data_5TWG # _entry.id 5TWG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.280 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5TWG WWPDB D_1000224927 # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 5TWF unspecified PDB . 5TWH unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5TWG _pdbx_database_status.recvd_initial_deposition_date 2016-11-13 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Xiong, S.' 1 ? 'Sicheri, F.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Mol. Cell Proteomics' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1535-9484 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 16 _citation.language ? _citation.page_first 1098 _citation.page_last 1110 _citation.title 'MOB1 Mediated Phospho-recognition in the Core Mammalian Hippo Pathway.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1074/mcp.M116.065490 _citation.pdbx_database_id_PubMed 28373298 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Couzens, A.L.' 1 primary 'Xiong, S.' 2 primary 'Knight, J.D.R.' 3 primary 'Mao, D.Y.' 4 primary 'Guettler, S.' 5 primary 'Picaud, S.' 6 primary 'Kurinov, I.' 7 primary 'Filippakopoulos, P.' 8 primary 'Sicheri, F.' 9 primary 'Gingras, A.C.' 10 # _cell.entry_id 5TWG _cell.length_a 60.660 _cell.length_b 60.660 _cell.length_c 138.310 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5TWG _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'MOB kinase activator 1A' 25111.754 1 ? ? ? ? 2 polymer man 'T353 peptide' 1617.691 1 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 4 water nat water 18.015 23 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Mob1 alpha,Mob1A,Mob1 homolog 1B,Mps one binder kinase activator-like 1B' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MSFLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCT EASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYA HIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDR ; ;MSFLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCT EASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYA HIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDR ; A ? 2 'polypeptide(L)' no yes 'VASTMTDGAN(TPO)MIEP' VASTMTDGANTMIEP E ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 PHE n 1 4 LEU n 1 5 PHE n 1 6 SER n 1 7 SER n 1 8 ARG n 1 9 SER n 1 10 SER n 1 11 LYS n 1 12 THR n 1 13 PHE n 1 14 LYS n 1 15 PRO n 1 16 LYS n 1 17 LYS n 1 18 ASN n 1 19 ILE n 1 20 PRO n 1 21 GLU n 1 22 GLY n 1 23 SER n 1 24 HIS n 1 25 GLN n 1 26 TYR n 1 27 GLU n 1 28 LEU n 1 29 LEU n 1 30 LYS n 1 31 HIS n 1 32 ALA n 1 33 GLU n 1 34 ALA n 1 35 THR n 1 36 LEU n 1 37 GLY n 1 38 SER n 1 39 GLY n 1 40 ASN n 1 41 LEU n 1 42 ARG n 1 43 GLN n 1 44 ALA n 1 45 VAL n 1 46 MET n 1 47 LEU n 1 48 PRO n 1 49 GLU n 1 50 GLY n 1 51 GLU n 1 52 ASP n 1 53 LEU n 1 54 ASN n 1 55 GLU n 1 56 TRP n 1 57 ILE n 1 58 ALA n 1 59 VAL n 1 60 ASN n 1 61 THR n 1 62 VAL n 1 63 ASP n 1 64 PHE n 1 65 PHE n 1 66 ASN n 1 67 GLN n 1 68 ILE n 1 69 ASN n 1 70 MET n 1 71 LEU n 1 72 TYR n 1 73 GLY n 1 74 THR n 1 75 ILE n 1 76 THR n 1 77 GLU n 1 78 PHE n 1 79 CYS n 1 80 THR n 1 81 GLU n 1 82 ALA n 1 83 SER n 1 84 CYS n 1 85 PRO n 1 86 VAL n 1 87 MET n 1 88 SER n 1 89 ALA n 1 90 GLY n 1 91 PRO n 1 92 ARG n 1 93 TYR n 1 94 GLU n 1 95 TYR n 1 96 HIS n 1 97 TRP n 1 98 ALA n 1 99 ASP n 1 100 GLY n 1 101 THR n 1 102 ASN n 1 103 ILE n 1 104 LYS n 1 105 LYS n 1 106 PRO n 1 107 ILE n 1 108 LYS n 1 109 CYS n 1 110 SER n 1 111 ALA n 1 112 PRO n 1 113 LYS n 1 114 TYR n 1 115 ILE n 1 116 ASP n 1 117 TYR n 1 118 LEU n 1 119 MET n 1 120 THR n 1 121 TRP n 1 122 VAL n 1 123 GLN n 1 124 ASP n 1 125 GLN n 1 126 LEU n 1 127 ASP n 1 128 ASP n 1 129 GLU n 1 130 THR n 1 131 LEU n 1 132 PHE n 1 133 PRO n 1 134 SER n 1 135 LYS n 1 136 ILE n 1 137 GLY n 1 138 VAL n 1 139 PRO n 1 140 PHE n 1 141 PRO n 1 142 LYS n 1 143 ASN n 1 144 PHE n 1 145 MET n 1 146 SER n 1 147 VAL n 1 148 ALA n 1 149 LYS n 1 150 THR n 1 151 ILE n 1 152 LEU n 1 153 LYS n 1 154 ARG n 1 155 LEU n 1 156 PHE n 1 157 ARG n 1 158 VAL n 1 159 TYR n 1 160 ALA n 1 161 HIS n 1 162 ILE n 1 163 TYR n 1 164 HIS n 1 165 GLN n 1 166 HIS n 1 167 PHE n 1 168 ASP n 1 169 SER n 1 170 VAL n 1 171 MET n 1 172 GLN n 1 173 LEU n 1 174 GLN n 1 175 GLU n 1 176 GLU n 1 177 ALA n 1 178 HIS n 1 179 LEU n 1 180 ASN n 1 181 THR n 1 182 SER n 1 183 PHE n 1 184 LYS n 1 185 HIS n 1 186 PHE n 1 187 ILE n 1 188 PHE n 1 189 PHE n 1 190 VAL n 1 191 GLN n 1 192 GLU n 1 193 PHE n 1 194 ASN n 1 195 LEU n 1 196 ILE n 1 197 ASP n 1 198 ARG n 1 199 ARG n 1 200 GLU n 1 201 LEU n 1 202 ALA n 1 203 PRO n 1 204 LEU n 1 205 GLN n 1 206 GLU n 1 207 LEU n 1 208 ILE n 1 209 GLU n 1 210 LYS n 1 211 LEU n 1 212 GLY n 1 213 SER n 1 214 LYS n 1 215 ASP n 1 216 ARG n 2 1 VAL n 2 2 ALA n 2 3 SER n 2 4 THR n 2 5 MET n 2 6 THR n 2 7 ASP n 2 8 GLY n 2 9 ALA n 2 10 ASN n 2 11 TPO n 2 12 MET n 2 13 ILE n 2 14 GLU n 2 15 PRO n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 216 Human ? 'MOB1A, C2orf6, MOB4B, MOBK1B, MOBKL1B' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 15 Human ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP MOB1A_HUMAN Q9H8S9 ? 1 ;MSFLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCT EASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYA HIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDR ; 1 2 PDB 5TWG 5TWG ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5TWG A 1 ? 216 ? Q9H8S9 1 ? 216 ? 1 216 2 2 5TWG E 1 ? 15 ? 5TWG -5 ? 9 ? -5 9 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TPO 'L-peptide linking' n PHOSPHOTHREONINE PHOSPHONOTHREONINE 'C4 H10 N O6 P' 199.099 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5TWG _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.48 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.33 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M MES pH 6.0, 0.2 M LiCl and 20% PEG 6000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-02-05 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97920 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-C' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97920 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-C _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5TWG _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.1 _reflns.d_resolution_low 56 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11982 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.5 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 2.8 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 30 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high . _reflns_shell.d_res_low ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 5TWG _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 11981 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 45.602 _refine.ls_d_res_high 2.300 _refine.ls_percent_reflns_obs 98.80 _refine.ls_R_factor_obs 0.2172 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2153 _refine.ls_R_factor_R_free 0.2524 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.82 _refine.ls_number_reflns_R_free 578 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.33 _refine.pdbx_overall_phase_error 29.40 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1572 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 23 _refine_hist.number_atoms_total 1596 _refine_hist.d_res_high 2.300 _refine_hist.d_res_low 45.602 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.013 ? ? 1613 'X-RAY DIFFRACTION' ? f_angle_d 1.299 ? ? 2197 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 18.434 ? ? 946 'X-RAY DIFFRACTION' ? f_chiral_restr 0.064 ? ? 242 'X-RAY DIFFRACTION' ? f_plane_restr 0.008 ? ? 282 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all 'X-RAY DIFFRACTION' . 2.3000 2.5314 2794 0.2851 100.00 0.3508 . . 149 . . 'X-RAY DIFFRACTION' . 2.5314 2.8977 2787 0.2569 98.00 0.3187 . . 134 . . 'X-RAY DIFFRACTION' . 2.8977 3.6506 2843 0.2407 99.00 0.2770 . . 136 . . 'X-RAY DIFFRACTION' . 3.6506 45.6114 2979 0.1855 98.00 0.2172 . . 159 . . # _struct.entry_id 5TWG _struct.title 'human MOB1A bound to human MST1 phosphorylated T353 peptide' _struct.pdbx_descriptor 'MOB kinase activator 1A, T353 peptide' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5TWG _struct_keywords.text 'complex, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 24 ? LEU A 36 ? HIS A 24 LEU A 36 1 ? 13 HELX_P HELX_P2 AA2 GLY A 37 ? GLY A 39 ? GLY A 37 GLY A 39 5 ? 3 HELX_P HELX_P3 AA3 ASN A 40 ? VAL A 45 ? ASN A 40 VAL A 45 1 ? 6 HELX_P HELX_P4 AA4 ASP A 52 ? ILE A 75 ? ASP A 52 ILE A 75 1 ? 24 HELX_P HELX_P5 AA5 THR A 76 ? CYS A 79 ? THR A 76 CYS A 79 5 ? 4 HELX_P HELX_P6 AA6 SER A 110 ? ASP A 127 ? SER A 110 ASP A 127 1 ? 18 HELX_P HELX_P7 AA7 ASN A 143 ? GLN A 165 ? ASN A 143 GLN A 165 1 ? 23 HELX_P HELX_P8 AA8 HIS A 166 ? LEU A 173 ? HIS A 166 LEU A 173 1 ? 8 HELX_P HELX_P9 AA9 GLU A 175 ? ASN A 194 ? GLU A 175 ASN A 194 1 ? 20 HELX_P HELX_P10 AB1 ASP A 197 ? ALA A 202 ? ASP A 197 ALA A 202 1 ? 6 HELX_P HELX_P11 AB2 LEU A 204 ? LEU A 211 ? LEU A 204 LEU A 211 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? A CYS 79 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 79 A ZN 301 1_555 ? ? ? ? ? ? ? 2.498 ? metalc2 metalc ? ? A CYS 84 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 84 A ZN 301 1_555 ? ? ? ? ? ? ? 2.399 ? metalc3 metalc ? ? A HIS 166 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 166 A ZN 301 1_555 ? ? ? ? ? ? ? 1.990 ? covale1 covale both ? B TPO 11 C ? ? ? 1_555 B MET 12 N ? ? E TPO 5 E MET 6 1_555 ? ? ? ? ? ? ? 1.336 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference metalc ? ? covale ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ASP _struct_mon_prot_cis.label_seq_id 99 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ASP _struct_mon_prot_cis.auth_seq_id 99 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 GLY _struct_mon_prot_cis.pdbx_label_seq_id_2 100 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 GLY _struct_mon_prot_cis.pdbx_auth_seq_id_2 100 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -15.96 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 MET A 87 ? ALA A 89 ? MET A 87 ALA A 89 AA1 2 TYR A 93 ? TYR A 95 ? TYR A 93 TYR A 95 AA1 3 MET B 12 ? ILE B 13 ? MET E 6 ILE E 7 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N MET A 87 ? N MET A 87 O TYR A 95 ? O TYR A 95 AA1 2 3 N GLU A 94 ? N GLU A 94 O ILE B 13 ? O ILE E 7 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 301 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'binding site for residue ZN A 301' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 79 ? CYS A 79 . ? 1_555 ? 2 AC1 4 CYS A 84 ? CYS A 84 . ? 1_555 ? 3 AC1 4 HIS A 161 ? HIS A 161 . ? 1_555 ? 4 AC1 4 HIS A 166 ? HIS A 166 . ? 1_555 ? # _atom_sites.entry_id 5TWG _atom_sites.fract_transf_matrix[1][1] 0.016485 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016485 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007230 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 PHE 3 3 ? ? ? A . n A 1 4 LEU 4 4 ? ? ? A . n A 1 5 PHE 5 5 ? ? ? A . n A 1 6 SER 6 6 ? ? ? A . n A 1 7 SER 7 7 ? ? ? A . n A 1 8 ARG 8 8 ? ? ? A . n A 1 9 SER 9 9 ? ? ? A . n A 1 10 SER 10 10 ? ? ? A . n A 1 11 LYS 11 11 ? ? ? A . n A 1 12 THR 12 12 ? ? ? A . n A 1 13 PHE 13 13 ? ? ? A . n A 1 14 LYS 14 14 ? ? ? A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 ILE 19 19 ? ? ? A . n A 1 20 PRO 20 20 ? ? ? A . n A 1 21 GLU 21 21 ? ? ? A . n A 1 22 GLY 22 22 ? ? ? A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 HIS 24 24 24 HIS HIS A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 HIS 31 31 31 HIS HIS A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 MET 46 46 46 MET MET A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 TRP 56 56 56 TRP TRP A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 ASN 69 69 69 ASN ASN A . n A 1 70 MET 70 70 70 MET MET A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 TYR 72 72 72 TYR TYR A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 PHE 78 78 78 PHE PHE A . n A 1 79 CYS 79 79 79 CYS CYS A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 CYS 84 84 84 CYS CYS A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 MET 87 87 87 MET MET A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 PRO 91 91 91 PRO PRO A . n A 1 92 ARG 92 92 92 ARG ARG A . n A 1 93 TYR 93 93 93 TYR TYR A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 TYR 95 95 95 TYR TYR A . n A 1 96 HIS 96 96 96 HIS HIS A . n A 1 97 TRP 97 97 97 TRP TRP A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 ASN 102 102 102 ASN ASN A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 PRO 106 106 106 PRO PRO A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 CYS 109 109 109 CYS CYS A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 PRO 112 112 112 PRO PRO A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 TYR 114 114 114 TYR TYR A . n A 1 115 ILE 115 115 115 ILE ILE A . n A 1 116 ASP 116 116 116 ASP ASP A . n A 1 117 TYR 117 117 117 TYR TYR A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 MET 119 119 119 MET MET A . n A 1 120 THR 120 120 120 THR THR A . n A 1 121 TRP 121 121 121 TRP TRP A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 GLN 123 123 123 GLN GLN A . n A 1 124 ASP 124 124 124 ASP ASP A . n A 1 125 GLN 125 125 125 GLN GLN A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 ASP 127 127 127 ASP ASP A . n A 1 128 ASP 128 128 128 ASP ASP A . n A 1 129 GLU 129 129 129 GLU GLU A . n A 1 130 THR 130 130 130 THR THR A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 PHE 132 132 132 PHE PHE A . n A 1 133 PRO 133 133 133 PRO PRO A . n A 1 134 SER 134 134 134 SER SER A . n A 1 135 LYS 135 135 135 LYS LYS A . n A 1 136 ILE 136 136 136 ILE ILE A . n A 1 137 GLY 137 137 137 GLY GLY A . n A 1 138 VAL 138 138 138 VAL VAL A . n A 1 139 PRO 139 139 139 PRO PRO A . n A 1 140 PHE 140 140 140 PHE PHE A . n A 1 141 PRO 141 141 141 PRO PRO A . n A 1 142 LYS 142 142 142 LYS LYS A . n A 1 143 ASN 143 143 143 ASN ASN A . n A 1 144 PHE 144 144 144 PHE PHE A . n A 1 145 MET 145 145 145 MET MET A . n A 1 146 SER 146 146 146 SER SER A . n A 1 147 VAL 147 147 147 VAL VAL A . n A 1 148 ALA 148 148 148 ALA ALA A . n A 1 149 LYS 149 149 149 LYS LYS A . n A 1 150 THR 150 150 150 THR THR A . n A 1 151 ILE 151 151 151 ILE ILE A . n A 1 152 LEU 152 152 152 LEU LEU A . n A 1 153 LYS 153 153 153 LYS LYS A . n A 1 154 ARG 154 154 154 ARG ARG A . n A 1 155 LEU 155 155 155 LEU LEU A . n A 1 156 PHE 156 156 156 PHE PHE A . n A 1 157 ARG 157 157 157 ARG ARG A . n A 1 158 VAL 158 158 158 VAL VAL A . n A 1 159 TYR 159 159 159 TYR TYR A . n A 1 160 ALA 160 160 160 ALA ALA A . n A 1 161 HIS 161 161 161 HIS HIS A . n A 1 162 ILE 162 162 162 ILE ILE A . n A 1 163 TYR 163 163 163 TYR TYR A . n A 1 164 HIS 164 164 164 HIS HIS A . n A 1 165 GLN 165 165 165 GLN GLN A . n A 1 166 HIS 166 166 166 HIS HIS A . n A 1 167 PHE 167 167 167 PHE PHE A . n A 1 168 ASP 168 168 168 ASP ASP A . n A 1 169 SER 169 169 169 SER SER A . n A 1 170 VAL 170 170 170 VAL VAL A . n A 1 171 MET 171 171 171 MET MET A . n A 1 172 GLN 172 172 172 GLN GLN A . n A 1 173 LEU 173 173 173 LEU LEU A . n A 1 174 GLN 174 174 174 GLN GLN A . n A 1 175 GLU 175 175 175 GLU GLU A . n A 1 176 GLU 176 176 176 GLU GLU A . n A 1 177 ALA 177 177 177 ALA ALA A . n A 1 178 HIS 178 178 178 HIS HIS A . n A 1 179 LEU 179 179 179 LEU LEU A . n A 1 180 ASN 180 180 180 ASN ASN A . n A 1 181 THR 181 181 181 THR THR A . n A 1 182 SER 182 182 182 SER SER A . n A 1 183 PHE 183 183 183 PHE PHE A . n A 1 184 LYS 184 184 184 LYS LYS A . n A 1 185 HIS 185 185 185 HIS HIS A . n A 1 186 PHE 186 186 186 PHE PHE A . n A 1 187 ILE 187 187 187 ILE ILE A . n A 1 188 PHE 188 188 188 PHE PHE A . n A 1 189 PHE 189 189 189 PHE PHE A . n A 1 190 VAL 190 190 190 VAL VAL A . n A 1 191 GLN 191 191 191 GLN GLN A . n A 1 192 GLU 192 192 192 GLU GLU A . n A 1 193 PHE 193 193 193 PHE PHE A . n A 1 194 ASN 194 194 194 ASN ASN A . n A 1 195 LEU 195 195 195 LEU LEU A . n A 1 196 ILE 196 196 196 ILE ILE A . n A 1 197 ASP 197 197 197 ASP ASP A . n A 1 198 ARG 198 198 198 ARG ARG A . n A 1 199 ARG 199 199 199 ARG ARG A . n A 1 200 GLU 200 200 200 GLU GLU A . n A 1 201 LEU 201 201 201 LEU LEU A . n A 1 202 ALA 202 202 202 ALA ALA A . n A 1 203 PRO 203 203 203 PRO PRO A . n A 1 204 LEU 204 204 204 LEU LEU A . n A 1 205 GLN 205 205 205 GLN GLN A . n A 1 206 GLU 206 206 206 GLU GLU A . n A 1 207 LEU 207 207 207 LEU LEU A . n A 1 208 ILE 208 208 208 ILE ILE A . n A 1 209 GLU 209 209 209 GLU GLU A . n A 1 210 LYS 210 210 210 LYS LYS A . n A 1 211 LEU 211 211 211 LEU LEU A . n A 1 212 GLY 212 212 ? ? ? A . n A 1 213 SER 213 213 ? ? ? A . n A 1 214 LYS 214 214 ? ? ? A . n A 1 215 ASP 215 215 ? ? ? A . n A 1 216 ARG 216 216 ? ? ? A . n B 2 1 VAL 1 -5 ? ? ? E . n B 2 2 ALA 2 -4 ? ? ? E . n B 2 3 SER 3 -3 ? ? ? E . n B 2 4 THR 4 -2 ? ? ? E . n B 2 5 MET 5 -1 ? ? ? E . n B 2 6 THR 6 0 ? ? ? E . n B 2 7 ASP 7 1 ? ? ? E . n B 2 8 GLY 8 2 ? ? ? E . n B 2 9 ALA 9 3 ? ? ? E . n B 2 10 ASN 10 4 ? ? ? E . n B 2 11 TPO 11 5 5 TPO TPO E . n B 2 12 MET 12 6 6 MET MET E . n B 2 13 ILE 13 7 7 ILE ILE E . n B 2 14 GLU 14 8 8 GLU GLU E . n B 2 15 PRO 15 9 9 PRO PRO E . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 ZN 1 301 1 ZN ZN A . D 4 HOH 1 401 17 HOH HOH A . D 4 HOH 2 402 23 HOH HOH A . D 4 HOH 3 403 18 HOH HOH A . D 4 HOH 4 404 2 HOH HOH A . D 4 HOH 5 405 14 HOH HOH A . D 4 HOH 6 406 3 HOH HOH A . D 4 HOH 7 407 5 HOH HOH A . D 4 HOH 8 408 4 HOH HOH A . D 4 HOH 9 409 19 HOH HOH A . D 4 HOH 10 410 13 HOH HOH A . D 4 HOH 11 411 22 HOH HOH A . D 4 HOH 12 412 1 HOH HOH A . D 4 HOH 13 413 7 HOH HOH A . D 4 HOH 14 414 16 HOH HOH A . D 4 HOH 15 415 15 HOH HOH A . D 4 HOH 16 416 9 HOH HOH A . D 4 HOH 17 417 6 HOH HOH A . D 4 HOH 18 418 10 HOH HOH A . D 4 HOH 19 419 8 HOH HOH A . D 4 HOH 20 420 11 HOH HOH A . D 4 HOH 21 421 21 HOH HOH A . D 4 HOH 22 422 12 HOH HOH A . D 4 HOH 23 423 20 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 770 ? 1 MORE -8 ? 1 'SSA (A^2)' 10310 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 406 ? D HOH . 2 1 A HOH 418 ? D HOH . 3 1 A HOH 423 ? D HOH . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 79 ? A CYS 79 ? 1_555 ZN ? C ZN . ? A ZN 301 ? 1_555 SG ? A CYS 84 ? A CYS 84 ? 1_555 124.0 ? 2 SG ? A CYS 79 ? A CYS 79 ? 1_555 ZN ? C ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 166 ? A HIS 166 ? 1_555 111.1 ? 3 SG ? A CYS 84 ? A CYS 84 ? 1_555 ZN ? C ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 166 ? A HIS 166 ? 1_555 93.5 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-04-12 2 'Structure model' 1 1 2017-04-19 3 'Structure model' 1 2 2017-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' citation 2 3 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_citation.country' 2 3 'Structure model' '_citation.journal_volume' 3 3 'Structure model' '_citation.page_first' 4 3 'Structure model' '_citation.page_last' 5 3 'Structure model' '_citation.title' 6 3 'Structure model' '_citation_author.name' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 44.1378 -21.9750 5.0905 0.4842 0.5346 0.4092 0.0668 -0.0144 0.0034 6.4484 8.0689 9.4220 -1.4297 0.1515 3.6410 -0.1963 -0.6115 0.6449 0.3338 0.2046 -0.0988 -0.3094 0.7325 0.2084 'X-RAY DIFFRACTION' 2 ? refined 35.1644 -17.3709 7.3648 0.3999 0.4745 0.5145 0.0825 0.0519 -0.0656 4.0692 4.0147 7.4540 0.7032 -0.0527 -2.0542 -0.0363 -0.2491 -0.0971 -0.0713 -0.2086 0.0565 -0.0175 -0.1745 0.1918 'X-RAY DIFFRACTION' 3 ? refined 23.0281 2.7301 0.5278 1.0587 0.9069 0.9025 0.4618 -0.1453 -0.1123 3.6378 1.9414 2.4314 1.1118 2.0036 -0.6820 -0.0004 -0.3712 0.8103 -0.2289 -0.1396 0.0937 -1.2452 -0.5291 0.1879 'X-RAY DIFFRACTION' 4 ? refined 33.4816 0.2960 4.0906 0.8155 0.5229 0.7291 0.1366 -0.1213 -0.1154 8.2905 3.2679 6.9648 -1.9684 3.3399 -1.6929 -0.0275 0.2224 1.3934 0.1794 -0.7361 0.0195 -1.4503 0.0168 0.5821 'X-RAY DIFFRACTION' 5 ? refined 46.0629 -6.4605 14.8301 0.5278 0.9704 0.8700 0.0556 -0.0724 -0.2015 1.6790 0.6951 4.0320 -0.7804 1.5192 -0.7392 0.6069 0.2126 -0.0182 0.4009 -0.0969 -0.6973 -0.4177 1.1787 -0.5072 'X-RAY DIFFRACTION' 6 ? refined 29.8939 -8.0606 9.5768 0.4805 0.5214 0.6941 0.1366 -0.0153 -0.1596 4.7554 2.4959 5.2428 -0.7488 -0.8788 0.6327 -0.2911 -0.7315 0.8584 -0.0415 -0.1779 0.2201 -1.0791 -1.0116 0.6529 'X-RAY DIFFRACTION' 7 ? refined 26.2967 -16.6254 -1.5630 0.4563 0.5750 0.6026 0.0697 -0.0674 -0.1725 4.9958 4.4672 7.2257 -0.0898 -3.0549 -0.0464 0.3703 0.2766 0.0082 -0.5570 -0.0703 0.4372 0.4307 -1.2880 0.0201 'X-RAY DIFFRACTION' 8 ? refined 18.7543 -14.0186 8.9119 0.4455 1.0293 0.8419 0.1008 -0.0432 -0.2550 5.1739 2.2626 3.2474 -0.6700 -2.0601 -2.0316 -0.1510 -0.5043 -0.4912 0.3075 -0.0565 1.4180 -0.1860 -1.2488 0.4995 'X-RAY DIFFRACTION' 9 ? refined 13.2684 -0.2364 7.2218 1.0999 1.3466 0.9020 0.4070 -0.1302 -0.0791 7.1090 2.8604 4.3730 -1.3370 5.3902 -0.1587 -0.3913 2.4005 -0.1758 0.1674 0.4133 0.9854 1.2259 0.7489 0.2728 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 15 through 38 ) ; 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 39 through 75 ) ; 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 76 through 110 ) ; 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 111 through 126 ) ; 'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 127 through 136 ) ; 'X-RAY DIFFRACTION' 6 6 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 137 through 165 ) ; 'X-RAY DIFFRACTION' 7 7 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 166 through 193 ) ; 'X-RAY DIFFRACTION' 8 8 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 194 through 211 ) ; 'X-RAY DIFFRACTION' 9 9 ? ? ? ? ? ? ? ? ? ;chain 'E' and (resid 6 through 9 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.10_2155: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OE2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLU _pdbx_validate_close_contact.auth_seq_id_1 27 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 ND1 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HIS _pdbx_validate_close_contact.auth_seq_id_2 31 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.99 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A GLU 49 ? ? 1_555 NH2 A ARG 199 ? ? 6_545 1.64 2 1 OE2 A GLU 51 ? ? 1_555 NH1 A ARG 199 ? ? 6_545 2.08 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CB A GLU 27 ? ? CG A GLU 27 ? ? 1.725 1.517 0.208 0.019 N 2 1 CG A GLU 27 ? ? CD A GLU 27 ? ? 1.608 1.515 0.093 0.015 N 3 1 CD A GLU 27 ? ? OE2 A GLU 27 ? ? 1.340 1.252 0.088 0.011 N # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CA _pdbx_validate_rmsd_angle.auth_asym_id_1 E _pdbx_validate_rmsd_angle.auth_comp_id_1 GLU _pdbx_validate_rmsd_angle.auth_seq_id_1 8 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CB _pdbx_validate_rmsd_angle.auth_asym_id_2 E _pdbx_validate_rmsd_angle.auth_comp_id_2 GLU _pdbx_validate_rmsd_angle.auth_seq_id_2 8 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CG _pdbx_validate_rmsd_angle.auth_asym_id_3 E _pdbx_validate_rmsd_angle.auth_comp_id_3 GLU _pdbx_validate_rmsd_angle.auth_seq_id_3 8 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 126.76 _pdbx_validate_rmsd_angle.angle_target_value 113.40 _pdbx_validate_rmsd_angle.angle_deviation 13.36 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.20 _pdbx_validate_rmsd_angle.linker_flag N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id THR _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 101 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -135.34 _pdbx_validate_torsion.psi -68.19 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 16 ? CG ? A LYS 16 CG 2 1 Y 1 A LYS 16 ? CD ? A LYS 16 CD 3 1 Y 1 A LYS 16 ? CE ? A LYS 16 CE 4 1 Y 1 A LYS 16 ? NZ ? A LYS 16 NZ 5 1 Y 1 A LYS 17 ? CG ? A LYS 17 CG 6 1 Y 1 A LYS 17 ? CD ? A LYS 17 CD 7 1 Y 1 A LYS 17 ? CE ? A LYS 17 CE 8 1 Y 1 A LYS 17 ? NZ ? A LYS 17 NZ 9 1 Y 1 A ARG 92 ? CG ? A ARG 92 CG 10 1 Y 1 A ARG 92 ? CD ? A ARG 92 CD 11 1 Y 1 A ARG 92 ? NE ? A ARG 92 NE 12 1 Y 1 A ARG 92 ? CZ ? A ARG 92 CZ 13 1 Y 1 A ARG 92 ? NH1 ? A ARG 92 NH1 14 1 Y 1 A ARG 92 ? NH2 ? A ARG 92 NH2 15 1 Y 1 A THR 101 ? OG1 ? A THR 101 OG1 16 1 Y 1 A THR 101 ? CG2 ? A THR 101 CG2 17 1 Y 1 A ASN 102 ? CG ? A ASN 102 CG 18 1 Y 1 A ASN 102 ? OD1 ? A ASN 102 OD1 19 1 Y 1 A ASN 102 ? ND2 ? A ASN 102 ND2 20 1 Y 1 A LYS 104 ? CG ? A LYS 104 CG 21 1 Y 1 A LYS 104 ? CD ? A LYS 104 CD 22 1 Y 1 A LYS 104 ? CE ? A LYS 104 CE 23 1 Y 1 A LYS 104 ? NZ ? A LYS 104 NZ 24 1 Y 1 A LYS 105 ? CG ? A LYS 105 CG 25 1 Y 1 A LYS 105 ? CD ? A LYS 105 CD 26 1 Y 1 A LYS 105 ? CE ? A LYS 105 CE 27 1 Y 1 A LYS 105 ? NZ ? A LYS 105 NZ 28 1 Y 1 A LYS 108 ? CG ? A LYS 108 CG 29 1 Y 1 A LYS 108 ? CD ? A LYS 108 CD 30 1 Y 1 A LYS 108 ? CE ? A LYS 108 CE 31 1 Y 1 A LYS 108 ? NZ ? A LYS 108 NZ 32 1 Y 1 A LYS 113 ? CG ? A LYS 113 CG 33 1 Y 1 A LYS 113 ? CD ? A LYS 113 CD 34 1 Y 1 A LYS 113 ? CE ? A LYS 113 CE 35 1 Y 1 A LYS 113 ? NZ ? A LYS 113 NZ 36 1 Y 1 A LYS 142 ? CG ? A LYS 142 CG 37 1 Y 1 A LYS 142 ? CD ? A LYS 142 CD 38 1 Y 1 A LYS 142 ? CE ? A LYS 142 CE 39 1 Y 1 A LYS 142 ? NZ ? A LYS 142 NZ 40 1 Y 1 A GLN 174 ? CG ? A GLN 174 CG 41 1 Y 1 A GLN 174 ? CD ? A GLN 174 CD 42 1 Y 1 A GLN 174 ? OE1 ? A GLN 174 OE1 43 1 Y 1 A GLN 174 ? NE2 ? A GLN 174 NE2 44 1 Y 1 A GLU 206 ? CG ? A GLU 206 CG 45 1 Y 1 A GLU 206 ? CD ? A GLU 206 CD 46 1 Y 1 A GLU 206 ? OE1 ? A GLU 206 OE1 47 1 Y 1 A GLU 206 ? OE2 ? A GLU 206 OE2 48 1 Y 1 A GLU 209 ? CG ? A GLU 209 CG 49 1 Y 1 A GLU 209 ? CD ? A GLU 209 CD 50 1 Y 1 A GLU 209 ? OE1 ? A GLU 209 OE1 51 1 Y 1 A GLU 209 ? OE2 ? A GLU 209 OE2 52 1 Y 1 A LYS 210 ? CG ? A LYS 210 CG 53 1 Y 1 A LYS 210 ? CD ? A LYS 210 CD 54 1 Y 1 A LYS 210 ? CE ? A LYS 210 CE 55 1 Y 1 A LYS 210 ? NZ ? A LYS 210 NZ 56 1 Y 1 E ILE 7 ? CG1 ? B ILE 13 CG1 57 1 Y 1 E ILE 7 ? CG2 ? B ILE 13 CG2 58 1 Y 1 E ILE 7 ? CD1 ? B ILE 13 CD1 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A PHE 3 ? A PHE 3 4 1 Y 1 A LEU 4 ? A LEU 4 5 1 Y 1 A PHE 5 ? A PHE 5 6 1 Y 1 A SER 6 ? A SER 6 7 1 Y 1 A SER 7 ? A SER 7 8 1 Y 1 A ARG 8 ? A ARG 8 9 1 Y 1 A SER 9 ? A SER 9 10 1 Y 1 A SER 10 ? A SER 10 11 1 Y 1 A LYS 11 ? A LYS 11 12 1 Y 1 A THR 12 ? A THR 12 13 1 Y 1 A PHE 13 ? A PHE 13 14 1 Y 1 A LYS 14 ? A LYS 14 15 1 Y 1 A ILE 19 ? A ILE 19 16 1 Y 1 A PRO 20 ? A PRO 20 17 1 Y 1 A GLU 21 ? A GLU 21 18 1 Y 1 A GLY 22 ? A GLY 22 19 1 Y 1 A GLY 212 ? A GLY 212 20 1 Y 1 A SER 213 ? A SER 213 21 1 Y 1 A LYS 214 ? A LYS 214 22 1 Y 1 A ASP 215 ? A ASP 215 23 1 Y 1 A ARG 216 ? A ARG 216 24 1 Y 1 E VAL -5 ? B VAL 1 25 1 Y 1 E ALA -4 ? B ALA 2 26 1 Y 1 E SER -3 ? B SER 3 27 1 Y 1 E THR -2 ? B THR 4 28 1 Y 1 E MET -1 ? B MET 5 29 1 Y 1 E THR 0 ? B THR 6 30 1 Y 1 E ASP 1 ? B ASP 7 31 1 Y 1 E GLY 2 ? B GLY 8 32 1 Y 1 E ALA 3 ? B ALA 9 33 1 Y 1 E ASN 4 ? B ASN 10 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'ZINC ION' ZN 4 water HOH #