data_5TSL # _entry.id 5TSL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5TSL pdb_00005tsl 10.2210/pdb5tsl/pdb WWPDB D_1000224740 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-02-01 2 'Structure model' 1 1 2019-10-23 3 'Structure model' 1 2 2024-03-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' Other 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Derived calculations' 6 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' atom_sites 2 2 'Structure model' cell 3 2 'Structure model' em_image_scans 4 3 'Structure model' chem_comp_atom 5 3 'Structure model' chem_comp_bond 6 3 'Structure model' database_2 7 3 'Structure model' em_3d_fitting_list 8 3 'Structure model' pdbx_initial_refinement_model 9 3 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_atom_sites.fract_transf_matrix[1][1]' 2 2 'Structure model' '_atom_sites.fract_transf_matrix[2][2]' 3 2 'Structure model' '_atom_sites.fract_transf_matrix[3][3]' 4 2 'Structure model' '_cell.Z_PDB' 5 3 'Structure model' '_database_2.pdbx_DOI' 6 3 'Structure model' '_database_2.pdbx_database_accession' 7 3 'Structure model' '_em_3d_fitting_list.accession_code' 8 3 'Structure model' '_em_3d_fitting_list.initial_refinement_model_id' 9 3 'Structure model' '_em_3d_fitting_list.source_name' 10 3 'Structure model' '_em_3d_fitting_list.type' 11 3 'Structure model' '_pdbx_struct_oper_list.name' 12 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 13 3 'Structure model' '_pdbx_struct_oper_list.type' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5TSL _pdbx_database_status.recvd_initial_deposition_date 2016-10-29 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type EMDB 'molecular dynamics flexible fitting model of coxsackievirus A16 empty procapsid VP3 subunit' EMD-8325 'associated EM volume' PDB . 5TSK unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Fan, C.' 1 ? 'Cong, Y.' 2 ? 'Ye, X.' 3 ? 'Huang, Z.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.VIROL. _citation.journal_id_ASTM JOVIAM _citation.journal_id_CSD 0825 _citation.journal_id_ISSN 1098-5514 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structural alteration and surface modifi cation of coxsackievirus A16 capsids by beta-propiolactone treatment' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Chen, F.' 1 ? primary 'Ye, X.' 2 ? primary 'Ku, Z.I.' 3 ? primary 'Kong, L.l.' 4 ? primary 'Liu, Q.' 5 ? primary 'Xu, C.' 6 ? primary 'Cong, Y.' 7 ? primary 'Huang, Z.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description 'coxsackievirus A16' _entity.formula_weight 26654.295 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GIPTELKPGTNQFLTTDDGVSAPILPGFHPTPPIHIPGEVHNLLEICRVETILEVNNLKTNETTPMQRLCFPVSVQSKTG ELCAAFRADPGRDGPWQSTILGQLCRYYTQWSGSLEVTFMFAGSFMATGKMLIAYTPPGGNVPADRITAMLGTHVIWDFG LQSSVTLVVPWISNTHYRAHARAGYFDYYTTGIITIWYQTNYVVPIGAPTTAYIVALAAAQDNFTMKLCKDTEDIEQTAN IQ ; _entity_poly.pdbx_seq_one_letter_code_can ;GIPTELKPGTNQFLTTDDGVSAPILPGFHPTPPIHIPGEVHNLLEICRVETILEVNNLKTNETTPMQRLCFPVSVQSKTG ELCAAFRADPGRDGPWQSTILGQLCRYYTQWSGSLEVTFMFAGSFMATGKMLIAYTPPGGNVPADRITAMLGTHVIWDFG LQSSVTLVVPWISNTHYRAHARAGYFDYYTTGIITIWYQTNYVVPIGAPTTAYIVALAAAQDNFTMKLCKDTEDIEQTAN IQ ; _entity_poly.pdbx_strand_id C _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ILE n 1 3 PRO n 1 4 THR n 1 5 GLU n 1 6 LEU n 1 7 LYS n 1 8 PRO n 1 9 GLY n 1 10 THR n 1 11 ASN n 1 12 GLN n 1 13 PHE n 1 14 LEU n 1 15 THR n 1 16 THR n 1 17 ASP n 1 18 ASP n 1 19 GLY n 1 20 VAL n 1 21 SER n 1 22 ALA n 1 23 PRO n 1 24 ILE n 1 25 LEU n 1 26 PRO n 1 27 GLY n 1 28 PHE n 1 29 HIS n 1 30 PRO n 1 31 THR n 1 32 PRO n 1 33 PRO n 1 34 ILE n 1 35 HIS n 1 36 ILE n 1 37 PRO n 1 38 GLY n 1 39 GLU n 1 40 VAL n 1 41 HIS n 1 42 ASN n 1 43 LEU n 1 44 LEU n 1 45 GLU n 1 46 ILE n 1 47 CYS n 1 48 ARG n 1 49 VAL n 1 50 GLU n 1 51 THR n 1 52 ILE n 1 53 LEU n 1 54 GLU n 1 55 VAL n 1 56 ASN n 1 57 ASN n 1 58 LEU n 1 59 LYS n 1 60 THR n 1 61 ASN n 1 62 GLU n 1 63 THR n 1 64 THR n 1 65 PRO n 1 66 MET n 1 67 GLN n 1 68 ARG n 1 69 LEU n 1 70 CYS n 1 71 PHE n 1 72 PRO n 1 73 VAL n 1 74 SER n 1 75 VAL n 1 76 GLN n 1 77 SER n 1 78 LYS n 1 79 THR n 1 80 GLY n 1 81 GLU n 1 82 LEU n 1 83 CYS n 1 84 ALA n 1 85 ALA n 1 86 PHE n 1 87 ARG n 1 88 ALA n 1 89 ASP n 1 90 PRO n 1 91 GLY n 1 92 ARG n 1 93 ASP n 1 94 GLY n 1 95 PRO n 1 96 TRP n 1 97 GLN n 1 98 SER n 1 99 THR n 1 100 ILE n 1 101 LEU n 1 102 GLY n 1 103 GLN n 1 104 LEU n 1 105 CYS n 1 106 ARG n 1 107 TYR n 1 108 TYR n 1 109 THR n 1 110 GLN n 1 111 TRP n 1 112 SER n 1 113 GLY n 1 114 SER n 1 115 LEU n 1 116 GLU n 1 117 VAL n 1 118 THR n 1 119 PHE n 1 120 MET n 1 121 PHE n 1 122 ALA n 1 123 GLY n 1 124 SER n 1 125 PHE n 1 126 MET n 1 127 ALA n 1 128 THR n 1 129 GLY n 1 130 LYS n 1 131 MET n 1 132 LEU n 1 133 ILE n 1 134 ALA n 1 135 TYR n 1 136 THR n 1 137 PRO n 1 138 PRO n 1 139 GLY n 1 140 GLY n 1 141 ASN n 1 142 VAL n 1 143 PRO n 1 144 ALA n 1 145 ASP n 1 146 ARG n 1 147 ILE n 1 148 THR n 1 149 ALA n 1 150 MET n 1 151 LEU n 1 152 GLY n 1 153 THR n 1 154 HIS n 1 155 VAL n 1 156 ILE n 1 157 TRP n 1 158 ASP n 1 159 PHE n 1 160 GLY n 1 161 LEU n 1 162 GLN n 1 163 SER n 1 164 SER n 1 165 VAL n 1 166 THR n 1 167 LEU n 1 168 VAL n 1 169 VAL n 1 170 PRO n 1 171 TRP n 1 172 ILE n 1 173 SER n 1 174 ASN n 1 175 THR n 1 176 HIS n 1 177 TYR n 1 178 ARG n 1 179 ALA n 1 180 HIS n 1 181 ALA n 1 182 ARG n 1 183 ALA n 1 184 GLY n 1 185 TYR n 1 186 PHE n 1 187 ASP n 1 188 TYR n 1 189 TYR n 1 190 THR n 1 191 THR n 1 192 GLY n 1 193 ILE n 1 194 ILE n 1 195 THR n 1 196 ILE n 1 197 TRP n 1 198 TYR n 1 199 GLN n 1 200 THR n 1 201 ASN n 1 202 TYR n 1 203 VAL n 1 204 VAL n 1 205 PRO n 1 206 ILE n 1 207 GLY n 1 208 ALA n 1 209 PRO n 1 210 THR n 1 211 THR n 1 212 ALA n 1 213 TYR n 1 214 ILE n 1 215 VAL n 1 216 ALA n 1 217 LEU n 1 218 ALA n 1 219 ALA n 1 220 ALA n 1 221 GLN n 1 222 ASP n 1 223 ASN n 1 224 PHE n 1 225 THR n 1 226 MET n 1 227 LYS n 1 228 LEU n 1 229 CYS n 1 230 LYS n 1 231 ASP n 1 232 THR n 1 233 GLU n 1 234 ASP n 1 235 ILE n 1 236 GLU n 1 237 GLN n 1 238 THR n 1 239 ALA n 1 240 ASN n 1 241 ILE n 1 242 GLN n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num 1 _entity_src_nat.pdbx_end_seq_num 242 _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Coxsackievirus A16' _entity_src_nat.pdbx_ncbi_taxonomy_id 31704 _entity_src_nat.genus ? _entity_src_nat.species ? _entity_src_nat.strain SZ05 _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line Vero _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY C . n A 1 2 ILE 2 2 2 ILE ILE C . n A 1 3 PRO 3 3 3 PRO PRO C . n A 1 4 THR 4 4 4 THR THR C . n A 1 5 GLU 5 5 5 GLU GLU C . n A 1 6 LEU 6 6 6 LEU LEU C . n A 1 7 LYS 7 7 7 LYS LYS C . n A 1 8 PRO 8 8 8 PRO PRO C . n A 1 9 GLY 9 9 9 GLY GLY C . n A 1 10 THR 10 10 10 THR THR C . n A 1 11 ASN 11 11 11 ASN ASN C . n A 1 12 GLN 12 12 12 GLN GLN C . n A 1 13 PHE 13 13 13 PHE PHE C . n A 1 14 LEU 14 14 14 LEU LEU C . n A 1 15 THR 15 15 15 THR THR C . n A 1 16 THR 16 16 16 THR THR C . n A 1 17 ASP 17 17 17 ASP ASP C . n A 1 18 ASP 18 18 18 ASP ASP C . n A 1 19 GLY 19 19 19 GLY GLY C . n A 1 20 VAL 20 20 20 VAL VAL C . n A 1 21 SER 21 21 21 SER SER C . n A 1 22 ALA 22 22 22 ALA ALA C . n A 1 23 PRO 23 23 23 PRO PRO C . n A 1 24 ILE 24 24 24 ILE ILE C . n A 1 25 LEU 25 25 25 LEU LEU C . n A 1 26 PRO 26 26 26 PRO PRO C . n A 1 27 GLY 27 27 27 GLY GLY C . n A 1 28 PHE 28 28 28 PHE PHE C . n A 1 29 HIS 29 29 29 HIS HIS C . n A 1 30 PRO 30 30 30 PRO PRO C . n A 1 31 THR 31 31 31 THR THR C . n A 1 32 PRO 32 32 32 PRO PRO C . n A 1 33 PRO 33 33 33 PRO PRO C . n A 1 34 ILE 34 34 34 ILE ILE C . n A 1 35 HIS 35 35 35 HIS HIS C . n A 1 36 ILE 36 36 36 ILE ILE C . n A 1 37 PRO 37 37 37 PRO PRO C . n A 1 38 GLY 38 38 38 GLY GLY C . n A 1 39 GLU 39 39 39 GLU GLU C . n A 1 40 VAL 40 40 40 VAL VAL C . n A 1 41 HIS 41 41 41 HIS HIS C . n A 1 42 ASN 42 42 42 ASN ASN C . n A 1 43 LEU 43 43 43 LEU LEU C . n A 1 44 LEU 44 44 44 LEU LEU C . n A 1 45 GLU 45 45 45 GLU GLU C . n A 1 46 ILE 46 46 46 ILE ILE C . n A 1 47 CYS 47 47 47 CYS CYS C . n A 1 48 ARG 48 48 48 ARG ARG C . n A 1 49 VAL 49 49 49 VAL VAL C . n A 1 50 GLU 50 50 50 GLU GLU C . n A 1 51 THR 51 51 51 THR THR C . n A 1 52 ILE 52 52 52 ILE ILE C . n A 1 53 LEU 53 53 53 LEU LEU C . n A 1 54 GLU 54 54 54 GLU GLU C . n A 1 55 VAL 55 55 55 VAL VAL C . n A 1 56 ASN 56 56 56 ASN ASN C . n A 1 57 ASN 57 57 57 ASN ASN C . n A 1 58 LEU 58 58 58 LEU LEU C . n A 1 59 LYS 59 59 59 LYS LYS C . n A 1 60 THR 60 60 60 THR THR C . n A 1 61 ASN 61 61 61 ASN ASN C . n A 1 62 GLU 62 62 62 GLU GLU C . n A 1 63 THR 63 63 63 THR THR C . n A 1 64 THR 64 64 64 THR THR C . n A 1 65 PRO 65 65 65 PRO PRO C . n A 1 66 MET 66 66 66 MET MET C . n A 1 67 GLN 67 67 67 GLN GLN C . n A 1 68 ARG 68 68 68 ARG ARG C . n A 1 69 LEU 69 69 69 LEU LEU C . n A 1 70 CYS 70 70 70 CYS CYS C . n A 1 71 PHE 71 71 71 PHE PHE C . n A 1 72 PRO 72 72 72 PRO PRO C . n A 1 73 VAL 73 73 73 VAL VAL C . n A 1 74 SER 74 74 74 SER SER C . n A 1 75 VAL 75 75 75 VAL VAL C . n A 1 76 GLN 76 76 76 GLN GLN C . n A 1 77 SER 77 77 77 SER SER C . n A 1 78 LYS 78 78 78 LYS LYS C . n A 1 79 THR 79 79 79 THR THR C . n A 1 80 GLY 80 80 80 GLY GLY C . n A 1 81 GLU 81 81 81 GLU GLU C . n A 1 82 LEU 82 82 82 LEU LEU C . n A 1 83 CYS 83 83 83 CYS CYS C . n A 1 84 ALA 84 84 84 ALA ALA C . n A 1 85 ALA 85 85 85 ALA ALA C . n A 1 86 PHE 86 86 86 PHE PHE C . n A 1 87 ARG 87 87 87 ARG ARG C . n A 1 88 ALA 88 88 88 ALA ALA C . n A 1 89 ASP 89 89 89 ASP ASP C . n A 1 90 PRO 90 90 90 PRO PRO C . n A 1 91 GLY 91 91 91 GLY GLY C . n A 1 92 ARG 92 92 92 ARG ARG C . n A 1 93 ASP 93 93 93 ASP ASP C . n A 1 94 GLY 94 94 94 GLY GLY C . n A 1 95 PRO 95 95 95 PRO PRO C . n A 1 96 TRP 96 96 96 TRP TRP C . n A 1 97 GLN 97 97 97 GLN GLN C . n A 1 98 SER 98 98 98 SER SER C . n A 1 99 THR 99 99 99 THR THR C . n A 1 100 ILE 100 100 100 ILE ILE C . n A 1 101 LEU 101 101 101 LEU LEU C . n A 1 102 GLY 102 102 102 GLY GLY C . n A 1 103 GLN 103 103 103 GLN GLN C . n A 1 104 LEU 104 104 104 LEU LEU C . n A 1 105 CYS 105 105 105 CYS CYS C . n A 1 106 ARG 106 106 106 ARG ARG C . n A 1 107 TYR 107 107 107 TYR TYR C . n A 1 108 TYR 108 108 108 TYR TYR C . n A 1 109 THR 109 109 109 THR THR C . n A 1 110 GLN 110 110 110 GLN GLN C . n A 1 111 TRP 111 111 111 TRP TRP C . n A 1 112 SER 112 112 112 SER SER C . n A 1 113 GLY 113 113 113 GLY GLY C . n A 1 114 SER 114 114 114 SER SER C . n A 1 115 LEU 115 115 115 LEU LEU C . n A 1 116 GLU 116 116 116 GLU GLU C . n A 1 117 VAL 117 117 117 VAL VAL C . n A 1 118 THR 118 118 118 THR THR C . n A 1 119 PHE 119 119 119 PHE PHE C . n A 1 120 MET 120 120 120 MET MET C . n A 1 121 PHE 121 121 121 PHE PHE C . n A 1 122 ALA 122 122 122 ALA ALA C . n A 1 123 GLY 123 123 123 GLY GLY C . n A 1 124 SER 124 124 124 SER SER C . n A 1 125 PHE 125 125 125 PHE PHE C . n A 1 126 MET 126 126 126 MET MET C . n A 1 127 ALA 127 127 127 ALA ALA C . n A 1 128 THR 128 128 128 THR THR C . n A 1 129 GLY 129 129 129 GLY GLY C . n A 1 130 LYS 130 130 130 LYS LYS C . n A 1 131 MET 131 131 131 MET MET C . n A 1 132 LEU 132 132 132 LEU LEU C . n A 1 133 ILE 133 133 133 ILE ILE C . n A 1 134 ALA 134 134 134 ALA ALA C . n A 1 135 TYR 135 135 135 TYR TYR C . n A 1 136 THR 136 136 136 THR THR C . n A 1 137 PRO 137 137 137 PRO PRO C . n A 1 138 PRO 138 138 138 PRO PRO C . n A 1 139 GLY 139 139 139 GLY GLY C . n A 1 140 GLY 140 140 140 GLY GLY C . n A 1 141 ASN 141 141 141 ASN ASN C . n A 1 142 VAL 142 142 142 VAL VAL C . n A 1 143 PRO 143 143 143 PRO PRO C . n A 1 144 ALA 144 144 144 ALA ALA C . n A 1 145 ASP 145 145 145 ASP ASP C . n A 1 146 ARG 146 146 146 ARG ARG C . n A 1 147 ILE 147 147 147 ILE ILE C . n A 1 148 THR 148 148 148 THR THR C . n A 1 149 ALA 149 149 149 ALA ALA C . n A 1 150 MET 150 150 150 MET MET C . n A 1 151 LEU 151 151 151 LEU LEU C . n A 1 152 GLY 152 152 152 GLY GLY C . n A 1 153 THR 153 153 153 THR THR C . n A 1 154 HIS 154 154 154 HIS HIS C . n A 1 155 VAL 155 155 155 VAL VAL C . n A 1 156 ILE 156 156 156 ILE ILE C . n A 1 157 TRP 157 157 157 TRP TRP C . n A 1 158 ASP 158 158 158 ASP ASP C . n A 1 159 PHE 159 159 159 PHE PHE C . n A 1 160 GLY 160 160 160 GLY GLY C . n A 1 161 LEU 161 161 161 LEU LEU C . n A 1 162 GLN 162 162 162 GLN GLN C . n A 1 163 SER 163 163 163 SER SER C . n A 1 164 SER 164 164 164 SER SER C . n A 1 165 VAL 165 165 165 VAL VAL C . n A 1 166 THR 166 166 166 THR THR C . n A 1 167 LEU 167 167 167 LEU LEU C . n A 1 168 VAL 168 168 168 VAL VAL C . n A 1 169 VAL 169 169 169 VAL VAL C . n A 1 170 PRO 170 170 170 PRO PRO C . n A 1 171 TRP 171 171 171 TRP TRP C . n A 1 172 ILE 172 172 172 ILE ILE C . n A 1 173 SER 173 173 173 SER SER C . n A 1 174 ASN 174 174 174 ASN ASN C . n A 1 175 THR 175 175 175 THR THR C . n A 1 176 HIS 176 176 176 HIS HIS C . n A 1 177 TYR 177 177 177 TYR TYR C . n A 1 178 ARG 178 178 178 ARG ARG C . n A 1 179 ALA 179 179 179 ALA ALA C . n A 1 180 HIS 180 180 ? ? ? C . n A 1 181 ALA 181 181 ? ? ? C . n A 1 182 ARG 182 182 ? ? ? C . n A 1 183 ALA 183 183 ? ? ? C . n A 1 184 GLY 184 184 ? ? ? C . n A 1 185 TYR 185 185 ? ? ? C . n A 1 186 PHE 186 186 ? ? ? C . n A 1 187 ASP 187 187 187 ASP ASP C . n A 1 188 TYR 188 188 188 TYR TYR C . n A 1 189 TYR 189 189 189 TYR TYR C . n A 1 190 THR 190 190 190 THR THR C . n A 1 191 THR 191 191 191 THR THR C . n A 1 192 GLY 192 192 192 GLY GLY C . n A 1 193 ILE 193 193 193 ILE ILE C . n A 1 194 ILE 194 194 194 ILE ILE C . n A 1 195 THR 195 195 195 THR THR C . n A 1 196 ILE 196 196 196 ILE ILE C . n A 1 197 TRP 197 197 197 TRP TRP C . n A 1 198 TYR 198 198 198 TYR TYR C . n A 1 199 GLN 199 199 199 GLN GLN C . n A 1 200 THR 200 200 200 THR THR C . n A 1 201 ASN 201 201 201 ASN ASN C . n A 1 202 TYR 202 202 202 TYR TYR C . n A 1 203 VAL 203 203 203 VAL VAL C . n A 1 204 VAL 204 204 204 VAL VAL C . n A 1 205 PRO 205 205 205 PRO PRO C . n A 1 206 ILE 206 206 206 ILE ILE C . n A 1 207 GLY 207 207 207 GLY GLY C . n A 1 208 ALA 208 208 208 ALA ALA C . n A 1 209 PRO 209 209 209 PRO PRO C . n A 1 210 THR 210 210 210 THR THR C . n A 1 211 THR 211 211 211 THR THR C . n A 1 212 ALA 212 212 212 ALA ALA C . n A 1 213 TYR 213 213 213 TYR TYR C . n A 1 214 ILE 214 214 214 ILE ILE C . n A 1 215 VAL 215 215 215 VAL VAL C . n A 1 216 ALA 216 216 216 ALA ALA C . n A 1 217 LEU 217 217 217 LEU LEU C . n A 1 218 ALA 218 218 218 ALA ALA C . n A 1 219 ALA 219 219 219 ALA ALA C . n A 1 220 ALA 220 220 220 ALA ALA C . n A 1 221 GLN 221 221 221 GLN GLN C . n A 1 222 ASP 222 222 222 ASP ASP C . n A 1 223 ASN 223 223 223 ASN ASN C . n A 1 224 PHE 224 224 224 PHE PHE C . n A 1 225 THR 225 225 225 THR THR C . n A 1 226 MET 226 226 226 MET MET C . n A 1 227 LYS 227 227 227 LYS LYS C . n A 1 228 LEU 228 228 228 LEU LEU C . n A 1 229 CYS 229 229 229 CYS CYS C . n A 1 230 LYS 230 230 230 LYS LYS C . n A 1 231 ASP 231 231 231 ASP ASP C . n A 1 232 THR 232 232 232 THR THR C . n A 1 233 GLU 233 233 233 GLU GLU C . n A 1 234 ASP 234 234 234 ASP ASP C . n A 1 235 ILE 235 235 235 ILE ILE C . n A 1 236 GLU 236 236 236 GLU GLU C . n A 1 237 GLN 237 237 ? ? ? C . n A 1 238 THR 238 238 ? ? ? C . n A 1 239 ALA 239 239 ? ? ? C . n A 1 240 ASN 240 240 ? ? ? C . n A 1 241 ILE 241 241 ? ? ? C . n A 1 242 GLN 242 242 ? ? ? C . n # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5TSL _cell.details ? _cell.formula_units_Z ? _cell.length_a 1 _cell.length_a_esd ? _cell.length_b 1 _cell.length_b_esd ? _cell.length_c 1 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 1 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5TSL _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5TSL _exptl.crystals_number ? _exptl.details ? _exptl.method 'ELECTRON MICROSCOPY' _exptl.method_details ? # _refine.pdbx_refine_id 'ELECTRON MICROSCOPY' _refine.entry_id 5TSL _refine.pdbx_diffrn_id ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs ? _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low ? _refine.ls_d_res_high 6.50 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work ? _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # loop_ _struct_ncs_oper.id _struct_ncs_oper.code _struct_ncs_oper.details _struct_ncs_oper.matrix[1][1] _struct_ncs_oper.matrix[1][2] _struct_ncs_oper.matrix[1][3] _struct_ncs_oper.vector[1] _struct_ncs_oper.matrix[2][1] _struct_ncs_oper.matrix[2][2] _struct_ncs_oper.matrix[2][3] _struct_ncs_oper.vector[2] _struct_ncs_oper.matrix[3][1] _struct_ncs_oper.matrix[3][2] _struct_ncs_oper.matrix[3][3] _struct_ncs_oper.vector[3] 1 given ? 1.00000000 0.00000000 0.00000000 0.00000 0.00000000 1.00000000 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 0.00000 2 generate ? 0.30901699 -0.50000000 -0.80901699 0.00000 0.50000000 0.80901699 -0.30901699 0.00000 0.80901699 -0.30901699 0.50000000 0.00000 3 generate ? -0.80901699 -0.30901699 -0.50000000 0.00000 0.30901699 0.50000000 -0.80901699 0.00000 0.50000000 -0.80901699 -0.30901699 0.00000 4 generate ? -0.80901699 0.30901699 0.50000000 0.00000 -0.30901699 0.50000000 -0.80901699 0.00000 -0.50000000 -0.80901699 -0.30901699 0.00000 5 generate ? 0.30901699 0.50000000 0.80901699 0.00000 -0.50000000 0.80901699 -0.30901699 0.00000 -0.80901699 -0.30901699 0.50000000 0.00000 6 generate ? -1.00000000 0.00000000 0.00000000 0.00000 0.00000000 1.00000000 0.00000000 0.00000 0.00000000 0.00000000 -1.00000000 0.00000 7 generate ? -0.30901699 0.50000000 0.80901699 0.00000 0.50000000 0.80901699 -0.30901699 0.00000 -0.80901699 0.30901699 -0.50000000 0.00000 8 generate ? 0.80901699 0.30901699 0.50000000 0.00000 0.30901699 0.50000000 -0.80901699 0.00000 -0.50000000 0.80901699 0.30901699 0.00000 9 generate ? 0.80901699 -0.30901699 -0.50000000 0.00000 -0.30901699 0.50000000 -0.80901699 0.00000 0.50000000 0.80901699 0.30901699 0.00000 10 generate ? -0.30901699 -0.50000000 -0.80901699 0.00000 -0.50000000 0.80901699 -0.30901699 0.00000 0.80901699 0.30901699 -0.50000000 0.00000 11 generate ? -1.00000000 0.00000000 0.00000000 0.00000 0.00000000 -1.00000000 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 0.00000 12 generate ? -0.30901699 0.50000000 0.80901699 0.00000 -0.50000000 -0.80901699 0.30901699 0.00000 0.80901699 -0.30901699 0.50000000 0.00000 13 generate ? 0.80901699 0.30901699 0.50000000 0.00000 -0.30901699 -0.50000000 0.80901699 0.00000 0.50000000 -0.80901699 -0.30901699 0.00000 14 generate ? 0.80901699 -0.30901699 -0.50000000 0.00000 0.30901699 -0.50000000 0.80901699 0.00000 -0.50000000 -0.80901699 -0.30901699 0.00000 15 generate ? -0.30901699 -0.50000000 -0.80901699 0.00000 0.50000000 -0.80901699 0.30901699 0.00000 -0.80901699 -0.30901699 0.50000000 0.00000 16 generate ? 1.00000000 0.00000000 0.00000000 0.00000 0.00000000 -1.00000000 0.00000000 0.00000 0.00000000 0.00000000 -1.00000000 0.00000 17 generate ? 0.30901699 -0.50000000 -0.80901699 0.00000 -0.50000000 -0.80901699 0.30901699 0.00000 -0.80901699 0.30901699 -0.50000000 0.00000 18 generate ? -0.80901699 -0.30901699 -0.50000000 0.00000 -0.30901699 -0.50000000 0.80901699 0.00000 -0.50000000 0.80901699 0.30901699 0.00000 19 generate ? -0.80901699 0.30901699 0.50000000 0.00000 0.30901699 -0.50000000 0.80901699 0.00000 0.50000000 0.80901699 0.30901699 0.00000 20 generate ? 0.30901699 0.50000000 0.80901699 0.00000 0.50000000 -0.80901699 0.30901699 0.00000 0.80901699 0.30901699 -0.50000000 0.00000 21 generate ? 0.00000000 -1.00000000 0.00000000 0.00000 0.00000000 0.00000000 -1.00000000 0.00000 1.00000000 0.00000000 0.00000000 0.00000 22 generate ? -0.50000000 -0.80901699 0.30901699 0.00000 -0.80901699 0.30901699 -0.50000000 0.00000 0.30901699 -0.50000000 -0.80901699 0.00000 23 generate ? -0.30901699 -0.50000000 0.80901699 0.00000 -0.50000000 0.80901699 0.30901699 0.00000 -0.80901699 -0.30901699 -0.50000000 0.00000 24 generate ? 0.30901699 -0.50000000 0.80901699 0.00000 0.50000000 0.80901699 0.30901699 0.00000 -0.80901699 0.30901699 0.50000000 0.00000 25 generate ? 0.50000000 -0.80901699 0.30901699 0.00000 0.80901699 0.30901699 -0.50000000 0.00000 0.30901699 0.50000000 0.80901699 0.00000 26 generate ? 0.00000000 -1.00000000 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 0.00000 -1.00000000 0.00000000 0.00000000 0.00000 27 generate ? -0.50000000 -0.80901699 0.30901699 0.00000 0.80901699 -0.30901699 0.50000000 0.00000 -0.30901699 0.50000000 0.80901699 0.00000 28 generate ? -0.30901699 -0.50000000 0.80901699 0.00000 0.50000000 -0.80901699 -0.30901699 0.00000 0.80901699 0.30901699 0.50000000 0.00000 29 generate ? 0.30901699 -0.50000000 0.80901699 0.00000 -0.50000000 -0.80901699 -0.30901699 0.00000 0.80901699 -0.30901699 -0.50000000 0.00000 30 generate ? 0.50000000 -0.80901699 0.30901699 0.00000 -0.80901699 -0.30901699 0.50000000 0.00000 -0.30901699 -0.50000000 -0.80901699 0.00000 31 generate ? 0.00000000 1.00000000 0.00000000 0.00000 0.00000000 0.00000000 -1.00000000 0.00000 -1.00000000 0.00000000 0.00000000 0.00000 32 generate ? 0.50000000 0.80901699 -0.30901699 0.00000 -0.80901699 0.30901699 -0.50000000 0.00000 -0.30901699 0.50000000 0.80901699 0.00000 33 generate ? 0.30901699 0.50000000 -0.80901699 0.00000 -0.50000000 0.80901699 0.30901699 0.00000 0.80901699 0.30901699 0.50000000 0.00000 34 generate ? -0.30901699 0.50000000 -0.80901699 0.00000 0.50000000 0.80901699 0.30901699 0.00000 0.80901699 -0.30901699 -0.50000000 0.00000 35 generate ? -0.50000000 0.80901699 -0.30901699 0.00000 0.80901699 0.30901699 -0.50000000 0.00000 -0.30901699 -0.50000000 -0.80901699 0.00000 36 generate ? 0.00000000 1.00000000 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 0.00000 1.00000000 0.00000000 0.00000000 0.00000 37 generate ? 0.50000000 0.80901699 -0.30901699 0.00000 0.80901699 -0.30901699 0.50000000 0.00000 0.30901699 -0.50000000 -0.80901699 0.00000 38 generate ? 0.30901699 0.50000000 -0.80901699 0.00000 0.50000000 -0.80901699 -0.30901699 0.00000 -0.80901699 -0.30901699 -0.50000000 0.00000 39 generate ? -0.30901699 0.50000000 -0.80901699 0.00000 -0.50000000 -0.80901699 -0.30901699 0.00000 -0.80901699 0.30901699 0.50000000 0.00000 40 generate ? -0.50000000 0.80901699 -0.30901699 0.00000 -0.80901699 -0.30901699 0.50000000 0.00000 0.30901699 0.50000000 0.80901699 0.00000 41 generate ? 0.00000000 0.00000000 1.00000000 0.00000 -1.00000000 0.00000000 0.00000000 0.00000 0.00000000 -1.00000000 0.00000000 0.00000 42 generate ? 0.80901699 -0.30901699 0.50000000 0.00000 -0.30901699 0.50000000 0.80901699 0.00000 -0.50000000 -0.80901699 0.30901699 0.00000 43 generate ? 0.50000000 -0.80901699 -0.30901699 0.00000 0.80901699 0.30901699 0.50000000 0.00000 -0.30901699 -0.50000000 0.80901699 0.00000 44 generate ? -0.50000000 -0.80901699 -0.30901699 0.00000 0.80901699 -0.30901699 -0.50000000 0.00000 0.30901699 -0.50000000 0.80901699 0.00000 45 generate ? -0.80901699 -0.30901699 0.50000000 0.00000 -0.30901699 -0.50000000 -0.80901699 0.00000 0.50000000 -0.80901699 0.30901699 0.00000 46 generate ? 0.00000000 0.00000000 -1.00000000 0.00000 1.00000000 0.00000000 0.00000000 0.00000 0.00000000 -1.00000000 0.00000000 0.00000 47 generate ? -0.80901699 0.30901699 -0.50000000 0.00000 0.30901699 -0.50000000 -0.80901699 0.00000 -0.50000000 -0.80901699 0.30901699 0.00000 48 generate ? -0.50000000 0.80901699 0.30901699 0.00000 -0.80901699 -0.30901699 -0.50000000 0.00000 -0.30901699 -0.50000000 0.80901699 0.00000 49 generate ? 0.50000000 0.80901699 0.30901699 0.00000 -0.80901699 0.30901699 0.50000000 0.00000 0.30901699 -0.50000000 0.80901699 0.00000 50 generate ? 0.80901699 0.30901699 -0.50000000 0.00000 0.30901699 0.50000000 0.80901699 0.00000 0.50000000 -0.80901699 0.30901699 0.00000 51 generate ? 0.00000000 0.00000000 1.00000000 0.00000 1.00000000 0.00000000 0.00000000 0.00000 0.00000000 1.00000000 0.00000000 0.00000 52 generate ? 0.80901699 -0.30901699 0.50000000 0.00000 0.30901699 -0.50000000 -0.80901699 0.00000 0.50000000 0.80901699 -0.30901699 0.00000 53 generate ? 0.50000000 -0.80901699 -0.30901699 0.00000 -0.80901699 -0.30901699 -0.50000000 0.00000 0.30901699 0.50000000 -0.80901699 0.00000 54 generate ? -0.50000000 -0.80901699 -0.30901699 0.00000 -0.80901699 0.30901699 0.50000000 0.00000 -0.30901699 0.50000000 -0.80901699 0.00000 55 generate ? -0.80901699 -0.30901699 0.50000000 0.00000 0.30901699 0.50000000 0.80901699 0.00000 -0.50000000 0.80901699 -0.30901699 0.00000 56 generate ? 0.00000000 0.00000000 -1.00000000 0.00000 -1.00000000 0.00000000 0.00000000 0.00000 0.00000000 1.00000000 0.00000000 0.00000 57 generate ? -0.80901699 0.30901699 -0.50000000 0.00000 -0.30901699 0.50000000 0.80901699 0.00000 0.50000000 0.80901699 -0.30901699 0.00000 58 generate ? -0.50000000 0.80901699 0.30901699 0.00000 0.80901699 0.30901699 0.50000000 0.00000 0.30901699 0.50000000 -0.80901699 0.00000 59 generate ? 0.50000000 0.80901699 0.30901699 0.00000 0.80901699 -0.30901699 -0.50000000 0.00000 -0.30901699 0.50000000 -0.80901699 0.00000 60 generate ? 0.80901699 0.30901699 -0.50000000 0.00000 -0.30901699 -0.50000000 -0.80901699 0.00000 -0.50000000 0.80901699 -0.30901699 0.00000 # _struct.entry_id 5TSL _struct.title 'Molecular Dynamics Flexible Fitting Model of Coxsackievirus A16 empty Procapsid VP3 Subunit' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5TSL _struct_keywords.text 'coxsackievirus, VIRUS' _struct_keywords.pdbx_keywords VIRUS # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 5TSL _struct_ref.pdbx_db_accession 5TSL _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5TSL _struct_ref_seq.pdbx_strand_id C _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 242 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 5TSL _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 242 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 242 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 'complete icosahedral assembly' ? 60-meric 60 2 'icosahedral asymmetric unit' ? monomeric 1 3 'icosahedral pentamer' ? pentameric 5 4 'icosahedral 23 hexamer' ? hexameric 6 5 'icosahedral asymmetric unit, std point frame' ? monomeric 1 6 'crystal asymmetric unit, crystal frame' ? 60-meric 60 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 '(1-60)' A 2 1 A 3 '(1-5)' A 4 '(1,2,6,10,23,24)' A 5 P A 6 '(X0)(1-60)' A # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] P 'transform to point frame' ? ? 1.00000000 0.00000000 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 0.00000 0.00000000 -1.00000000 0.00000000 0.00000 X0 'identity operation' 1_555 x,y,z 1.00000000 0.00000000 0.00000000 0.00000 0.00000000 1.00000000 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 0.00000 1 'identity operation' 1_555 x,y,z 1.00000000 0.00000000 0.00000000 0.00000 0.00000000 1.00000000 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 0.00000 2 'point symmetry operation' ? ? 0.30901699 -0.50000000 -0.80901699 0.00000 0.50000000 0.80901699 -0.30901699 0.00000 0.80901699 -0.30901699 0.50000000 0.00000 3 'point symmetry operation' ? ? -0.80901699 -0.30901699 -0.50000000 0.00000 0.30901699 0.50000000 -0.80901699 0.00000 0.50000000 -0.80901699 -0.30901699 0.00000 4 'point symmetry operation' ? ? -0.80901699 0.30901699 0.50000000 0.00000 -0.30901699 0.50000000 -0.80901699 0.00000 -0.50000000 -0.80901699 -0.30901699 0.00000 5 'point symmetry operation' ? ? 0.30901699 0.50000000 0.80901699 0.00000 -0.50000000 0.80901699 -0.30901699 0.00000 -0.80901699 -0.30901699 0.50000000 0.00000 6 'point symmetry operation' ? ? -1.00000000 0.00000000 0.00000000 0.00000 0.00000000 1.00000000 0.00000000 0.00000 0.00000000 0.00000000 -1.00000000 0.00000 7 'point symmetry operation' ? ? -0.30901699 0.50000000 0.80901699 0.00000 0.50000000 0.80901699 -0.30901699 0.00000 -0.80901699 0.30901699 -0.50000000 0.00000 8 'point symmetry operation' ? ? 0.80901699 0.30901699 0.50000000 0.00000 0.30901699 0.50000000 -0.80901699 0.00000 -0.50000000 0.80901699 0.30901699 0.00000 9 'point symmetry operation' ? ? 0.80901699 -0.30901699 -0.50000000 0.00000 -0.30901699 0.50000000 -0.80901699 0.00000 0.50000000 0.80901699 0.30901699 0.00000 10 'point symmetry operation' ? ? -0.30901699 -0.50000000 -0.80901699 0.00000 -0.50000000 0.80901699 -0.30901699 0.00000 0.80901699 0.30901699 -0.50000000 0.00000 11 'point symmetry operation' ? ? -1.00000000 0.00000000 0.00000000 0.00000 0.00000000 -1.00000000 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 0.00000 12 'point symmetry operation' ? ? -0.30901699 0.50000000 0.80901699 0.00000 -0.50000000 -0.80901699 0.30901699 0.00000 0.80901699 -0.30901699 0.50000000 0.00000 13 'point symmetry operation' ? ? 0.80901699 0.30901699 0.50000000 0.00000 -0.30901699 -0.50000000 0.80901699 0.00000 0.50000000 -0.80901699 -0.30901699 0.00000 14 'point symmetry operation' ? ? 0.80901699 -0.30901699 -0.50000000 0.00000 0.30901699 -0.50000000 0.80901699 0.00000 -0.50000000 -0.80901699 -0.30901699 0.00000 15 'point symmetry operation' ? ? -0.30901699 -0.50000000 -0.80901699 0.00000 0.50000000 -0.80901699 0.30901699 0.00000 -0.80901699 -0.30901699 0.50000000 0.00000 16 'point symmetry operation' ? ? 1.00000000 0.00000000 0.00000000 0.00000 0.00000000 -1.00000000 0.00000000 0.00000 0.00000000 0.00000000 -1.00000000 0.00000 17 'point symmetry operation' ? ? 0.30901699 -0.50000000 -0.80901699 0.00000 -0.50000000 -0.80901699 0.30901699 0.00000 -0.80901699 0.30901699 -0.50000000 0.00000 18 'point symmetry operation' ? ? -0.80901699 -0.30901699 -0.50000000 0.00000 -0.30901699 -0.50000000 0.80901699 0.00000 -0.50000000 0.80901699 0.30901699 0.00000 19 'point symmetry operation' ? ? -0.80901699 0.30901699 0.50000000 0.00000 0.30901699 -0.50000000 0.80901699 0.00000 0.50000000 0.80901699 0.30901699 0.00000 20 'point symmetry operation' ? ? 0.30901699 0.50000000 0.80901699 0.00000 0.50000000 -0.80901699 0.30901699 0.00000 0.80901699 0.30901699 -0.50000000 0.00000 21 'point symmetry operation' ? ? 0.00000000 -1.00000000 0.00000000 0.00000 0.00000000 0.00000000 -1.00000000 0.00000 1.00000000 0.00000000 0.00000000 0.00000 22 'point symmetry operation' ? ? -0.50000000 -0.80901699 0.30901699 0.00000 -0.80901699 0.30901699 -0.50000000 0.00000 0.30901699 -0.50000000 -0.80901699 0.00000 23 'point symmetry operation' ? ? -0.30901699 -0.50000000 0.80901699 0.00000 -0.50000000 0.80901699 0.30901699 0.00000 -0.80901699 -0.30901699 -0.50000000 0.00000 24 'point symmetry operation' ? ? 0.30901699 -0.50000000 0.80901699 0.00000 0.50000000 0.80901699 0.30901699 0.00000 -0.80901699 0.30901699 0.50000000 0.00000 25 'point symmetry operation' ? ? 0.50000000 -0.80901699 0.30901699 0.00000 0.80901699 0.30901699 -0.50000000 0.00000 0.30901699 0.50000000 0.80901699 0.00000 26 'point symmetry operation' ? ? 0.00000000 -1.00000000 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 0.00000 -1.00000000 0.00000000 0.00000000 0.00000 27 'point symmetry operation' ? ? -0.50000000 -0.80901699 0.30901699 0.00000 0.80901699 -0.30901699 0.50000000 0.00000 -0.30901699 0.50000000 0.80901699 0.00000 28 'point symmetry operation' ? ? -0.30901699 -0.50000000 0.80901699 0.00000 0.50000000 -0.80901699 -0.30901699 0.00000 0.80901699 0.30901699 0.50000000 0.00000 29 'point symmetry operation' ? ? 0.30901699 -0.50000000 0.80901699 0.00000 -0.50000000 -0.80901699 -0.30901699 0.00000 0.80901699 -0.30901699 -0.50000000 0.00000 30 'point symmetry operation' ? ? 0.50000000 -0.80901699 0.30901699 0.00000 -0.80901699 -0.30901699 0.50000000 0.00000 -0.30901699 -0.50000000 -0.80901699 0.00000 31 'point symmetry operation' ? ? 0.00000000 1.00000000 0.00000000 0.00000 0.00000000 0.00000000 -1.00000000 0.00000 -1.00000000 0.00000000 0.00000000 0.00000 32 'point symmetry operation' ? ? 0.50000000 0.80901699 -0.30901699 0.00000 -0.80901699 0.30901699 -0.50000000 0.00000 -0.30901699 0.50000000 0.80901699 0.00000 33 'point symmetry operation' ? ? 0.30901699 0.50000000 -0.80901699 0.00000 -0.50000000 0.80901699 0.30901699 0.00000 0.80901699 0.30901699 0.50000000 0.00000 34 'point symmetry operation' ? ? -0.30901699 0.50000000 -0.80901699 0.00000 0.50000000 0.80901699 0.30901699 0.00000 0.80901699 -0.30901699 -0.50000000 0.00000 35 'point symmetry operation' ? ? -0.50000000 0.80901699 -0.30901699 0.00000 0.80901699 0.30901699 -0.50000000 0.00000 -0.30901699 -0.50000000 -0.80901699 0.00000 36 'point symmetry operation' ? ? 0.00000000 1.00000000 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 0.00000 1.00000000 0.00000000 0.00000000 0.00000 37 'point symmetry operation' ? ? 0.50000000 0.80901699 -0.30901699 0.00000 0.80901699 -0.30901699 0.50000000 0.00000 0.30901699 -0.50000000 -0.80901699 0.00000 38 'point symmetry operation' ? ? 0.30901699 0.50000000 -0.80901699 0.00000 0.50000000 -0.80901699 -0.30901699 0.00000 -0.80901699 -0.30901699 -0.50000000 0.00000 39 'point symmetry operation' ? ? -0.30901699 0.50000000 -0.80901699 0.00000 -0.50000000 -0.80901699 -0.30901699 0.00000 -0.80901699 0.30901699 0.50000000 0.00000 40 'point symmetry operation' ? ? -0.50000000 0.80901699 -0.30901699 0.00000 -0.80901699 -0.30901699 0.50000000 0.00000 0.30901699 0.50000000 0.80901699 0.00000 41 'point symmetry operation' ? ? 0.00000000 0.00000000 1.00000000 0.00000 -1.00000000 0.00000000 0.00000000 0.00000 0.00000000 -1.00000000 0.00000000 0.00000 42 'point symmetry operation' ? ? 0.80901699 -0.30901699 0.50000000 0.00000 -0.30901699 0.50000000 0.80901699 0.00000 -0.50000000 -0.80901699 0.30901699 0.00000 43 'point symmetry operation' ? ? 0.50000000 -0.80901699 -0.30901699 0.00000 0.80901699 0.30901699 0.50000000 0.00000 -0.30901699 -0.50000000 0.80901699 0.00000 44 'point symmetry operation' ? ? -0.50000000 -0.80901699 -0.30901699 0.00000 0.80901699 -0.30901699 -0.50000000 0.00000 0.30901699 -0.50000000 0.80901699 0.00000 45 'point symmetry operation' ? ? -0.80901699 -0.30901699 0.50000000 0.00000 -0.30901699 -0.50000000 -0.80901699 0.00000 0.50000000 -0.80901699 0.30901699 0.00000 46 'point symmetry operation' ? ? 0.00000000 0.00000000 -1.00000000 0.00000 1.00000000 0.00000000 0.00000000 0.00000 0.00000000 -1.00000000 0.00000000 0.00000 47 'point symmetry operation' ? ? -0.80901699 0.30901699 -0.50000000 0.00000 0.30901699 -0.50000000 -0.80901699 0.00000 -0.50000000 -0.80901699 0.30901699 0.00000 48 'point symmetry operation' ? ? -0.50000000 0.80901699 0.30901699 0.00000 -0.80901699 -0.30901699 -0.50000000 0.00000 -0.30901699 -0.50000000 0.80901699 0.00000 49 'point symmetry operation' ? ? 0.50000000 0.80901699 0.30901699 0.00000 -0.80901699 0.30901699 0.50000000 0.00000 0.30901699 -0.50000000 0.80901699 0.00000 50 'point symmetry operation' ? ? 0.80901699 0.30901699 -0.50000000 0.00000 0.30901699 0.50000000 0.80901699 0.00000 0.50000000 -0.80901699 0.30901699 0.00000 51 'point symmetry operation' ? ? 0.00000000 0.00000000 1.00000000 0.00000 1.00000000 0.00000000 0.00000000 0.00000 0.00000000 1.00000000 0.00000000 0.00000 52 'point symmetry operation' ? ? 0.80901699 -0.30901699 0.50000000 0.00000 0.30901699 -0.50000000 -0.80901699 0.00000 0.50000000 0.80901699 -0.30901699 0.00000 53 'point symmetry operation' ? ? 0.50000000 -0.80901699 -0.30901699 0.00000 -0.80901699 -0.30901699 -0.50000000 0.00000 0.30901699 0.50000000 -0.80901699 0.00000 54 'point symmetry operation' ? ? -0.50000000 -0.80901699 -0.30901699 0.00000 -0.80901699 0.30901699 0.50000000 0.00000 -0.30901699 0.50000000 -0.80901699 0.00000 55 'point symmetry operation' ? ? -0.80901699 -0.30901699 0.50000000 0.00000 0.30901699 0.50000000 0.80901699 0.00000 -0.50000000 0.80901699 -0.30901699 0.00000 56 'point symmetry operation' ? ? 0.00000000 0.00000000 -1.00000000 0.00000 -1.00000000 0.00000000 0.00000000 0.00000 0.00000000 1.00000000 0.00000000 0.00000 57 'point symmetry operation' ? ? -0.80901699 0.30901699 -0.50000000 0.00000 -0.30901699 0.50000000 0.80901699 0.00000 0.50000000 0.80901699 -0.30901699 0.00000 58 'point symmetry operation' ? ? -0.50000000 0.80901699 0.30901699 0.00000 0.80901699 0.30901699 0.50000000 0.00000 0.30901699 0.50000000 -0.80901699 0.00000 59 'point symmetry operation' ? ? 0.50000000 0.80901699 0.30901699 0.00000 0.80901699 -0.30901699 -0.50000000 0.00000 -0.30901699 0.50000000 -0.80901699 0.00000 60 'point symmetry operation' ? ? 0.80901699 0.30901699 -0.50000000 0.00000 -0.30901699 -0.50000000 -0.80901699 0.00000 -0.50000000 0.80901699 -0.30901699 0.00000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 42 ? ARG A 48 ? ASN C 42 ARG C 48 1 ? 7 HELX_P HELX_P2 AA2 THR A 64 ? ARG A 68 ? THR C 64 ARG C 68 5 ? 5 HELX_P HELX_P3 AA3 GLY A 94 ? SER A 98 ? GLY C 94 SER C 98 5 ? 5 HELX_P HELX_P4 AA4 THR A 99 ? ARG A 106 ? THR C 99 ARG C 106 1 ? 8 HELX_P HELX_P5 AA5 ASP A 145 ? GLY A 152 ? ASP C 145 GLY C 152 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 4 ? AA3 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 51 ? ILE A 52 ? THR C 51 ILE C 52 AA1 2 THR A 211 ? ALA A 220 ? THR C 211 ALA C 220 AA1 3 TYR A 108 ? PHE A 121 ? TYR C 108 PHE C 121 AA1 4 SER A 164 ? ILE A 172 ? SER C 164 ILE C 172 AA2 1 CYS A 70 ? SER A 74 ? CYS C 70 SER C 74 AA2 2 THR A 211 ? ALA A 220 ? THR C 211 ALA C 220 AA2 3 TYR A 108 ? PHE A 121 ? TYR C 108 PHE C 121 AA2 4 THR A 225 ? CYS A 229 ? THR C 225 CYS C 229 AA3 1 LEU A 82 ? ARG A 87 ? LEU C 82 ARG C 87 AA3 2 ILE A 193 ? TYR A 198 ? ILE C 193 TYR C 198 AA3 3 LYS A 130 ? THR A 136 ? LYS C 130 THR C 136 AA3 4 THR A 153 ? ASP A 158 ? THR C 153 ASP C 158 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N THR A 51 ? N THR C 51 O ALA A 218 ? O ALA C 218 AA1 2 3 O LEU A 217 ? O LEU C 217 N THR A 118 ? N THR C 118 AA1 3 4 N VAL A 117 ? N VAL C 117 O LEU A 167 ? O LEU C 167 AA2 1 2 N PHE A 71 ? N PHE C 71 O ILE A 214 ? O ILE C 214 AA2 2 3 O LEU A 217 ? O LEU C 217 N THR A 118 ? N THR C 118 AA2 3 4 N THR A 109 ? N THR C 109 O LEU A 228 ? O LEU C 228 AA3 1 2 N CYS A 83 ? N CYS C 83 O ILE A 196 ? O ILE C 196 AA3 2 3 O TRP A 197 ? O TRP C 197 N LEU A 132 ? N LEU C 132 AA3 3 4 N MET A 131 ? N MET C 131 O TRP A 157 ? O TRP C 157 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 C _pdbx_validate_rmsd_bond.auth_asym_id_1 C _pdbx_validate_rmsd_bond.auth_comp_id_1 GLU _pdbx_validate_rmsd_bond.auth_seq_id_1 236 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 O _pdbx_validate_rmsd_bond.auth_asym_id_2 C _pdbx_validate_rmsd_bond.auth_comp_id_2 GLU _pdbx_validate_rmsd_bond.auth_seq_id_2 236 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.001 _pdbx_validate_rmsd_bond.bond_target_value 1.229 _pdbx_validate_rmsd_bond.bond_deviation -0.228 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.019 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU C 62 ? ? -32.37 -34.94 2 1 THR C 64 ? ? -146.94 54.57 3 1 ASP C 89 ? ? -112.69 61.23 4 1 PRO C 90 ? ? -29.36 -57.29 5 1 SER C 124 ? ? -39.53 142.93 6 1 ARG C 178 ? ? -163.99 -115.88 7 1 TYR C 188 ? ? -176.80 -18.66 8 1 THR C 190 ? ? -172.94 127.60 9 1 LEU C 228 ? ? 64.23 94.02 # _pdbx_point_symmetry.entry_id 5TSL _pdbx_point_symmetry.Schoenflies_symbol I # loop_ _pdbx_struct_legacy_oper_list.id _pdbx_struct_legacy_oper_list.name _pdbx_struct_legacy_oper_list.matrix[1][1] _pdbx_struct_legacy_oper_list.matrix[1][2] _pdbx_struct_legacy_oper_list.matrix[1][3] _pdbx_struct_legacy_oper_list.vector[1] _pdbx_struct_legacy_oper_list.matrix[2][1] _pdbx_struct_legacy_oper_list.matrix[2][2] _pdbx_struct_legacy_oper_list.matrix[2][3] _pdbx_struct_legacy_oper_list.vector[2] _pdbx_struct_legacy_oper_list.matrix[3][1] _pdbx_struct_legacy_oper_list.matrix[3][2] _pdbx_struct_legacy_oper_list.matrix[3][3] _pdbx_struct_legacy_oper_list.vector[3] 1 'point symmetry operation' 1.00000000 0.00000000 0.00000000 0.00000 0.00000000 1.00000000 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 0.00000 2 'point symmetry operation' 0.30901699 -0.50000000 -0.80901699 0.00000 0.50000000 0.80901699 -0.30901699 0.00000 0.80901699 -0.30901699 0.50000000 0.00000 3 'point symmetry operation' -0.80901699 -0.30901699 -0.50000000 0.00000 0.30901699 0.50000000 -0.80901699 0.00000 0.50000000 -0.80901699 -0.30901699 0.00000 4 'point symmetry operation' -0.80901699 0.30901699 0.50000000 0.00000 -0.30901699 0.50000000 -0.80901699 0.00000 -0.50000000 -0.80901699 -0.30901699 0.00000 5 'point symmetry operation' 0.30901699 0.50000000 0.80901699 0.00000 -0.50000000 0.80901699 -0.30901699 0.00000 -0.80901699 -0.30901699 0.50000000 0.00000 6 'point symmetry operation' -1.00000000 0.00000000 0.00000000 0.00000 0.00000000 1.00000000 0.00000000 0.00000 0.00000000 0.00000000 -1.00000000 0.00000 7 'point symmetry operation' -0.30901699 0.50000000 0.80901699 0.00000 0.50000000 0.80901699 -0.30901699 0.00000 -0.80901699 0.30901699 -0.50000000 0.00000 8 'point symmetry operation' 0.80901699 0.30901699 0.50000000 0.00000 0.30901699 0.50000000 -0.80901699 0.00000 -0.50000000 0.80901699 0.30901699 0.00000 9 'point symmetry operation' 0.80901699 -0.30901699 -0.50000000 0.00000 -0.30901699 0.50000000 -0.80901699 0.00000 0.50000000 0.80901699 0.30901699 0.00000 10 'point symmetry operation' -0.30901699 -0.50000000 -0.80901699 0.00000 -0.50000000 0.80901699 -0.30901699 0.00000 0.80901699 0.30901699 -0.50000000 0.00000 11 'point symmetry operation' -1.00000000 0.00000000 0.00000000 0.00000 0.00000000 -1.00000000 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 0.00000 12 'point symmetry operation' -0.30901699 0.50000000 0.80901699 0.00000 -0.50000000 -0.80901699 0.30901699 0.00000 0.80901699 -0.30901699 0.50000000 0.00000 13 'point symmetry operation' 0.80901699 0.30901699 0.50000000 0.00000 -0.30901699 -0.50000000 0.80901699 0.00000 0.50000000 -0.80901699 -0.30901699 0.00000 14 'point symmetry operation' 0.80901699 -0.30901699 -0.50000000 0.00000 0.30901699 -0.50000000 0.80901699 0.00000 -0.50000000 -0.80901699 -0.30901699 0.00000 15 'point symmetry operation' -0.30901699 -0.50000000 -0.80901699 0.00000 0.50000000 -0.80901699 0.30901699 0.00000 -0.80901699 -0.30901699 0.50000000 0.00000 16 'point symmetry operation' 1.00000000 0.00000000 0.00000000 0.00000 0.00000000 -1.00000000 0.00000000 0.00000 0.00000000 0.00000000 -1.00000000 0.00000 17 'point symmetry operation' 0.30901699 -0.50000000 -0.80901699 0.00000 -0.50000000 -0.80901699 0.30901699 0.00000 -0.80901699 0.30901699 -0.50000000 0.00000 18 'point symmetry operation' -0.80901699 -0.30901699 -0.50000000 0.00000 -0.30901699 -0.50000000 0.80901699 0.00000 -0.50000000 0.80901699 0.30901699 0.00000 19 'point symmetry operation' -0.80901699 0.30901699 0.50000000 0.00000 0.30901699 -0.50000000 0.80901699 0.00000 0.50000000 0.80901699 0.30901699 0.00000 20 'point symmetry operation' 0.30901699 0.50000000 0.80901699 0.00000 0.50000000 -0.80901699 0.30901699 0.00000 0.80901699 0.30901699 -0.50000000 0.00000 21 'point symmetry operation' 0.00000000 -1.00000000 0.00000000 0.00000 0.00000000 0.00000000 -1.00000000 0.00000 1.00000000 0.00000000 0.00000000 0.00000 22 'point symmetry operation' -0.50000000 -0.80901699 0.30901699 0.00000 -0.80901699 0.30901699 -0.50000000 0.00000 0.30901699 -0.50000000 -0.80901699 0.00000 23 'point symmetry operation' -0.30901699 -0.50000000 0.80901699 0.00000 -0.50000000 0.80901699 0.30901699 0.00000 -0.80901699 -0.30901699 -0.50000000 0.00000 24 'point symmetry operation' 0.30901699 -0.50000000 0.80901699 0.00000 0.50000000 0.80901699 0.30901699 0.00000 -0.80901699 0.30901699 0.50000000 0.00000 25 'point symmetry operation' 0.50000000 -0.80901699 0.30901699 0.00000 0.80901699 0.30901699 -0.50000000 0.00000 0.30901699 0.50000000 0.80901699 0.00000 26 'point symmetry operation' 0.00000000 -1.00000000 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 0.00000 -1.00000000 0.00000000 0.00000000 0.00000 27 'point symmetry operation' -0.50000000 -0.80901699 0.30901699 0.00000 0.80901699 -0.30901699 0.50000000 0.00000 -0.30901699 0.50000000 0.80901699 0.00000 28 'point symmetry operation' -0.30901699 -0.50000000 0.80901699 0.00000 0.50000000 -0.80901699 -0.30901699 0.00000 0.80901699 0.30901699 0.50000000 0.00000 29 'point symmetry operation' 0.30901699 -0.50000000 0.80901699 0.00000 -0.50000000 -0.80901699 -0.30901699 0.00000 0.80901699 -0.30901699 -0.50000000 0.00000 30 'point symmetry operation' 0.50000000 -0.80901699 0.30901699 0.00000 -0.80901699 -0.30901699 0.50000000 0.00000 -0.30901699 -0.50000000 -0.80901699 0.00000 31 'point symmetry operation' 0.00000000 1.00000000 0.00000000 0.00000 0.00000000 0.00000000 -1.00000000 0.00000 -1.00000000 0.00000000 0.00000000 0.00000 32 'point symmetry operation' 0.50000000 0.80901699 -0.30901699 0.00000 -0.80901699 0.30901699 -0.50000000 0.00000 -0.30901699 0.50000000 0.80901699 0.00000 33 'point symmetry operation' 0.30901699 0.50000000 -0.80901699 0.00000 -0.50000000 0.80901699 0.30901699 0.00000 0.80901699 0.30901699 0.50000000 0.00000 34 'point symmetry operation' -0.30901699 0.50000000 -0.80901699 0.00000 0.50000000 0.80901699 0.30901699 0.00000 0.80901699 -0.30901699 -0.50000000 0.00000 35 'point symmetry operation' -0.50000000 0.80901699 -0.30901699 0.00000 0.80901699 0.30901699 -0.50000000 0.00000 -0.30901699 -0.50000000 -0.80901699 0.00000 36 'point symmetry operation' 0.00000000 1.00000000 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 0.00000 1.00000000 0.00000000 0.00000000 0.00000 37 'point symmetry operation' 0.50000000 0.80901699 -0.30901699 0.00000 0.80901699 -0.30901699 0.50000000 0.00000 0.30901699 -0.50000000 -0.80901699 0.00000 38 'point symmetry operation' 0.30901699 0.50000000 -0.80901699 0.00000 0.50000000 -0.80901699 -0.30901699 0.00000 -0.80901699 -0.30901699 -0.50000000 0.00000 39 'point symmetry operation' -0.30901699 0.50000000 -0.80901699 0.00000 -0.50000000 -0.80901699 -0.30901699 0.00000 -0.80901699 0.30901699 0.50000000 0.00000 40 'point symmetry operation' -0.50000000 0.80901699 -0.30901699 0.00000 -0.80901699 -0.30901699 0.50000000 0.00000 0.30901699 0.50000000 0.80901699 0.00000 41 'point symmetry operation' 0.00000000 0.00000000 1.00000000 0.00000 -1.00000000 0.00000000 0.00000000 0.00000 0.00000000 -1.00000000 0.00000000 0.00000 42 'point symmetry operation' 0.80901699 -0.30901699 0.50000000 0.00000 -0.30901699 0.50000000 0.80901699 0.00000 -0.50000000 -0.80901699 0.30901699 0.00000 43 'point symmetry operation' 0.50000000 -0.80901699 -0.30901699 0.00000 0.80901699 0.30901699 0.50000000 0.00000 -0.30901699 -0.50000000 0.80901699 0.00000 44 'point symmetry operation' -0.50000000 -0.80901699 -0.30901699 0.00000 0.80901699 -0.30901699 -0.50000000 0.00000 0.30901699 -0.50000000 0.80901699 0.00000 45 'point symmetry operation' -0.80901699 -0.30901699 0.50000000 0.00000 -0.30901699 -0.50000000 -0.80901699 0.00000 0.50000000 -0.80901699 0.30901699 0.00000 46 'point symmetry operation' 0.00000000 0.00000000 -1.00000000 0.00000 1.00000000 0.00000000 0.00000000 0.00000 0.00000000 -1.00000000 0.00000000 0.00000 47 'point symmetry operation' -0.80901699 0.30901699 -0.50000000 0.00000 0.30901699 -0.50000000 -0.80901699 0.00000 -0.50000000 -0.80901699 0.30901699 0.00000 48 'point symmetry operation' -0.50000000 0.80901699 0.30901699 0.00000 -0.80901699 -0.30901699 -0.50000000 0.00000 -0.30901699 -0.50000000 0.80901699 0.00000 49 'point symmetry operation' 0.50000000 0.80901699 0.30901699 0.00000 -0.80901699 0.30901699 0.50000000 0.00000 0.30901699 -0.50000000 0.80901699 0.00000 50 'point symmetry operation' 0.80901699 0.30901699 -0.50000000 0.00000 0.30901699 0.50000000 0.80901699 0.00000 0.50000000 -0.80901699 0.30901699 0.00000 51 'point symmetry operation' 0.00000000 0.00000000 1.00000000 0.00000 1.00000000 0.00000000 0.00000000 0.00000 0.00000000 1.00000000 0.00000000 0.00000 52 'point symmetry operation' 0.80901699 -0.30901699 0.50000000 0.00000 0.30901699 -0.50000000 -0.80901699 0.00000 0.50000000 0.80901699 -0.30901699 0.00000 53 'point symmetry operation' 0.50000000 -0.80901699 -0.30901699 0.00000 -0.80901699 -0.30901699 -0.50000000 0.00000 0.30901699 0.50000000 -0.80901699 0.00000 54 'point symmetry operation' -0.50000000 -0.80901699 -0.30901699 0.00000 -0.80901699 0.30901699 0.50000000 0.00000 -0.30901699 0.50000000 -0.80901699 0.00000 55 'point symmetry operation' -0.80901699 -0.30901699 0.50000000 0.00000 0.30901699 0.50000000 0.80901699 0.00000 -0.50000000 0.80901699 -0.30901699 0.00000 56 'point symmetry operation' 0.00000000 0.00000000 -1.00000000 0.00000 -1.00000000 0.00000000 0.00000000 0.00000 0.00000000 1.00000000 0.00000000 0.00000 57 'point symmetry operation' -0.80901699 0.30901699 -0.50000000 0.00000 -0.30901699 0.50000000 0.80901699 0.00000 0.50000000 0.80901699 -0.30901699 0.00000 58 'point symmetry operation' -0.50000000 0.80901699 0.30901699 0.00000 0.80901699 0.30901699 0.50000000 0.00000 0.30901699 0.50000000 -0.80901699 0.00000 59 'point symmetry operation' 0.50000000 0.80901699 0.30901699 0.00000 0.80901699 -0.30901699 -0.50000000 0.00000 -0.30901699 0.50000000 -0.80901699 0.00000 60 'point symmetry operation' 0.80901699 0.30901699 -0.50000000 0.00000 -0.30901699 -0.50000000 -0.80901699 0.00000 -0.50000000 0.80901699 -0.30901699 0.00000 # _em_3d_fitting.entry_id 5TSL _em_3d_fitting.id 1 _em_3d_fitting.details ;Weighting factor of 0.5 was chosen to weigh the contribution of the cryo-EM map in the molecular dynamic simulation. The simulation started with 20 000 steps of minimization followed by 100 000 steps of molecular dynamics before converging. ; _em_3d_fitting.overall_b_value ? _em_3d_fitting.ref_protocol 'FLEXIBLE FIT' _em_3d_fitting.ref_space REAL _em_3d_fitting.target_criteria ? _em_3d_fitting.method ? # _em_3d_fitting_list.3d_fitting_id 1 _em_3d_fitting_list.id 1 _em_3d_fitting_list.details ? _em_3d_fitting_list.pdb_chain_id C _em_3d_fitting_list.pdb_chain_residue_range 1-239 _em_3d_fitting_list.pdb_entry_id 4JGY _em_3d_fitting_list.initial_refinement_model_id 1 _em_3d_fitting_list.chain_id ? _em_3d_fitting_list.chain_residue_range ? _em_3d_fitting_list.source_name PDB _em_3d_fitting_list.type 'experimental model' _em_3d_fitting_list.accession_code 4JGY # _em_3d_reconstruction.entry_id 5TSL _em_3d_reconstruction.id 1 _em_3d_reconstruction.algorithm ? _em_3d_reconstruction.details ? _em_3d_reconstruction.refinement_type ? _em_3d_reconstruction.image_processing_id 1 _em_3d_reconstruction.num_class_averages ? _em_3d_reconstruction.num_particles 1642 _em_3d_reconstruction.resolution 6.5 _em_3d_reconstruction.resolution_method 'FSC 0.143 CUT-OFF' _em_3d_reconstruction.symmetry_type POINT _em_3d_reconstruction.method ? _em_3d_reconstruction.nominal_pixel_size ? _em_3d_reconstruction.actual_pixel_size ? _em_3d_reconstruction.magnification_calibration ? # _em_buffer.id 1 _em_buffer.details ? _em_buffer.pH 7.6 _em_buffer.specimen_id 1 _em_buffer.name ? # _em_entity_assembly.id 1 _em_entity_assembly.parent_id 0 _em_entity_assembly.details ? _em_entity_assembly.name 'coxsackievirus A16' _em_entity_assembly.source NATURAL _em_entity_assembly.type VIRUS _em_entity_assembly.entity_id_list 1 _em_entity_assembly.synonym ? _em_entity_assembly.oligomeric_details ? # _em_imaging.id 1 _em_imaging.entry_id 5TSL _em_imaging.accelerating_voltage 300 _em_imaging.alignment_procedure BASIC _em_imaging.c2_aperture_diameter ? _em_imaging.calibrated_defocus_max ? _em_imaging.calibrated_defocus_min ? _em_imaging.calibrated_magnification ? _em_imaging.cryogen NITROGEN _em_imaging.details ? _em_imaging.electron_source 'FIELD EMISSION GUN' _em_imaging.illumination_mode 'FLOOD BEAM' _em_imaging.microscope_model 'FEI TITAN KRIOS' _em_imaging.mode 'BRIGHT FIELD' _em_imaging.nominal_cs 0.05 _em_imaging.nominal_defocus_max 3500 _em_imaging.nominal_defocus_min 2000 _em_imaging.nominal_magnification 57000 _em_imaging.recording_temperature_maximum 90 _em_imaging.recording_temperature_minimum 70 _em_imaging.residual_tilt ? _em_imaging.specimen_holder_model 'FEI TITAN KRIOS AUTOGRID HOLDER' _em_imaging.specimen_id 1 _em_imaging.citation_id ? _em_imaging.date ? _em_imaging.temperature ? _em_imaging.tilt_angle_min ? _em_imaging.tilt_angle_max ? _em_imaging.astigmatism ? _em_imaging.detector_distance ? _em_imaging.electron_beam_tilt_params ? _em_imaging.specimen_holder_type ? # _em_sample_support.id 1 _em_sample_support.specimen_id 1 _em_sample_support.method ? _em_sample_support.film_material ? _em_sample_support.grid_material ? _em_sample_support.grid_mesh_size ? _em_sample_support.grid_type ? _em_sample_support.details ? # _em_virus_entity.entity_assembly_id 1 _em_virus_entity.empty YES _em_virus_entity.enveloped NO _em_virus_entity.virus_isolate STRAIN _em_virus_entity.virus_type VIRION _em_virus_entity.id 1 _em_virus_entity.virus_host_category ? _em_virus_entity.details ? # _em_vitrification.id 1 _em_vitrification.specimen_id 1 _em_vitrification.chamber_temperature ? _em_vitrification.cryogen_name ETHANE _em_vitrification.details ? _em_vitrification.humidity ? _em_vitrification.instrument ? _em_vitrification.entry_id 5TSL _em_vitrification.citation_id ? _em_vitrification.method ? _em_vitrification.temp ? _em_vitrification.time_resolved_state ? # _em_experiment.entry_id 5TSL _em_experiment.id 1 _em_experiment.aggregation_state PARTICLE _em_experiment.reconstruction_method 'SINGLE PARTICLE' _em_experiment.entity_assembly_id 1 # _em_single_particle_entity.entry_id 5TSL _em_single_particle_entity.id 1 _em_single_particle_entity.image_processing_id 1 _em_single_particle_entity.point_symmetry I # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 C HIS 180 ? A HIS 180 2 1 Y 1 C ALA 181 ? A ALA 181 3 1 Y 1 C ARG 182 ? A ARG 182 4 1 Y 1 C ALA 183 ? A ALA 183 5 1 Y 1 C GLY 184 ? A GLY 184 6 1 Y 1 C TYR 185 ? A TYR 185 7 1 Y 1 C PHE 186 ? A PHE 186 8 1 Y 1 C GLN 237 ? A GLN 237 9 1 Y 1 C THR 238 ? A THR 238 10 1 Y 1 C ALA 239 ? A ALA 239 11 1 Y 1 C ASN 240 ? A ASN 240 12 1 Y 1 C ILE 241 ? A ILE 241 13 1 Y 1 C GLN 242 ? A GLN 242 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _em_buffer_component.buffer_id 1 _em_buffer_component.id 1 _em_buffer_component.concentration 0.15 _em_buffer_component.concentration_units M _em_buffer_component.formula ? _em_buffer_component.name 'phosphate buffered saline(PBS) buffer' # _em_ctf_correction.id 1 _em_ctf_correction.em_image_processing_id 1 _em_ctf_correction.type 'PHASE FLIPPING ONLY' _em_ctf_correction.details ? # _em_image_processing.id 1 _em_image_processing.image_recording_id 1 _em_image_processing.details ? # _em_image_recording.id 1 _em_image_recording.imaging_id 1 _em_image_recording.avg_electron_dose_per_image 25 _em_image_recording.average_exposure_time 1.1 _em_image_recording.details ? _em_image_recording.detector_mode INTEGRATING _em_image_recording.film_or_detector_model 'FEI FALCON II (4k x 4k)' _em_image_recording.num_diffraction_images ? _em_image_recording.num_grids_imaged ? _em_image_recording.num_real_images ? # loop_ _em_software.id _em_software.category _em_software.details _em_software.name _em_software.version _em_software.image_processing_id _em_software.fitting_id _em_software.imaging_id 1 'PARTICLE SELECTION' ? jspr ? 1 ? ? 2 'IMAGE ACQUISITION' ? ? ? ? ? 1 3 MASKING ? ? ? ? ? ? 4 'CTF CORRECTION' ? jspr ? 1 ? ? 5 'LAYERLINE INDEXING' ? ? ? ? ? ? 6 'DIFFRACTION INDEXING' ? ? ? ? ? ? 7 'MODEL FITTING' ? NAMD 2.1 ? 1 ? 8 OTHER ? ? ? ? ? ? 9 'INITIAL EULER ASSIGNMENT' ? jspr ? 1 ? ? 10 'FINAL EULER ASSIGNMENT' ? jspr ? 1 ? ? 11 CLASSIFICATION ? jspr ? 1 ? ? 12 RECONSTRUCTION ? jspr ? 1 ? ? 13 'MODEL REFINEMENT' ? NAMD 2.1 ? 1 ? # _em_specimen.id 1 _em_specimen.experiment_id 1 _em_specimen.concentration 3.22 _em_specimen.details ? _em_specimen.embedding_applied NO _em_specimen.shadowing_applied NO _em_specimen.staining_applied NO _em_specimen.vitrification_applied YES # _em_virus_natural_host.id 1 _em_virus_natural_host.entity_assembly_id 1 _em_virus_natural_host.ncbi_tax_id 9606 _em_virus_natural_host.organism 'Homo sapiens' _em_virus_natural_host.strain ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4JGY # _atom_sites.entry_id 5TSL _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_