A . n A 1 105 THR 105 107 107 THR THR A . n A 1 106 PRO 106 108 108 PRO PRO A . n A 1 107 GLU 107 109 109 GLU GLU A . n A 1 108 GLU 108 110 110 GLU GLU A . n A 1 109 MET 109 111 111 MET MET A . n A 1 110 ALA 110 112 112 ALA ALA A . n A 1 111 ASP 111 113 113 ASP ASP A . n A 1 112 PHE 112 114 114 PHE PHE A . n A 1 113 LEU 113 115 115 LEU LEU A . n A 1 114 ALA 114 116 116 ALA ALA A . n A 1 115 GLY 115 117 117 GLY GLY A . n A 1 116 LYS 116 118 118 LYS LYS A . n A 1 117 GLY 117 119 119 GLY GLY A . n A 1 118 VAL 118 120 120 VAL VAL A . n A 1 119 ASP 119 121 121 ASP ASP A . n A 1 120 LYS 120 122 122 LYS LYS A . n A 1 121 GLU 121 123 123 GLU GLU A . n A 1 122 LYS 122 124 124 LYS LYS A . n A 1 123 PHE 123 125 125 PHE PHE A . n A 1 124 LEU 124 126 126 LEU LEU A . n A 1 125 SER 125 127 127 SER SER A . n A 1 126 THR 126 128 128 THR THR A . n A 1 127 TYR 127 129 129 TYR TYR A . n A 1 128 ASN 128 130 130 ASN ASN A . n A 1 129 SER 129 131 131 SER SER A . n A 1 130 PHE 130 132 132 PHE PHE A . n A 1 131 ALA 131 133 133 ALA ALA A . n A 1 132 ILE 132 134 134 ILE ILE A . n A 1 133 LYS 133 135 135 LYS LYS A . n A 1 134 GLY 134 136 136 GLY GLY A . n A 1 135 GLN 135 137 137 GLN GLN A . n A 1 136 MET 136 138 138 MET MET A . n A 1 137 GLU 137 139 139 GLU GLU A . n A 1 138 LYS 138 140 140 LYS LYS A . n A 1 139 ALA 139 141 141 ALA ALA A . n A 1 140 LYS 140 142 142 LYS LYS A . n A 1 141 LYS 141 143 143 LYS LYS A . n A 1 142 LEU 142 144 144 LEU LEU A . n A 1 143 ALA 143 145 145 ALA ALA A . n A 1 144 MET 144 146 146 MET MET A . n A 1 145 ALA 145 147 147 ALA ALA A . n A 1 146 TYR 146 148 148 TYR TYR A . n A 1 147 GLN 147 149 149 GLN GLN A . n A 1 148 VAL 148 150 150 VAL VAL A . n A 1 149 THR 149 151 151 THR THR A . n A 1 150 GLY 150 152 152 GLY GLY A . n A 1 151 VAL 151 153 153 VAL VAL A . n A 1 152 PRO 152 154 154 PRO PRO A . n A 1 153 THR 153 155 155 THR THR A . n A 1 154 MET 154 156 156 MET MET A . n A 1 155 VAL 155 157 157 VAL VAL A . n A 1 156 VAL 156 158 158 VAL VAL A . n A 1 157 ASN 157 159 159 ASN ASN A . n A 1 158 GLY 158 160 160 GLY GLY A . n A 1 159 LYS 159 161 161 LYS LYS A . n A 1 160 TYR 160 162 162 TYR TYR A . n A 1 161 ARG 161 163 163 ARG ARG A . n A 1 162 PHE 162 164 164 PHE PHE A . n A 1 163 ASP 163 165 165 ASP ASP A . n A 1 164 ILE 164 166 166 ILE ILE A . n A 1 165 GLY 165 167 167 GLY GLY A . n A 1 166 SER 166 168 168 SER SER A . n A 1 167 ALA 167 169 169 ALA ALA A . n A 1 168 GLY 168 170 170 GLY GLY A . n A 1 169 GLY 169 171 171 GLY GLY A . n A 1 170 PRO 170 172 172 PRO PRO A . n A 1 171 GLU 171 173 173 GLU GLU A . n A 1 172 GLU 172 174 174 GLU GLU A . n A 1 173 THR 173 175 175 THR THR A . n A 1 174 LEU 174 176 176 LEU LEU A . n A 1 175 LYS 175 177 177 LYS LYS A . n A 1 176 LEU 176 178 178 LEU LEU A . n A 1 177 ALA 177 179 179 ALA ALA A . n A 1 178 ASP 178 180 180 ASP ASP A . n A 1 179 TYR 179 181 181 TYR TYR A . n A 1 180 LEU 180 182 182 LEU LEU A . n A 1 181 ILE 181 183 183 ILE ILE A . n A 1 182 GLU 182 184 184 GLU GLU A . n A 1 183 LYS 183 185 185 LYS LYS A . n A 1 184 GLU 184 186 186 GLU GLU A . n A 1 185 ARG 185 187 187 ARG ARG A . n A 1 186 ALA 186 188 188 ALA ALA A . n A 1 187 ALA 187 189 189 ALA ALA A . n A 1 188 ALA 188 190 190 ALA ALA A . n A 1 189 LYS 189 191 191 LYS LYS A . n A 1 190 LYS 190 192 192 LYS LYS A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id 1YO _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 201 _pdbx_nonpoly_scheme.auth_seq_num 1 _pdbx_nonpoly_scheme.pdb_mon_id 1YO _pdbx_nonpoly_scheme.auth_mon_id DRG _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-04-12 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_nmr_spectrometer 5 2 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_pdbx_nmr_spectrometer.model' 6 2 'Structure model' '_struct_conn.pdbx_dist_value' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 PaDsbA1 0.3 ? mM '[U-98% 13C; U-98% 15N]' 1 '3-((2-methylbenzyl)thio)-4H-1,2,4-triazol-4-amine' 3.3 ? mM 'natural abundance' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HG1 A THR 107 ? ? OE1 A GLU 110 ? ? 1.57 2 1 HZ2 A LYS 161 ? ? OE2 A GLU 186 ? ? 1.59 3 1 HZ2 A LYS 26 ? ? OD2 A ASP 57 ? ? 1.60 4 2 HZ2 A LYS 10 ? ? OE2 A GLU 11 ? ? 1.59 5 2 OE1 A GLU 31 ? ? HE A ARG 62 ? ? 1.60 6 3 HZ2 A LYS 10 ? ? OE2 A GLU 11 ? ? 1.58 7 3 OE1 A GLU 31 ? ? HE A ARG 62 ? ? 1.60 8 4 HZ2 A LYS 10 ? ? OE2 A GLU 11 ? ? 1.56 9 5 OE1 A GLU 82 ? ? HE2 A HIS 91 ? ? 1.57 10 6 OE2 A GLU 31 ? ? HE A ARG 62 ? ? 1.58 11 6 HG1 A THR 107 ? ? OE1 A GLU 110 ? ? 1.59 12 6 OD2 A ASP 89 ? ? HZ1 A LYS 118 ? ? 1.59 13 7 OE1 A GLU 44 ? ? HH22 A ARG 62 ? ? 1.57 14 7 OD1 A ASP 113 ? ? HZ3 A LYS 122 ? ? 1.59 15 7 HZ1 A LYS 104 ? ? OE1 A GLU 110 ? ? 1.60 16 8 OD2 A ASP 89 ? ? HZ1 A LYS 118 ? ? 1.59 17 10 OD2 A ASP 89 ? ? HZ1 A LYS 118 ? ? 1.58 18 10 OE2 A GLU 87 ? ? HD1 A HIS 88 ? ? 1.59 19 10 OE1 A GLU 82 ? ? HE2 A HIS 91 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 4 ? ? 65.10 168.74 2 1 ASP A 5 ? ? -165.77 9.58 3 1 PRO A 45 ? ? -67.36 2.87 4 1 ALA A 56 ? ? -76.58 32.10 5 1 HIS A 74 ? ? -89.34 46.90 6 1 VAL A 90 ? ? 60.63 66.93 7 1 LYS A 103 ? ? -83.49 40.36 8 1 THR A 155 ? ? -165.85 114.47 9 1 LYS A 161 ? ? -130.03 -41.47 10 1 ALA A 190 ? ? -152.16 56.08 11 1 LYS A 191 ? ? -100.62 57.03 12 2 LYS A 10 ? ? -124.81 -59.11 13 2 ALA A 56 ? ? -77.40 26.09 14 2 ASP A 57 ? ? -142.04 21.65 15 2 HIS A 74 ? ? -84.35 49.62 16 2 HIS A 88 ? ? 74.52 115.54 17 2 LYS A 103 ? ? -92.66 33.77 18 2 LYS A 104 ? ? 68.85 -68.69 19 3 HIS A 88 ? ? 75.00 124.54 20 3 VAL A 90 ? ? -100.15 47.11 21 3 LYS A 103 ? ? -91.57 32.33 22 3 LYS A 104 ? ? 69.30 -73.30 23 3 ASN A 159 ? ? 53.80 13.81 24 4 PHE A 43 ? ? -145.47 -35.88 25 4 GLU A 87 ? ? -122.07 -69.50 26 4 HIS A 88 ? ? 68.32 150.67 27 4 ASP A 89 ? ? -106.91 -164.46 28 4 VAL A 90 ? ? 37.60 59.41 29 4 HIS A 91 ? ? -78.78 44.77 30 4 LYS A 100 ? ? -80.88 -70.01 31 4 HIS A 102 ? ? -56.28 95.29 32 4 LYS A 104 ? ? 74.58 -56.81 33 5 ASP A 4 ? ? 62.35 75.21 34 5 LYS A 10 ? ? -93.73 -75.81 35 5 ALA A 56 ? ? -78.41 27.91 36 5 VAL A 90 ? ? 66.05 69.29 37 5 LYS A 104 ? ? 55.41 78.24 38 5 LYS A 118 ? ? -141.23 34.63 39 6 ASP A 4 ? ? 72.74 153.44 40 6 ASP A 5 ? ? -151.53 18.44 41 6 LYS A 10 ? ? -106.94 -69.37 42 6 PHE A 67 ? ? -92.37 47.97 43 6 VAL A 90 ? ? 66.79 79.81 44 6 LYS A 104 ? ? 65.41 85.56 45 7 ASP A 4 ? ? 68.53 100.66 46 7 LYS A 10 ? ? -96.24 -73.41 47 7 PRO A 45 ? ? -59.92 -9.32 48 7 ILE A 70 ? ? -67.71 9.89 49 7 VAL A 86 ? ? 41.90 106.33 50 7 HIS A 99 ? ? -94.33 -80.02 51 7 THR A 155 ? ? -162.11 103.94 52 7 ASN A 159 ? ? 56.74 18.60 53 7 ASP A 165 ? ? -170.40 -176.22 54 8 ASP A 4 ? ? 64.99 95.25 55 8 LYS A 10 ? ? -109.59 -68.25 56 8 ASP A 57 ? ? -150.05 -16.62 57 8 HIS A 74 ? ? -91.53 33.70 58 8 VAL A 90 ? ? 65.01 77.50 59 8 LYS A 103 ? ? -79.40 25.16 60 8 LYS A 161 ? ? -120.59 -56.11 61 9 ASP A 4 ? ? 66.69 104.69 62 9 SER A 17 ? ? -119.81 77.67 63 9 PRO A 49 ? ? -69.42 1.64 64 9 ALA A 56 ? ? -73.95 24.12 65 9 VAL A 86 ? ? 39.95 92.55 66 9 ASN A 130 ? ? -99.13 53.18 67 9 ASN A 159 ? ? 59.55 15.79 68 9 LYS A 191 ? ? 61.67 63.41 69 10 ASP A 4 ? ? 70.93 109.75 70 10 LYS A 10 ? ? -105.00 -80.97 71 10 PRO A 45 ? ? -69.83 3.88 72 10 HIS A 74 ? ? -89.48 43.45 73 10 VAL A 90 ? ? 68.92 90.70 74 10 HIS A 102 ? ? 60.50 60.01 75 10 ASN A 159 ? ? 58.55 17.20 76 10 ALA A 190 ? ? -147.06 38.69 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name '3-[(2-methylbenzyl)sulfanyl]-4H-1,2,4-triazol-4-amine' _pdbx_entity_nonpoly.comp_id 1YO #