data_5TWX # _entry.id 5TWX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5TWX pdb_00005twx 10.2210/pdb5twx/pdb WWPDB D_1000224957 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5TWX _pdbx_database_status.recvd_initial_deposition_date 2016-11-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Seo, H.-S.' 1 ? 'Dhe-Paganon, S.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country GE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Angew. Chem. Int. Ed. Engl.' _citation.journal_id_ASTM ACIEAY _citation.journal_id_CSD 0179 _citation.journal_id_ISSN 1521-3773 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 56 _citation.language ? _citation.page_first 5738 _citation.page_last 5743 _citation.title 'Degradation of the BAF Complex Factor BRD9 by Heterobifunctional Ligands.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/anie.201611281 _citation.pdbx_database_id_PubMed 28418626 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Remillard, D.' 1 ? primary 'Buckley, D.L.' 2 ? primary 'Paulk, J.' 3 ? primary 'Brien, G.L.' 4 ? primary 'Sonnett, M.' 5 ? primary 'Seo, H.S.' 6 ? primary 'Dastjerdi, S.' 7 ? primary 'Wuhr, M.' 8 ? primary 'Dhe-Paganon, S.' 9 ? primary 'Armstrong, S.A.' 10 ? primary 'Bradner, J.E.' 11 ? # _cell.length_a 75.260 _cell.length_b 75.260 _cell.length_c 344.330 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 120.000 _cell.entry_id 5TWX _cell.Z_PDB 48 _cell.pdbx_unique_axis ? # _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.entry_id 5TWX _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Bromodomain-containing protein 9' 13807.977 4 ? ? 'UNP residues 134-250' ? 2 non-polymer syn ;N-[6-({2-[(3S)-2,6-dioxopiperidin-3-yl]-1,3-dioxo-2,3-dihydro-1H-isoindol-4-yl}oxy)hexyl]-2-(4-{2-[N-(1,1-dioxo-1lambda~6~-thian-4-yl)carbamimidoyl]-5-methyl-4-oxo-4,5-dihydrothieno[3,2-c]pyridin-7-yl}-2-methoxyphenoxy)acetamide ; 874.978 4 ? ? ? ? 3 water nat water 18.015 39 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Rhabdomyosarcoma antigen MU-RMS-40.8' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPHMAENESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMC DNAMTYNRPDTVYYKLAKKILHAGFKMMSKQAALLGNEDTA ; _entity_poly.pdbx_seq_one_letter_code_can ;GPHMAENESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMC DNAMTYNRPDTVYYKLAKKILHAGFKMMSKQAALLGNEDTA ; _entity_poly.pdbx_strand_id A,B,C,D _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 HIS n 1 4 MET n 1 5 ALA n 1 6 GLU n 1 7 ASN n 1 8 GLU n 1 9 SER n 1 10 THR n 1 11 PRO n 1 12 ILE n 1 13 GLN n 1 14 GLN n 1 15 LEU n 1 16 LEU n 1 17 GLU n 1 18 HIS n 1 19 PHE n 1 20 LEU n 1 21 ARG n 1 22 GLN n 1 23 LEU n 1 24 GLN n 1 25 ARG n 1 26 LYS n 1 27 ASP n 1 28 PRO n 1 29 HIS n 1 30 GLY n 1 31 PHE n 1 32 PHE n 1 33 ALA n 1 34 PHE n 1 35 PRO n 1 36 VAL n 1 37 THR n 1 38 ASP n 1 39 ALA n 1 40 ILE n 1 41 ALA n 1 42 PRO n 1 43 GLY n 1 44 TYR n 1 45 SER n 1 46 MET n 1 47 ILE n 1 48 ILE n 1 49 LYS n 1 50 HIS n 1 51 PRO n 1 52 MET n 1 53 ASP n 1 54 PHE n 1 55 GLY n 1 56 THR n 1 57 MET n 1 58 LYS n 1 59 ASP n 1 60 LYS n 1 61 ILE n 1 62 VAL n 1 63 ALA n 1 64 ASN n 1 65 GLU n 1 66 TYR n 1 67 LYS n 1 68 SER n 1 69 VAL n 1 70 THR n 1 71 GLU n 1 72 PHE n 1 73 LYS n 1 74 ALA n 1 75 ASP n 1 76 PHE n 1 77 LYS n 1 78 LEU n 1 79 MET n 1 80 CYS n 1 81 ASP n 1 82 ASN n 1 83 ALA n 1 84 MET n 1 85 THR n 1 86 TYR n 1 87 ASN n 1 88 ARG n 1 89 PRO n 1 90 ASP n 1 91 THR n 1 92 VAL n 1 93 TYR n 1 94 TYR n 1 95 LYS n 1 96 LEU n 1 97 ALA n 1 98 LYS n 1 99 LYS n 1 100 ILE n 1 101 LEU n 1 102 HIS n 1 103 ALA n 1 104 GLY n 1 105 PHE n 1 106 LYS n 1 107 MET n 1 108 MET n 1 109 SER n 1 110 LYS n 1 111 GLN n 1 112 ALA n 1 113 ALA n 1 114 LEU n 1 115 LEU n 1 116 GLY n 1 117 ASN n 1 118 GLU n 1 119 ASP n 1 120 THR n 1 121 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 121 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'BRD9, UNQ3040/PRO9856' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BRD9_HUMAN _struct_ref.pdbx_db_accession Q9H8M2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AENESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAM TYNRPDTVYYKLAKKILHAGFKMMSKQAALLGNEDTA ; _struct_ref.pdbx_align_begin 134 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5TWX A 5 ? 121 ? Q9H8M2 134 ? 250 ? 134 250 2 1 5TWX B 5 ? 121 ? Q9H8M2 134 ? 250 ? 134 250 3 1 5TWX C 5 ? 121 ? Q9H8M2 134 ? 250 ? 134 250 4 1 5TWX D 5 ? 121 ? Q9H8M2 134 ? 250 ? 134 250 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5TWX GLY A 1 ? UNP Q9H8M2 ? ? 'expression tag' 130 1 1 5TWX PRO A 2 ? UNP Q9H8M2 ? ? 'expression tag' 131 2 1 5TWX HIS A 3 ? UNP Q9H8M2 ? ? 'expression tag' 132 3 1 5TWX MET A 4 ? UNP Q9H8M2 ? ? 'expression tag' 133 4 2 5TWX GLY B 1 ? UNP Q9H8M2 ? ? 'expression tag' 130 5 2 5TWX PRO B 2 ? UNP Q9H8M2 ? ? 'expression tag' 131 6 2 5TWX HIS B 3 ? UNP Q9H8M2 ? ? 'expression tag' 132 7 2 5TWX MET B 4 ? UNP Q9H8M2 ? ? 'expression tag' 133 8 3 5TWX GLY C 1 ? UNP Q9H8M2 ? ? 'expression tag' 130 9 3 5TWX PRO C 2 ? UNP Q9H8M2 ? ? 'expression tag' 131 10 3 5TWX HIS C 3 ? UNP Q9H8M2 ? ? 'expression tag' 132 11 3 5TWX MET C 4 ? UNP Q9H8M2 ? ? 'expression tag' 133 12 4 5TWX GLY D 1 ? UNP Q9H8M2 ? ? 'expression tag' 130 13 4 5TWX PRO D 2 ? UNP Q9H8M2 ? ? 'expression tag' 131 14 4 5TWX HIS D 3 ? UNP Q9H8M2 ? ? 'expression tag' 132 15 4 5TWX MET D 4 ? UNP Q9H8M2 ? ? 'expression tag' 133 16 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 7P7 non-polymer . ;N-[6-({2-[(3S)-2,6-dioxopiperidin-3-yl]-1,3-dioxo-2,3-dihydro-1H-isoindol-4-yl}oxy)hexyl]-2-(4-{2-[N-(1,1-dioxo-1lambda~6~-thian-4-yl)carbamimidoyl]-5-methyl-4-oxo-4,5-dihydrothieno[3,2-c]pyridin-7-yl}-2-methoxyphenoxy)acetamide ; ? 'C42 H46 N6 O11 S2' 874.978 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5TWX _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.55 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 51.75 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity 0.000 _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'PEG 4000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-07-20 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9792 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-E' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9792 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-E _diffrn_source.pdbx_synchrotron_site APS # _reflns.entry_id 5TWX _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 64.040 _reflns.d_resolution_high 2.550 _reflns.number_obs 19982 _reflns.number_all ? _reflns.percent_possible_obs 100.000 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 15.300 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 13.000 _reflns.pdbx_Rrim_I_all 0.143 _reflns.pdbx_Rpim_I_all 0.038 _reflns.pdbx_CC_half ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_number_measured_all 260441 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_chi_squared ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.details ? # loop_ _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_ordinal _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.pdbx_rejects _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.meanI_over_sigI_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_CC_half 1 1 2.550 2.590 ? 14100 989 ? ? 1.600 ? ? 14.300 ? ? ? ? ? ? ? ? 100.000 2.030 0.526 ? 1 2 6.920 64.060 ? 13496 1165 ? ? 47.100 ? ? 11.600 ? ? ? ? ? ? ? ? 99.200 0.038 0.011 ? # _refine.entry_id 5TWX _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_d_res_high 2.5500 _refine.ls_d_res_low 64.0400 _refine.pdbx_ls_sigma_F 1.330 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 99.8200 _refine.ls_number_reflns_obs 19938 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.ls_matrix_type ? _refine.pdbx_R_Free_selection_details ? _refine.details ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2350 _refine.ls_R_factor_R_work 0.2327 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.2798 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 4.7600 _refine.ls_number_reflns_R_free 950 _refine.ls_number_reflns_R_work 18988 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 74.0504 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.3300 _refine.overall_SU_B ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model 4YYD _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set ? _refine.B_iso_max 149.830 _refine.B_iso_min 34.300 _refine.pdbx_overall_phase_error 28.2100 _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_R_factor_R_free_error_details ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.5500 _refine_hist.d_res_low 64.0400 _refine_hist.pdbx_number_atoms_ligand 221 _refine_hist.number_atoms_solvent 39 _refine_hist.number_atoms_total 3626 _refine_hist.pdbx_number_residues_total 442 _refine_hist.pdbx_B_iso_mean_ligand 68.70 _refine_hist.pdbx_B_iso_mean_solvent 52.16 _refine_hist.pdbx_number_atoms_protein 3366 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' f_bond_d 3737 0.005 ? ? ? 'X-RAY DIFFRACTION' f_angle_d 5085 1.478 ? ? ? 'X-RAY DIFFRACTION' f_chiral_restr 527 0.045 ? ? ? 'X-RAY DIFFRACTION' f_plane_restr 635 0.005 ? ? ? 'X-RAY DIFFRACTION' f_dihedral_angle_d 2199 11.241 ? ? ? # loop_ _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.pdbx_ens_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_weight 1 'X-RAY DIFFRACTION' 1 1 TORSIONAL A 1615 15.769 ? ? ? ? ? ? ? 2 'X-RAY DIFFRACTION' 1 2 TORSIONAL B 1615 15.769 ? ? ? ? ? ? ? 3 'X-RAY DIFFRACTION' 1 3 TORSIONAL C 1615 15.769 ? ? ? ? ? ? ? 4 'X-RAY DIFFRACTION' 1 4 TORSIONAL D 1615 15.769 ? ? ? ? ? ? ? # loop_ _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.percent_reflns_obs _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_R_work _refine_ls_shell.R_factor_R_free _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.pdbx_refine_id _refine_ls_shell.R_factor_obs 2.5500 2.6845 7 100.0000 2642 . 0.3326 0.3838 . 134 0.0000 2776 . 'X-RAY DIFFRACTION' . 2.6845 2.8526 7 100.0000 2617 . 0.2970 0.3321 . 126 0.0000 2743 . 'X-RAY DIFFRACTION' . 2.8526 3.0729 7 100.0000 2651 . 0.2864 0.3540 . 123 0.0000 2774 . 'X-RAY DIFFRACTION' . 3.0729 3.3821 7 100.0000 2675 . 0.2656 0.3445 . 137 0.0000 2812 . 'X-RAY DIFFRACTION' . 3.3821 3.8715 7 100.0000 2708 . 0.2250 0.2733 . 126 0.0000 2834 . 'X-RAY DIFFRACTION' . 3.8715 4.8774 7 100.0000 2742 . 0.1984 0.2468 . 140 0.0000 2882 . 'X-RAY DIFFRACTION' . 4.8774 64.0601 7 99.0000 2953 . 0.2118 0.2484 . 164 0.0000 3117 . 'X-RAY DIFFRACTION' . # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 ;(chain A and (resid 137 through 144 or (resid 145 through 146 and (name N or name CA or name C or name O or name CB )) or resid 147 through 149 or resid 151 through 153 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 162 or resid 164 through 168 or resid 170 through 174 or (resid 175 and (name N or name CA or name C or name O or name CB )) or resid 176 or (resid 177 through 178 and (name N or name CA or name C or name O or name CB )) or resid 179 through 186 or (resid 187 and (name N or name CA or name C or name O or name CB )) or resid 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 192 or (resid 193 through 194 and (name N or name CA or name C or name O or name CB )) or resid 195 through 201 or (resid 202 through 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205 or (resid 206 through 207 and (name N or name CA or name C or name O or name CB )) or resid 208 through 218 or (resid 219 and (name N or name CA or name C or name O or name CB )) or resid 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 223 or (resid 224 through 227 and (name N or name CA or name C or name O or name CB )) or resid 229 through 230 or resid 232 through 234 or resid 236 through 238 or (resid 239 and (name N or name CA or name C or name O or name CB )) or resid 240 through 242 or (resid 243 through 244 and (name N or name CA or name C or name O or name CB )))) ; 1 2 ;(chain B and (resid 137 through 144 or (resid 145 through 146 and (name N or name CA or name C or name O or name CB )) or resid 147 through 149 or resid 151 through 153 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 162 or resid 164 through 168 or resid 170 through 174 or (resid 175 and (name N or name CA or name C or name O or name CB )) or resid 176 or (resid 177 through 178 and (name N or name CA or name C or name O or name CB )) or resid 179 through 186 or (resid 187 and (name N or name CA or name C or name O or name CB )) or resid 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 192 or (resid 193 through 194 and (name N or name CA or name C or name O or name CB )) or resid 195 through 201 or (resid 202 through 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205 or (resid 206 through 207 and (name N or name CA or name C or name O or name CB )) or resid 208 through 218 or (resid 219 and (name N or name CA or name C or name O or name CB )) or resid 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 223 or (resid 224 through 227 and (name N or name CA or name C or name O or name CB )) or resid 229 through 230 or resid 232 through 234 or resid 236 through 238 or (resid 239 and (name N or name CA or name C or name O or name CB )) or resid 240 through 242 or (resid 243 through 244 and (name N or name CA or name C or name O or name CB )))) ; 1 3 ;(chain C and (resid 137 through 144 or (resid 145 through 146 and (name N or name CA or name C or name O or name CB )) or resid 147 through 149 or resid 151 through 153 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 162 or resid 164 through 168 or resid 170 through 174 or (resid 175 and (name N or name CA or name C or name O or name CB )) or resid 176 or (resid 177 through 178 and (name N or name CA or name C or name O or name CB )) or resid 179 through 186 or (resid 187 and (name N or name CA or name C or name O or name CB )) or resid 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 192 or (resid 193 through 194 and (name N or name CA or name C or name O or name CB )) or resid 195 through 201 or (resid 202 through 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205 or (resid 206 through 207 and (name N or name CA or name C or name O or name CB )) or resid 208 through 218 or (resid 219 and (name N or name CA or name C or name O or name CB )) or resid 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 223 or (resid 224 through 227 and (name N or name CA or name C or name O or name CB )) or resid 229 through 230 or resid 232 through 234 or resid 236 through 238 or (resid 239 and (name N or name CA or name C or name O or name CB )) or resid 240 through 244)) ; 1 4 ;(chain D and (resid 137 through 149 or resid 151 through 153 or resid 155 through 162 or resid 164 through 168 or resid 170 through 227 or resid 229 through 230 or resid 232 through 234 or resid 236 through 244)) ; # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 1 A GLU 8 . A LEU 15 . A GLU 137 A LEU 144 ? ;(chain A and (resid 137 through 144 or (resid 145 through 146 and (name N or name CA or name C or name O or name CB )) or resid 147 through 149 or resid 151 through 153 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 162 or resid 164 through 168 or resid 170 through 174 or (resid 175 and (name N or name CA or name C or name O or name CB )) or resid 176 or (resid 177 through 178 and (name N or name CA or name C or name O or name CB )) or resid 179 through 186 or (resid 187 and (name N or name CA or name C or name O or name CB )) or resid 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 192 or (resid 193 through 194 and (name N or name CA or name C or name O or name CB )) or resid 195 through 201 or (resid 202 through 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205 or (resid 206 through 207 and (name N or name CA or name C or name O or name CB )) or resid 208 through 218 or (resid 219 and (name N or name CA or name C or name O or name CB )) or resid 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 223 or (resid 224 through 227 and (name N or name CA or name C or name O or name CB )) or resid 229 through 230 or resid 232 through 234 or resid 236 through 238 or (resid 239 and (name N or name CA or name C or name O or name CB )) or resid 240 through 242 or (resid 243 through 244 and (name N or name CA or name C or name O or name CB )))) ; 1 1 2 A LEU 16 . A GLU 17 . A LEU 145 A GLU 146 ? ;(chain A and (resid 137 through 144 or (resid 145 through 146 and (name N or name CA or name C or name O or name CB )) or resid 147 through 149 or resid 151 through 153 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 162 or resid 164 through 168 or resid 170 through 174 or (resid 175 and (name N or name CA or name C or name O or name CB )) or resid 176 or (resid 177 through 178 and (name N or name CA or name C or name O or name CB )) or resid 179 through 186 or (resid 187 and (name N or name CA or name C or name O or name CB )) or resid 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 192 or (resid 193 through 194 and (name N or name CA or name C or name O or name CB )) or resid 195 through 201 or (resid 202 through 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205 or (resid 206 through 207 and (name N or name CA or name C or name O or name CB )) or resid 208 through 218 or (resid 219 and (name N or name CA or name C or name O or name CB )) or resid 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 223 or (resid 224 through 227 and (name N or name CA or name C or name O or name CB )) or resid 229 through 230 or resid 232 through 234 or resid 236 through 238 or (resid 239 and (name N or name CA or name C or name O or name CB )) or resid 240 through 242 or (resid 243 through 244 and (name N or name CA or name C or name O or name CB )))) ; 1 1 3 A GLU 8 . E 7P7 . . A GLU 137 A 7P7 4000 ? ;(chain A and (resid 137 through 144 or (resid 145 through 146 and (name N or name CA or name C or name O or name CB )) or resid 147 through 149 or resid 151 through 153 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 162 or resid 164 through 168 or resid 170 through 174 or (resid 175 and (name N or name CA or name C or name O or name CB )) or resid 176 or (resid 177 through 178 and (name N or name CA or name C or name O or name CB )) or resid 179 through 186 or (resid 187 and (name N or name CA or name C or name O or name CB )) or resid 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 192 or (resid 193 through 194 and (name N or name CA or name C or name O or name CB )) or resid 195 through 201 or (resid 202 through 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205 or (resid 206 through 207 and (name N or name CA or name C or name O or name CB )) or resid 208 through 218 or (resid 219 and (name N or name CA or name C or name O or name CB )) or resid 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 223 or (resid 224 through 227 and (name N or name CA or name C or name O or name CB )) or resid 229 through 230 or resid 232 through 234 or resid 236 through 238 or (resid 239 and (name N or name CA or name C or name O or name CB )) or resid 240 through 242 or (resid 243 through 244 and (name N or name CA or name C or name O or name CB )))) ; 1 1 4 A GLU 8 . E 7P7 . . A GLU 137 A 7P7 4000 ? ;(chain A and (resid 137 through 144 or (resid 145 through 146 and (name N or name CA or name C or name O or name CB )) or resid 147 through 149 or resid 151 through 153 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 162 or resid 164 through 168 or resid 170 through 174 or (resid 175 and (name N or name CA or name C or name O or name CB )) or resid 176 or (resid 177 through 178 and (name N or name CA or name C or name O or name CB )) or resid 179 through 186 or (resid 187 and (name N or name CA or name C or name O or name CB )) or resid 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 192 or (resid 193 through 194 and (name N or name CA or name C or name O or name CB )) or resid 195 through 201 or (resid 202 through 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205 or (resid 206 through 207 and (name N or name CA or name C or name O or name CB )) or resid 208 through 218 or (resid 219 and (name N or name CA or name C or name O or name CB )) or resid 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 223 or (resid 224 through 227 and (name N or name CA or name C or name O or name CB )) or resid 229 through 230 or resid 232 through 234 or resid 236 through 238 or (resid 239 and (name N or name CA or name C or name O or name CB )) or resid 240 through 242 or (resid 243 through 244 and (name N or name CA or name C or name O or name CB )))) ; 1 1 5 A GLU 8 . E 7P7 . . A GLU 137 A 7P7 4000 ? ;(chain A and (resid 137 through 144 or (resid 145 through 146 and (name N or name CA or name C or name O or name CB )) or resid 147 through 149 or resid 151 through 153 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 162 or resid 164 through 168 or resid 170 through 174 or (resid 175 and (name N or name CA or name C or name O or name CB )) or resid 176 or (resid 177 through 178 and (name N or name CA or name C or name O or name CB )) or resid 179 through 186 or (resid 187 and (name N or name CA or name C or name O or name CB )) or resid 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 192 or (resid 193 through 194 and (name N or name CA or name C or name O or name CB )) or resid 195 through 201 or (resid 202 through 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205 or (resid 206 through 207 and (name N or name CA or name C or name O or name CB )) or resid 208 through 218 or (resid 219 and (name N or name CA or name C or name O or name CB )) or resid 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 223 or (resid 224 through 227 and (name N or name CA or name C or name O or name CB )) or resid 229 through 230 or resid 232 through 234 or resid 236 through 238 or (resid 239 and (name N or name CA or name C or name O or name CB )) or resid 240 through 242 or (resid 243 through 244 and (name N or name CA or name C or name O or name CB )))) ; 1 1 6 A GLU 8 . E 7P7 . . A GLU 137 A 7P7 4000 ? ;(chain A and (resid 137 through 144 or (resid 145 through 146 and (name N or name CA or name C or name O or name CB )) or resid 147 through 149 or resid 151 through 153 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 162 or resid 164 through 168 or resid 170 through 174 or (resid 175 and (name N or name CA or name C or name O or name CB )) or resid 176 or (resid 177 through 178 and (name N or name CA or name C or name O or name CB )) or resid 179 through 186 or (resid 187 and (name N or name CA or name C or name O or name CB )) or resid 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 192 or (resid 193 through 194 and (name N or name CA or name C or name O or name CB )) or resid 195 through 201 or (resid 202 through 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205 or (resid 206 through 207 and (name N or name CA or name C or name O or name CB )) or resid 208 through 218 or (resid 219 and (name N or name CA or name C or name O or name CB )) or resid 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 223 or (resid 224 through 227 and (name N or name CA or name C or name O or name CB )) or resid 229 through 230 or resid 232 through 234 or resid 236 through 238 or (resid 239 and (name N or name CA or name C or name O or name CB )) or resid 240 through 242 or (resid 243 through 244 and (name N or name CA or name C or name O or name CB )))) ; 1 2 1 B GLU 8 . B LEU 15 . B GLU 137 B LEU 144 ? ;(chain B and (resid 137 through 144 or (resid 145 through 146 and (name N or name CA or name C or name O or name CB )) or resid 147 through 149 or resid 151 through 153 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 162 or resid 164 through 168 or resid 170 through 174 or (resid 175 and (name N or name CA or name C or name O or name CB )) or resid 176 or (resid 177 through 178 and (name N or name CA or name C or name O or name CB )) or resid 179 through 186 or (resid 187 and (name N or name CA or name C or name O or name CB )) or resid 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 192 or (resid 193 through 194 and (name N or name CA or name C or name O or name CB )) or resid 195 through 201 or (resid 202 through 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205 or (resid 206 through 207 and (name N or name CA or name C or name O or name CB )) or resid 208 through 218 or (resid 219 and (name N or name CA or name C or name O or name CB )) or resid 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 223 or (resid 224 through 227 and (name N or name CA or name C or name O or name CB )) or resid 229 through 230 or resid 232 through 234 or resid 236 through 238 or (resid 239 and (name N or name CA or name C or name O or name CB )) or resid 240 through 242 or (resid 243 through 244 and (name N or name CA or name C or name O or name CB )))) ; 1 2 2 B LEU 16 . B GLU 17 . B LEU 145 B GLU 146 ? ;(chain B and (resid 137 through 144 or (resid 145 through 146 and (name N or name CA or name C or name O or name CB )) or resid 147 through 149 or resid 151 through 153 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 162 or resid 164 through 168 or resid 170 through 174 or (resid 175 and (name N or name CA or name C or name O or name CB )) or resid 176 or (resid 177 through 178 and (name N or name CA or name C or name O or name CB )) or resid 179 through 186 or (resid 187 and (name N or name CA or name C or name O or name CB )) or resid 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 192 or (resid 193 through 194 and (name N or name CA or name C or name O or name CB )) or resid 195 through 201 or (resid 202 through 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205 or (resid 206 through 207 and (name N or name CA or name C or name O or name CB )) or resid 208 through 218 or (resid 219 and (name N or name CA or name C or name O or name CB )) or resid 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 223 or (resid 224 through 227 and (name N or name CA or name C or name O or name CB )) or resid 229 through 230 or resid 232 through 234 or resid 236 through 238 or (resid 239 and (name N or name CA or name C or name O or name CB )) or resid 240 through 242 or (resid 243 through 244 and (name N or name CA or name C or name O or name CB )))) ; 1 2 3 B GLU 8 . F 7P7 . . B GLU 137 B 7P7 4000 ? ;(chain B and (resid 137 through 144 or (resid 145 through 146 and (name N or name CA or name C or name O or name CB )) or resid 147 through 149 or resid 151 through 153 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 162 or resid 164 through 168 or resid 170 through 174 or (resid 175 and (name N or name CA or name C or name O or name CB )) or resid 176 or (resid 177 through 178 and (name N or name CA or name C or name O or name CB )) or resid 179 through 186 or (resid 187 and (name N or name CA or name C or name O or name CB )) or resid 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 192 or (resid 193 through 194 and (name N or name CA or name C or name O or name CB )) or resid 195 through 201 or (resid 202 through 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205 or (resid 206 through 207 and (name N or name CA or name C or name O or name CB )) or resid 208 through 218 or (resid 219 and (name N or name CA or name C or name O or name CB )) or resid 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 223 or (resid 224 through 227 and (name N or name CA or name C or name O or name CB )) or resid 229 through 230 or resid 232 through 234 or resid 236 through 238 or (resid 239 and (name N or name CA or name C or name O or name CB )) or resid 240 through 242 or (resid 243 through 244 and (name N or name CA or name C or name O or name CB )))) ; 1 2 4 B GLU 8 . F 7P7 . . B GLU 137 B 7P7 4000 ? ;(chain B and (resid 137 through 144 or (resid 145 through 146 and (name N or name CA or name C or name O or name CB )) or resid 147 through 149 or resid 151 through 153 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 162 or resid 164 through 168 or resid 170 through 174 or (resid 175 and (name N or name CA or name C or name O or name CB )) or resid 176 or (resid 177 through 178 and (name N or name CA or name C or name O or name CB )) or resid 179 through 186 or (resid 187 and (name N or name CA or name C or name O or name CB )) or resid 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 192 or (resid 193 through 194 and (name N or name CA or name C or name O or name CB )) or resid 195 through 201 or (resid 202 through 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205 or (resid 206 through 207 and (name N or name CA or name C or name O or name CB )) or resid 208 through 218 or (resid 219 and (name N or name CA or name C or name O or name CB )) or resid 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 223 or (resid 224 through 227 and (name N or name CA or name C or name O or name CB )) or resid 229 through 230 or resid 232 through 234 or resid 236 through 238 or (resid 239 and (name N or name CA or name C or name O or name CB )) or resid 240 through 242 or (resid 243 through 244 and (name N or name CA or name C or name O or name CB )))) ; 1 2 5 B GLU 8 . F 7P7 . . B GLU 137 B 7P7 4000 ? ;(chain B and (resid 137 through 144 or (resid 145 through 146 and (name N or name CA or name C or name O or name CB )) or resid 147 through 149 or resid 151 through 153 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 162 or resid 164 through 168 or resid 170 through 174 or (resid 175 and (name N or name CA or name C or name O or name CB )) or resid 176 or (resid 177 through 178 and (name N or name CA or name C or name O or name CB )) or resid 179 through 186 or (resid 187 and (name N or name CA or name C or name O or name CB )) or resid 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 192 or (resid 193 through 194 and (name N or name CA or name C or name O or name CB )) or resid 195 through 201 or (resid 202 through 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205 or (resid 206 through 207 and (name N or name CA or name C or name O or name CB )) or resid 208 through 218 or (resid 219 and (name N or name CA or name C or name O or name CB )) or resid 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 223 or (resid 224 through 227 and (name N or name CA or name C or name O or name CB )) or resid 229 through 230 or resid 232 through 234 or resid 236 through 238 or (resid 239 and (name N or name CA or name C or name O or name CB )) or resid 240 through 242 or (resid 243 through 244 and (name N or name CA or name C or name O or name CB )))) ; 1 2 6 B GLU 8 . F 7P7 . . B GLU 137 B 7P7 4000 ? ;(chain B and (resid 137 through 144 or (resid 145 through 146 and (name N or name CA or name C or name O or name CB )) or resid 147 through 149 or resid 151 through 153 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 162 or resid 164 through 168 or resid 170 through 174 or (resid 175 and (name N or name CA or name C or name O or name CB )) or resid 176 or (resid 177 through 178 and (name N or name CA or name C or name O or name CB )) or resid 179 through 186 or (resid 187 and (name N or name CA or name C or name O or name CB )) or resid 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 192 or (resid 193 through 194 and (name N or name CA or name C or name O or name CB )) or resid 195 through 201 or (resid 202 through 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205 or (resid 206 through 207 and (name N or name CA or name C or name O or name CB )) or resid 208 through 218 or (resid 219 and (name N or name CA or name C or name O or name CB )) or resid 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 223 or (resid 224 through 227 and (name N or name CA or name C or name O or name CB )) or resid 229 through 230 or resid 232 through 234 or resid 236 through 238 or (resid 239 and (name N or name CA or name C or name O or name CB )) or resid 240 through 242 or (resid 243 through 244 and (name N or name CA or name C or name O or name CB )))) ; 1 3 1 C GLU 8 . C LEU 15 . C GLU 137 C LEU 144 ? ;(chain C and (resid 137 through 144 or (resid 145 through 146 and (name N or name CA or name C or name O or name CB )) or resid 147 through 149 or resid 151 through 153 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 162 or resid 164 through 168 or resid 170 through 174 or (resid 175 and (name N or name CA or name C or name O or name CB )) or resid 176 or (resid 177 through 178 and (name N or name CA or name C or name O or name CB )) or resid 179 through 186 or (resid 187 and (name N or name CA or name C or name O or name CB )) or resid 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 192 or (resid 193 through 194 and (name N or name CA or name C or name O or name CB )) or resid 195 through 201 or (resid 202 through 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205 or (resid 206 through 207 and (name N or name CA or name C or name O or name CB )) or resid 208 through 218 or (resid 219 and (name N or name CA or name C or name O or name CB )) or resid 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 223 or (resid 224 through 227 and (name N or name CA or name C or name O or name CB )) or resid 229 through 230 or resid 232 through 234 or resid 236 through 238 or (resid 239 and (name N or name CA or name C or name O or name CB )) or resid 240 through 244)) ; 1 3 2 C LEU 16 . C GLU 17 . C LEU 145 C GLU 146 ? ;(chain C and (resid 137 through 144 or (resid 145 through 146 and (name N or name CA or name C or name O or name CB )) or resid 147 through 149 or resid 151 through 153 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 162 or resid 164 through 168 or resid 170 through 174 or (resid 175 and (name N or name CA or name C or name O or name CB )) or resid 176 or (resid 177 through 178 and (name N or name CA or name C or name O or name CB )) or resid 179 through 186 or (resid 187 and (name N or name CA or name C or name O or name CB )) or resid 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 192 or (resid 193 through 194 and (name N or name CA or name C or name O or name CB )) or resid 195 through 201 or (resid 202 through 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205 or (resid 206 through 207 and (name N or name CA or name C or name O or name CB )) or resid 208 through 218 or (resid 219 and (name N or name CA or name C or name O or name CB )) or resid 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 223 or (resid 224 through 227 and (name N or name CA or name C or name O or name CB )) or resid 229 through 230 or resid 232 through 234 or resid 236 through 238 or (resid 239 and (name N or name CA or name C or name O or name CB )) or resid 240 through 244)) ; 1 3 3 C GLU 8 . G 7P7 . . C GLU 137 C 7P7 4000 ? ;(chain C and (resid 137 through 144 or (resid 145 through 146 and (name N or name CA or name C or name O or name CB )) or resid 147 through 149 or resid 151 through 153 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 162 or resid 164 through 168 or resid 170 through 174 or (resid 175 and (name N or name CA or name C or name O or name CB )) or resid 176 or (resid 177 through 178 and (name N or name CA or name C or name O or name CB )) or resid 179 through 186 or (resid 187 and (name N or name CA or name C or name O or name CB )) or resid 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 192 or (resid 193 through 194 and (name N or name CA or name C or name O or name CB )) or resid 195 through 201 or (resid 202 through 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205 or (resid 206 through 207 and (name N or name CA or name C or name O or name CB )) or resid 208 through 218 or (resid 219 and (name N or name CA or name C or name O or name CB )) or resid 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 223 or (resid 224 through 227 and (name N or name CA or name C or name O or name CB )) or resid 229 through 230 or resid 232 through 234 or resid 236 through 238 or (resid 239 and (name N or name CA or name C or name O or name CB )) or resid 240 through 244)) ; 1 3 4 C GLU 8 . G 7P7 . . C GLU 137 C 7P7 4000 ? ;(chain C and (resid 137 through 144 or (resid 145 through 146 and (name N or name CA or name C or name O or name CB )) or resid 147 through 149 or resid 151 through 153 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 162 or resid 164 through 168 or resid 170 through 174 or (resid 175 and (name N or name CA or name C or name O or name CB )) or resid 176 or (resid 177 through 178 and (name N or name CA or name C or name O or name CB )) or resid 179 through 186 or (resid 187 and (name N or name CA or name C or name O or name CB )) or resid 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 192 or (resid 193 through 194 and (name N or name CA or name C or name O or name CB )) or resid 195 through 201 or (resid 202 through 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205 or (resid 206 through 207 and (name N or name CA or name C or name O or name CB )) or resid 208 through 218 or (resid 219 and (name N or name CA or name C or name O or name CB )) or resid 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 223 or (resid 224 through 227 and (name N or name CA or name C or name O or name CB )) or resid 229 through 230 or resid 232 through 234 or resid 236 through 238 or (resid 239 and (name N or name CA or name C or name O or name CB )) or resid 240 through 244)) ; 1 3 5 C GLU 8 . G 7P7 . . C GLU 137 C 7P7 4000 ? ;(chain C and (resid 137 through 144 or (resid 145 through 146 and (name N or name CA or name C or name O or name CB )) or resid 147 through 149 or resid 151 through 153 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 162 or resid 164 through 168 or resid 170 through 174 or (resid 175 and (name N or name CA or name C or name O or name CB )) or resid 176 or (resid 177 through 178 and (name N or name CA or name C or name O or name CB )) or resid 179 through 186 or (resid 187 and (name N or name CA or name C or name O or name CB )) or resid 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 192 or (resid 193 through 194 and (name N or name CA or name C or name O or name CB )) or resid 195 through 201 or (resid 202 through 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205 or (resid 206 through 207 and (name N or name CA or name C or name O or name CB )) or resid 208 through 218 or (resid 219 and (name N or name CA or name C or name O or name CB )) or resid 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 223 or (resid 224 through 227 and (name N or name CA or name C or name O or name CB )) or resid 229 through 230 or resid 232 through 234 or resid 236 through 238 or (resid 239 and (name N or name CA or name C or name O or name CB )) or resid 240 through 244)) ; 1 3 6 C GLU 8 . G 7P7 . . C GLU 137 C 7P7 4000 ? ;(chain C and (resid 137 through 144 or (resid 145 through 146 and (name N or name CA or name C or name O or name CB )) or resid 147 through 149 or resid 151 through 153 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 162 or resid 164 through 168 or resid 170 through 174 or (resid 175 and (name N or name CA or name C or name O or name CB )) or resid 176 or (resid 177 through 178 and (name N or name CA or name C or name O or name CB )) or resid 179 through 186 or (resid 187 and (name N or name CA or name C or name O or name CB )) or resid 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 192 or (resid 193 through 194 and (name N or name CA or name C or name O or name CB )) or resid 195 through 201 or (resid 202 through 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205 or (resid 206 through 207 and (name N or name CA or name C or name O or name CB )) or resid 208 through 218 or (resid 219 and (name N or name CA or name C or name O or name CB )) or resid 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 223 or (resid 224 through 227 and (name N or name CA or name C or name O or name CB )) or resid 229 through 230 or resid 232 through 234 or resid 236 through 238 or (resid 239 and (name N or name CA or name C or name O or name CB )) or resid 240 through 244)) ; 1 4 1 D GLU 8 . D LEU 20 . D GLU 137 D LEU 149 ? ;(chain D and (resid 137 through 149 or resid 151 through 153 or resid 155 through 162 or resid 164 through 168 or resid 170 through 227 or resid 229 through 230 or resid 232 through 234 or resid 236 through 244)) ; 1 4 2 D GLN 22 . D GLN 24 . D GLN 151 D GLN 153 ? ;(chain D and (resid 137 through 149 or resid 151 through 153 or resid 155 through 162 or resid 164 through 168 or resid 170 through 227 or resid 229 through 230 or resid 232 through 234 or resid 236 through 244)) ; 1 4 3 D LYS 26 . D ALA 33 . D LYS 155 D ALA 162 ? ;(chain D and (resid 137 through 149 or resid 151 through 153 or resid 155 through 162 or resid 164 through 168 or resid 170 through 227 or resid 229 through 230 or resid 232 through 234 or resid 236 through 244)) ; 1 4 4 D PRO 35 . D ALA 39 . D PRO 164 D ALA 168 ? ;(chain D and (resid 137 through 149 or resid 151 through 153 or resid 155 through 162 or resid 164 through 168 or resid 170 through 227 or resid 229 through 230 or resid 232 through 234 or resid 236 through 244)) ; 1 4 5 D ALA 41 . D LYS 98 . D ALA 170 D LYS 227 ? ;(chain D and (resid 137 through 149 or resid 151 through 153 or resid 155 through 162 or resid 164 through 168 or resid 170 through 227 or resid 229 through 230 or resid 232 through 234 or resid 236 through 244)) ; 1 4 6 D ILE 100 . D LEU 101 . D ILE 229 D LEU 230 ? ;(chain D and (resid 137 through 149 or resid 151 through 153 or resid 155 through 162 or resid 164 through 168 or resid 170 through 227 or resid 229 through 230 or resid 232 through 234 or resid 236 through 244)) ; 1 4 7 D ALA 103 . D PHE 105 . D ALA 232 D PHE 234 ? ;(chain D and (resid 137 through 149 or resid 151 through 153 or resid 155 through 162 or resid 164 through 168 or resid 170 through 227 or resid 229 through 230 or resid 232 through 234 or resid 236 through 244)) ; 1 4 8 D MET 107 . D LEU 115 . D MET 236 D LEU 244 ? ;(chain D and (resid 137 through 149 or resid 151 through 153 or resid 155 through 162 or resid 164 through 168 or resid 170 through 227 or resid 229 through 230 or resid 232 through 234 or resid 236 through 244)) ; # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 5TWX _struct.title 'Crystal Structure of BRD9 bromodomain' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5TWX _struct_keywords.text 'bromodomain, inhibitor, chemical degradation, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 1 ? E N N 2 ? F N N 2 ? G N N 2 ? H N N 2 ? I N N 3 ? J N N 3 ? K N N 3 ? L N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 10 ? ARG A 25 ? THR A 139 ARG A 154 1 ? 16 HELX_P HELX_P2 AA2 GLY A 43 ? ILE A 48 ? GLY A 172 ILE A 177 1 ? 6 HELX_P HELX_P3 AA3 ASP A 53 ? ALA A 63 ? ASP A 182 ALA A 192 1 ? 11 HELX_P HELX_P4 AA4 SER A 68 ? ASN A 87 ? SER A 197 ASN A 216 1 ? 20 HELX_P HELX_P5 AA5 THR A 91 ? LEU A 114 ? THR A 220 LEU A 243 1 ? 24 HELX_P HELX_P6 AA6 THR B 10 ? ARG B 25 ? THR B 139 ARG B 154 1 ? 16 HELX_P HELX_P7 AA7 GLY B 43 ? ILE B 48 ? GLY B 172 ILE B 177 1 ? 6 HELX_P HELX_P8 AA8 ASP B 53 ? ALA B 63 ? ASP B 182 ALA B 192 1 ? 11 HELX_P HELX_P9 AA9 SER B 68 ? ASN B 87 ? SER B 197 ASN B 216 1 ? 20 HELX_P HELX_P10 AB1 THR B 91 ? ASN B 117 ? THR B 220 ASN B 246 1 ? 27 HELX_P HELX_P11 AB2 THR C 10 ? ARG C 25 ? THR C 139 ARG C 154 1 ? 16 HELX_P HELX_P12 AB3 GLY C 43 ? ILE C 48 ? GLY C 172 ILE C 177 1 ? 6 HELX_P HELX_P13 AB4 ASP C 53 ? ALA C 63 ? ASP C 182 ALA C 192 1 ? 11 HELX_P HELX_P14 AB5 SER C 68 ? ASN C 87 ? SER C 197 ASN C 216 1 ? 20 HELX_P HELX_P15 AB6 THR C 91 ? LEU C 115 ? THR C 220 LEU C 244 1 ? 25 HELX_P HELX_P16 AB7 THR D 10 ? LYS D 26 ? THR D 139 LYS D 155 1 ? 17 HELX_P HELX_P17 AB8 GLY D 43 ? ILE D 48 ? GLY D 172 ILE D 177 1 ? 6 HELX_P HELX_P18 AB9 ASP D 53 ? ALA D 63 ? ASP D 182 ALA D 192 1 ? 11 HELX_P HELX_P19 AC1 SER D 68 ? ASN D 87 ? SER D 197 ASN D 216 1 ? 20 HELX_P HELX_P20 AC2 THR D 91 ? LEU D 114 ? THR D 220 LEU D 243 1 ? 24 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale none ? E 7P7 . C6 ? ? ? 1_555 G 7P7 . C34 ? ? A 7P7 4000 C 7P7 4000 8_555 ? ? ? ? ? ? ? 1.491 ? ? covale2 covale none ? E 7P7 . C7 ? ? ? 1_555 G 7P7 . C34 ? ? A 7P7 4000 C 7P7 4000 8_555 ? ? ? ? ? ? ? 1.630 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software B 7P7 4000 ? 14 'binding site for residue 7P7 B 4000' AC2 Software D 7P7 4000 ? 11 'binding site for residue 7P7 D 4000' AC3 Software A 7P7 4000 ? 29 'binding site for residues 7P7 A 4000 and 7P7 C 4000' AC4 Software A 7P7 4000 ? 29 'binding site for residues 7P7 A 4000 and 7P7 C 4000' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 14 PHE B 31 ? PHE B 160 . ? 1_555 ? 2 AC1 14 PHE B 32 ? PHE B 161 . ? 1_555 ? 3 AC1 14 VAL B 36 ? VAL B 165 . ? 1_555 ? 4 AC1 14 ILE B 40 ? ILE B 169 . ? 1_555 ? 5 AC1 14 ALA B 41 ? ALA B 170 . ? 1_555 ? 6 AC1 14 TYR B 86 ? TYR B 215 . ? 1_555 ? 7 AC1 14 ASN B 87 ? ASN B 216 . ? 1_555 ? 8 AC1 14 ARG B 88 ? ARG B 217 . ? 1_555 ? 9 AC1 14 THR B 91 ? THR B 220 . ? 1_555 ? 10 AC1 14 TYR B 93 ? TYR B 222 . ? 1_555 ? 11 AC1 14 GLN D 24 ? GLN D 153 . ? 1_555 ? 12 AC1 14 ARG D 25 ? ARG D 154 . ? 1_555 ? 13 AC1 14 PRO D 28 ? PRO D 157 . ? 1_555 ? 14 AC1 14 PHE D 34 ? PHE D 163 . ? 1_555 ? 15 AC2 11 THR B 37 ? THR B 166 . ? 1_555 ? 16 AC2 11 ALA B 39 ? ALA B 168 . ? 1_555 ? 17 AC2 11 ILE B 40 ? ILE B 169 . ? 1_555 ? 18 AC2 11 MET C 46 ? MET C 175 . ? 1_655 ? 19 AC2 11 PHE D 31 ? PHE D 160 . ? 1_555 ? 20 AC2 11 ILE D 40 ? ILE D 169 . ? 1_555 ? 21 AC2 11 TYR D 86 ? TYR D 215 . ? 1_555 ? 22 AC2 11 ASN D 87 ? ASN D 216 . ? 1_555 ? 23 AC2 11 ARG D 88 ? ARG D 217 . ? 1_555 ? 24 AC2 11 THR D 91 ? THR D 220 . ? 1_555 ? 25 AC2 11 TYR D 93 ? TYR D 222 . ? 1_555 ? 26 AC3 29 LYS A 26 ? LYS A 155 . ? 8_555 ? 27 AC3 29 PRO A 28 ? PRO A 157 . ? 8_555 ? 28 AC3 29 HIS A 29 ? HIS A 158 . ? 8_555 ? 29 AC3 29 PHE A 31 ? PHE A 160 . ? 1_555 ? 30 AC3 29 PHE A 31 ? PHE A 160 . ? 8_555 ? 31 AC3 29 PHE A 32 ? PHE A 161 . ? 1_555 ? 32 AC3 29 PHE A 34 ? PHE A 163 . ? 1_555 ? 33 AC3 29 VAL A 36 ? VAL A 165 . ? 1_555 ? 34 AC3 29 ILE A 40 ? ILE A 169 . ? 1_555 ? 35 AC3 29 ALA A 41 ? ALA A 170 . ? 1_555 ? 36 AC3 29 TYR A 86 ? TYR A 215 . ? 1_555 ? 37 AC3 29 ASN A 87 ? ASN A 216 . ? 1_555 ? 38 AC3 29 ARG A 88 ? ARG A 217 . ? 1_555 ? 39 AC3 29 THR A 91 ? THR A 220 . ? 1_555 ? 40 AC3 29 VAL A 92 ? VAL A 221 . ? 8_555 ? 41 AC3 29 TYR A 93 ? TYR A 222 . ? 1_555 ? 42 AC3 29 TYR A 93 ? TYR A 222 . ? 8_555 ? 43 AC3 29 LEU A 96 ? LEU A 225 . ? 8_555 ? 44 AC3 29 MET B 46 ? MET B 175 . ? 1_455 ? 45 AC3 29 PHE C 31 ? PHE C 160 . ? 1_555 ? 46 AC3 29 PHE C 32 ? PHE C 161 . ? 1_555 ? 47 AC3 29 PHE C 34 ? PHE C 163 . ? 1_555 ? 48 AC3 29 ALA C 39 ? ALA C 168 . ? 1_555 ? 49 AC3 29 ILE C 40 ? ILE C 169 . ? 1_555 ? 50 AC3 29 ALA C 41 ? ALA C 170 . ? 1_555 ? 51 AC3 29 ASN C 87 ? ASN C 216 . ? 1_555 ? 52 AC3 29 ARG C 88 ? ARG C 217 . ? 1_555 ? 53 AC3 29 THR C 91 ? THR C 220 . ? 1_555 ? 54 AC3 29 TYR C 93 ? TYR C 222 . ? 1_555 ? 55 AC4 29 LYS A 26 ? LYS A 155 . ? 8_555 ? 56 AC4 29 PRO A 28 ? PRO A 157 . ? 8_555 ? 57 AC4 29 HIS A 29 ? HIS A 158 . ? 8_555 ? 58 AC4 29 PHE A 31 ? PHE A 160 . ? 1_555 ? 59 AC4 29 PHE A 31 ? PHE A 160 . ? 8_555 ? 60 AC4 29 PHE A 32 ? PHE A 161 . ? 1_555 ? 61 AC4 29 PHE A 34 ? PHE A 163 . ? 1_555 ? 62 AC4 29 VAL A 36 ? VAL A 165 . ? 1_555 ? 63 AC4 29 ILE A 40 ? ILE A 169 . ? 1_555 ? 64 AC4 29 ALA A 41 ? ALA A 170 . ? 1_555 ? 65 AC4 29 TYR A 86 ? TYR A 215 . ? 1_555 ? 66 AC4 29 ASN A 87 ? ASN A 216 . ? 1_555 ? 67 AC4 29 ARG A 88 ? ARG A 217 . ? 1_555 ? 68 AC4 29 THR A 91 ? THR A 220 . ? 1_555 ? 69 AC4 29 VAL A 92 ? VAL A 221 . ? 8_555 ? 70 AC4 29 TYR A 93 ? TYR A 222 . ? 1_555 ? 71 AC4 29 TYR A 93 ? TYR A 222 . ? 8_555 ? 72 AC4 29 LEU A 96 ? LEU A 225 . ? 8_555 ? 73 AC4 29 MET B 46 ? MET B 175 . ? 1_455 ? 74 AC4 29 PHE C 31 ? PHE C 160 . ? 1_555 ? 75 AC4 29 PHE C 32 ? PHE C 161 . ? 1_555 ? 76 AC4 29 PHE C 34 ? PHE C 163 . ? 1_555 ? 77 AC4 29 ALA C 39 ? ALA C 168 . ? 1_555 ? 78 AC4 29 ILE C 40 ? ILE C 169 . ? 1_555 ? 79 AC4 29 ALA C 41 ? ALA C 170 . ? 1_555 ? 80 AC4 29 ASN C 87 ? ASN C 216 . ? 1_555 ? 81 AC4 29 ARG C 88 ? ARG C 217 . ? 1_555 ? 82 AC4 29 THR C 91 ? THR C 220 . ? 1_555 ? 83 AC4 29 TYR C 93 ? TYR C 222 . ? 1_555 ? # _atom_sites.entry_id 5TWX _atom_sites.fract_transf_matrix[1][1] 0.013287 _atom_sites.fract_transf_matrix[1][2] 0.007671 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015343 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.002904 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 130 ? ? ? A . n A 1 2 PRO 2 131 ? ? ? A . n A 1 3 HIS 3 132 ? ? ? A . n A 1 4 MET 4 133 ? ? ? A . n A 1 5 ALA 5 134 ? ? ? A . n A 1 6 GLU 6 135 ? ? ? A . n A 1 7 ASN 7 136 ? ? ? A . n A 1 8 GLU 8 137 137 GLU GLU A . n A 1 9 SER 9 138 138 SER SER A . n A 1 10 THR 10 139 139 THR THR A . n A 1 11 PRO 11 140 140 PRO PRO A . n A 1 12 ILE 12 141 141 ILE ILE A . n A 1 13 GLN 13 142 142 GLN GLN A . n A 1 14 GLN 14 143 143 GLN GLN A . n A 1 15 LEU 15 144 144 LEU LEU A . n A 1 16 LEU 16 145 145 LEU LEU A . n A 1 17 GLU 17 146 146 GLU GLU A . n A 1 18 HIS 18 147 147 HIS HIS A . n A 1 19 PHE 19 148 148 PHE PHE A . n A 1 20 LEU 20 149 149 LEU LEU A . n A 1 21 ARG 21 150 150 ARG ARG A . n A 1 22 GLN 22 151 151 GLN GLN A . n A 1 23 LEU 23 152 152 LEU LEU A . n A 1 24 GLN 24 153 153 GLN GLN A . n A 1 25 ARG 25 154 154 ARG ARG A . n A 1 26 LYS 26 155 155 LYS LYS A . n A 1 27 ASP 27 156 156 ASP ASP A . n A 1 28 PRO 28 157 157 PRO PRO A . n A 1 29 HIS 29 158 158 HIS HIS A . n A 1 30 GLY 30 159 159 GLY GLY A . n A 1 31 PHE 31 160 160 PHE PHE A . n A 1 32 PHE 32 161 161 PHE PHE A . n A 1 33 ALA 33 162 162 ALA ALA A . n A 1 34 PHE 34 163 163 PHE PHE A . n A 1 35 PRO 35 164 164 PRO PRO A . n A 1 36 VAL 36 165 165 VAL VAL A . n A 1 37 THR 37 166 166 THR THR A . n A 1 38 ASP 38 167 167 ASP ASP A . n A 1 39 ALA 39 168 168 ALA ALA A . n A 1 40 ILE 40 169 169 ILE ILE A . n A 1 41 ALA 41 170 170 ALA ALA A . n A 1 42 PRO 42 171 171 PRO PRO A . n A 1 43 GLY 43 172 172 GLY GLY A . n A 1 44 TYR 44 173 173 TYR TYR A . n A 1 45 SER 45 174 174 SER SER A . n A 1 46 MET 46 175 175 MET MET A . n A 1 47 ILE 47 176 176 ILE ILE A . n A 1 48 ILE 48 177 177 ILE ILE A . n A 1 49 LYS 49 178 178 LYS LYS A . n A 1 50 HIS 50 179 179 HIS HIS A . n A 1 51 PRO 51 180 180 PRO PRO A . n A 1 52 MET 52 181 181 MET MET A . n A 1 53 ASP 53 182 182 ASP ASP A . n A 1 54 PHE 54 183 183 PHE PHE A . n A 1 55 GLY 55 184 184 GLY GLY A . n A 1 56 THR 56 185 185 THR THR A . n A 1 57 MET 57 186 186 MET MET A . n A 1 58 LYS 58 187 187 LYS LYS A . n A 1 59 ASP 59 188 188 ASP ASP A . n A 1 60 LYS 60 189 189 LYS LYS A . n A 1 61 ILE 61 190 190 ILE ILE A . n A 1 62 VAL 62 191 191 VAL VAL A . n A 1 63 ALA 63 192 192 ALA ALA A . n A 1 64 ASN 64 193 193 ASN ASN A . n A 1 65 GLU 65 194 194 GLU GLU A . n A 1 66 TYR 66 195 195 TYR TYR A . n A 1 67 LYS 67 196 196 LYS LYS A . n A 1 68 SER 68 197 197 SER SER A . n A 1 69 VAL 69 198 198 VAL VAL A . n A 1 70 THR 70 199 199 THR THR A . n A 1 71 GLU 71 200 200 GLU GLU A . n A 1 72 PHE 72 201 201 PHE PHE A . n A 1 73 LYS 73 202 202 LYS LYS A . n A 1 74 ALA 74 203 203 ALA ALA A . n A 1 75 ASP 75 204 204 ASP ASP A . n A 1 76 PHE 76 205 205 PHE PHE A . n A 1 77 LYS 77 206 206 LYS LYS A . n A 1 78 LEU 78 207 207 LEU LEU A . n A 1 79 MET 79 208 208 MET MET A . n A 1 80 CYS 80 209 209 CYS CYS A . n A 1 81 ASP 81 210 210 ASP ASP A . n A 1 82 ASN 82 211 211 ASN ASN A . n A 1 83 ALA 83 212 212 ALA ALA A . n A 1 84 MET 84 213 213 MET MET A . n A 1 85 THR 85 214 214 THR THR A . n A 1 86 TYR 86 215 215 TYR TYR A . n A 1 87 ASN 87 216 216 ASN ASN A . n A 1 88 ARG 88 217 217 ARG ARG A . n A 1 89 PRO 89 218 218 PRO PRO A . n A 1 90 ASP 90 219 219 ASP ASP A . n A 1 91 THR 91 220 220 THR THR A . n A 1 92 VAL 92 221 221 VAL VAL A . n A 1 93 TYR 93 222 222 TYR TYR A . n A 1 94 TYR 94 223 223 TYR TYR A . n A 1 95 LYS 95 224 224 LYS LYS A . n A 1 96 LEU 96 225 225 LEU LEU A . n A 1 97 ALA 97 226 226 ALA ALA A . n A 1 98 LYS 98 227 227 LYS LYS A . n A 1 99 LYS 99 228 228 LYS LYS A . n A 1 100 ILE 100 229 229 ILE ILE A . n A 1 101 LEU 101 230 230 LEU LEU A . n A 1 102 HIS 102 231 231 HIS HIS A . n A 1 103 ALA 103 232 232 ALA ALA A . n A 1 104 GLY 104 233 233 GLY GLY A . n A 1 105 PHE 105 234 234 PHE PHE A . n A 1 106 LYS 106 235 235 LYS LYS A . n A 1 107 MET 107 236 236 MET MET A . n A 1 108 MET 108 237 237 MET MET A . n A 1 109 SER 109 238 238 SER SER A . n A 1 110 LYS 110 239 239 LYS LYS A . n A 1 111 GLN 111 240 240 GLN GLN A . n A 1 112 ALA 112 241 241 ALA ALA A . n A 1 113 ALA 113 242 242 ALA ALA A . n A 1 114 LEU 114 243 243 LEU LEU A . n A 1 115 LEU 115 244 244 LEU LEU A . n A 1 116 GLY 116 245 245 GLY GLY A . n A 1 117 ASN 117 246 246 ASN ASN A . n A 1 118 GLU 118 247 247 GLU GLU A . n A 1 119 ASP 119 248 248 ASP ASP A . n A 1 120 THR 120 249 249 THR THR A . n A 1 121 ALA 121 250 250 ALA ALA A . n B 1 1 GLY 1 130 ? ? ? B . n B 1 2 PRO 2 131 ? ? ? B . n B 1 3 HIS 3 132 ? ? ? B . n B 1 4 MET 4 133 ? ? ? B . n B 1 5 ALA 5 134 ? ? ? B . n B 1 6 GLU 6 135 ? ? ? B . n B 1 7 ASN 7 136 ? ? ? B . n B 1 8 GLU 8 137 137 GLU GLU B . n B 1 9 SER 9 138 138 SER SER B . n B 1 10 THR 10 139 139 THR THR B . n B 1 11 PRO 11 140 140 PRO PRO B . n B 1 12 ILE 12 141 141 ILE ILE B . n B 1 13 GLN 13 142 142 GLN GLN B . n B 1 14 GLN 14 143 143 GLN GLN B . n B 1 15 LEU 15 144 144 LEU LEU B . n B 1 16 LEU 16 145 145 LEU LEU B . n B 1 17 GLU 17 146 146 GLU GLU B . n B 1 18 HIS 18 147 147 HIS HIS B . n B 1 19 PHE 19 148 148 PHE PHE B . n B 1 20 LEU 20 149 149 LEU LEU B . n B 1 21 ARG 21 150 150 ARG ARG B . n B 1 22 GLN 22 151 151 GLN GLN B . n B 1 23 LEU 23 152 152 LEU LEU B . n B 1 24 GLN 24 153 153 GLN GLN B . n B 1 25 ARG 25 154 154 ARG ARG B . n B 1 26 LYS 26 155 155 LYS LYS B . n B 1 27 ASP 27 156 156 ASP ASP B . n B 1 28 PRO 28 157 157 PRO PRO B . n B 1 29 HIS 29 158 158 HIS HIS B . n B 1 30 GLY 30 159 159 GLY GLY B . n B 1 31 PHE 31 160 160 PHE PHE B . n B 1 32 PHE 32 161 161 PHE PHE B . n B 1 33 ALA 33 162 162 ALA ALA B . n B 1 34 PHE 34 163 163 PHE PHE B . n B 1 35 PRO 35 164 164 PRO PRO B . n B 1 36 VAL 36 165 165 VAL VAL B . n B 1 37 THR 37 166 166 THR THR B . n B 1 38 ASP 38 167 167 ASP ASP B . n B 1 39 ALA 39 168 168 ALA ALA B . n B 1 40 ILE 40 169 169 ILE ILE B . n B 1 41 ALA 41 170 170 ALA ALA B . n B 1 42 PRO 42 171 171 PRO PRO B . n B 1 43 GLY 43 172 172 GLY GLY B . n B 1 44 TYR 44 173 173 TYR TYR B . n B 1 45 SER 45 174 174 SER SER B . n B 1 46 MET 46 175 175 MET MET B . n B 1 47 ILE 47 176 176 ILE ILE B . n B 1 48 ILE 48 177 177 ILE ILE B . n B 1 49 LYS 49 178 178 LYS LYS B . n B 1 50 HIS 50 179 179 HIS HIS B . n B 1 51 PRO 51 180 180 PRO PRO B . n B 1 52 MET 52 181 181 MET MET B . n B 1 53 ASP 53 182 182 ASP ASP B . n B 1 54 PHE 54 183 183 PHE PHE B . n B 1 55 GLY 55 184 184 GLY GLY B . n B 1 56 THR 56 185 185 THR THR B . n B 1 57 MET 57 186 186 MET MET B . n B 1 58 LYS 58 187 187 LYS LYS B . n B 1 59 ASP 59 188 188 ASP ASP B . n B 1 60 LYS 60 189 189 LYS LYS B . n B 1 61 ILE 61 190 190 ILE ILE B . n B 1 62 VAL 62 191 191 VAL VAL B . n B 1 63 ALA 63 192 192 ALA ALA B . n B 1 64 ASN 64 193 193 ASN ASN B . n B 1 65 GLU 65 194 194 GLU GLU B . n B 1 66 TYR 66 195 195 TYR TYR B . n B 1 67 LYS 67 196 196 LYS LYS B . n B 1 68 SER 68 197 197 SER SER B . n B 1 69 VAL 69 198 198 VAL VAL B . n B 1 70 THR 70 199 199 THR THR B . n B 1 71 GLU 71 200 200 GLU GLU B . n B 1 72 PHE 72 201 201 PHE PHE B . n B 1 73 LYS 73 202 202 LYS LYS B . n B 1 74 ALA 74 203 203 ALA ALA B . n B 1 75 ASP 75 204 204 ASP ASP B . n B 1 76 PHE 76 205 205 PHE PHE B . n B 1 77 LYS 77 206 206 LYS LYS B . n B 1 78 LEU 78 207 207 LEU LEU B . n B 1 79 MET 79 208 208 MET MET B . n B 1 80 CYS 80 209 209 CYS CYS B . n B 1 81 ASP 81 210 210 ASP ASP B . n B 1 82 ASN 82 211 211 ASN ASN B . n B 1 83 ALA 83 212 212 ALA ALA B . n B 1 84 MET 84 213 213 MET MET B . n B 1 85 THR 85 214 214 THR THR B . n B 1 86 TYR 86 215 215 TYR TYR B . n B 1 87 ASN 87 216 216 ASN ASN B . n B 1 88 ARG 88 217 217 ARG ARG B . n B 1 89 PRO 89 218 218 PRO PRO B . n B 1 90 ASP 90 219 219 ASP ASP B . n B 1 91 THR 91 220 220 THR THR B . n B 1 92 VAL 92 221 221 VAL VAL B . n B 1 93 TYR 93 222 222 TYR TYR B . n B 1 94 TYR 94 223 223 TYR TYR B . n B 1 95 LYS 95 224 224 LYS LYS B . n B 1 96 LEU 96 225 225 LEU LEU B . n B 1 97 ALA 97 226 226 ALA ALA B . n B 1 98 LYS 98 227 227 LYS LYS B . n B 1 99 LYS 99 228 228 LYS LYS B . n B 1 100 ILE 100 229 229 ILE ILE B . n B 1 101 LEU 101 230 230 LEU LEU B . n B 1 102 HIS 102 231 231 HIS HIS B . n B 1 103 ALA 103 232 232 ALA ALA B . n B 1 104 GLY 104 233 233 GLY GLY B . n B 1 105 PHE 105 234 234 PHE PHE B . n B 1 106 LYS 106 235 235 LYS LYS B . n B 1 107 MET 107 236 236 MET MET B . n B 1 108 MET 108 237 237 MET MET B . n B 1 109 SER 109 238 238 SER SER B . n B 1 110 LYS 110 239 239 LYS LYS B . n B 1 111 GLN 111 240 240 GLN GLN B . n B 1 112 ALA 112 241 241 ALA ALA B . n B 1 113 ALA 113 242 242 ALA ALA B . n B 1 114 LEU 114 243 243 LEU LEU B . n B 1 115 LEU 115 244 244 LEU LEU B . n B 1 116 GLY 116 245 245 GLY GLY B . n B 1 117 ASN 117 246 246 ASN ASN B . n B 1 118 GLU 118 247 247 GLU GLU B . n B 1 119 ASP 119 248 ? ? ? B . n B 1 120 THR 120 249 ? ? ? B . n B 1 121 ALA 121 250 ? ? ? B . n C 1 1 GLY 1 130 ? ? ? C . n C 1 2 PRO 2 131 ? ? ? C . n C 1 3 HIS 3 132 ? ? ? C . n C 1 4 MET 4 133 ? ? ? C . n C 1 5 ALA 5 134 ? ? ? C . n C 1 6 GLU 6 135 ? ? ? C . n C 1 7 ASN 7 136 ? ? ? C . n C 1 8 GLU 8 137 137 GLU GLU C . n C 1 9 SER 9 138 138 SER SER C . n C 1 10 THR 10 139 139 THR THR C . n C 1 11 PRO 11 140 140 PRO PRO C . n C 1 12 ILE 12 141 141 ILE ILE C . n C 1 13 GLN 13 142 142 GLN GLN C . n C 1 14 GLN 14 143 143 GLN GLN C . n C 1 15 LEU 15 144 144 LEU LEU C . n C 1 16 LEU 16 145 145 LEU LEU C . n C 1 17 GLU 17 146 146 GLU GLU C . n C 1 18 HIS 18 147 147 HIS HIS C . n C 1 19 PHE 19 148 148 PHE PHE C . n C 1 20 LEU 20 149 149 LEU LEU C . n C 1 21 ARG 21 150 150 ARG ARG C . n C 1 22 GLN 22 151 151 GLN GLN C . n C 1 23 LEU 23 152 152 LEU LEU C . n C 1 24 GLN 24 153 153 GLN GLN C . n C 1 25 ARG 25 154 154 ARG ARG C . n C 1 26 LYS 26 155 155 LYS LYS C . n C 1 27 ASP 27 156 156 ASP ASP C . n C 1 28 PRO 28 157 157 PRO PRO C . n C 1 29 HIS 29 158 158 HIS HIS C . n C 1 30 GLY 30 159 159 GLY GLY C . n C 1 31 PHE 31 160 160 PHE PHE C . n C 1 32 PHE 32 161 161 PHE PHE C . n C 1 33 ALA 33 162 162 ALA ALA C . n C 1 34 PHE 34 163 163 PHE PHE C . n C 1 35 PRO 35 164 164 PRO PRO C . n C 1 36 VAL 36 165 165 VAL VAL C . n C 1 37 THR 37 166 166 THR THR C . n C 1 38 ASP 38 167 167 ASP ASP C . n C 1 39 ALA 39 168 168 ALA ALA C . n C 1 40 ILE 40 169 169 ILE ILE C . n C 1 41 ALA 41 170 170 ALA ALA C . n C 1 42 PRO 42 171 171 PRO PRO C . n C 1 43 GLY 43 172 172 GLY GLY C . n C 1 44 TYR 44 173 173 TYR TYR C . n C 1 45 SER 45 174 174 SER SER C . n C 1 46 MET 46 175 175 MET MET C . n C 1 47 ILE 47 176 176 ILE ILE C . n C 1 48 ILE 48 177 177 ILE ILE C . n C 1 49 LYS 49 178 178 LYS LYS C . n C 1 50 HIS 50 179 179 HIS HIS C . n C 1 51 PRO 51 180 180 PRO PRO C . n C 1 52 MET 52 181 181 MET MET C . n C 1 53 ASP 53 182 182 ASP ASP C . n C 1 54 PHE 54 183 183 PHE PHE C . n C 1 55 GLY 55 184 184 GLY GLY C . n C 1 56 THR 56 185 185 THR THR C . n C 1 57 MET 57 186 186 MET MET C . n C 1 58 LYS 58 187 187 LYS LYS C . n C 1 59 ASP 59 188 188 ASP ASP C . n C 1 60 LYS 60 189 189 LYS LYS C . n C 1 61 ILE 61 190 190 ILE ILE C . n C 1 62 VAL 62 191 191 VAL VAL C . n C 1 63 ALA 63 192 192 ALA ALA C . n C 1 64 ASN 64 193 193 ASN ASN C . n C 1 65 GLU 65 194 194 GLU GLU C . n C 1 66 TYR 66 195 195 TYR TYR C . n C 1 67 LYS 67 196 196 LYS LYS C . n C 1 68 SER 68 197 197 SER SER C . n C 1 69 VAL 69 198 198 VAL VAL C . n C 1 70 THR 70 199 199 THR THR C . n C 1 71 GLU 71 200 200 GLU GLU C . n C 1 72 PHE 72 201 201 PHE PHE C . n C 1 73 LYS 73 202 202 LYS LYS C . n C 1 74 ALA 74 203 203 ALA ALA C . n C 1 75 ASP 75 204 204 ASP ASP C . n C 1 76 PHE 76 205 205 PHE PHE C . n C 1 77 LYS 77 206 206 LYS LYS C . n C 1 78 LEU 78 207 207 LEU LEU C . n C 1 79 MET 79 208 208 MET MET C . n C 1 80 CYS 80 209 209 CYS CYS C . n C 1 81 ASP 81 210 210 ASP ASP C . n C 1 82 ASN 82 211 211 ASN ASN C . n C 1 83 ALA 83 212 212 ALA ALA C . n C 1 84 MET 84 213 213 MET MET C . n C 1 85 THR 85 214 214 THR THR C . n C 1 86 TYR 86 215 215 TYR TYR C . n C 1 87 ASN 87 216 216 ASN ASN C . n C 1 88 ARG 88 217 217 ARG ARG C . n C 1 89 PRO 89 218 218 PRO PRO C . n C 1 90 ASP 90 219 219 ASP ASP C . n C 1 91 THR 91 220 220 THR THR C . n C 1 92 VAL 92 221 221 VAL VAL C . n C 1 93 TYR 93 222 222 TYR TYR C . n C 1 94 TYR 94 223 223 TYR TYR C . n C 1 95 LYS 95 224 224 LYS LYS C . n C 1 96 LEU 96 225 225 LEU LEU C . n C 1 97 ALA 97 226 226 ALA ALA C . n C 1 98 LYS 98 227 227 LYS LYS C . n C 1 99 LYS 99 228 228 LYS LYS C . n C 1 100 ILE 100 229 229 ILE ILE C . n C 1 101 LEU 101 230 230 LEU LEU C . n C 1 102 HIS 102 231 231 HIS HIS C . n C 1 103 ALA 103 232 232 ALA ALA C . n C 1 104 GLY 104 233 233 GLY GLY C . n C 1 105 PHE 105 234 234 PHE PHE C . n C 1 106 LYS 106 235 235 LYS LYS C . n C 1 107 MET 107 236 236 MET MET C . n C 1 108 MET 108 237 237 MET MET C . n C 1 109 SER 109 238 238 SER SER C . n C 1 110 LYS 110 239 239 LYS LYS C . n C 1 111 GLN 111 240 240 GLN GLN C . n C 1 112 ALA 112 241 241 ALA ALA C . n C 1 113 ALA 113 242 242 ALA ALA C . n C 1 114 LEU 114 243 243 LEU LEU C . n C 1 115 LEU 115 244 244 LEU LEU C . n C 1 116 GLY 116 245 ? ? ? C . n C 1 117 ASN 117 246 ? ? ? C . n C 1 118 GLU 118 247 ? ? ? C . n C 1 119 ASP 119 248 ? ? ? C . n C 1 120 THR 120 249 ? ? ? C . n C 1 121 ALA 121 250 ? ? ? C . n D 1 1 GLY 1 130 ? ? ? D . n D 1 2 PRO 2 131 ? ? ? D . n D 1 3 HIS 3 132 ? ? ? D . n D 1 4 MET 4 133 ? ? ? D . n D 1 5 ALA 5 134 ? ? ? D . n D 1 6 GLU 6 135 ? ? ? D . n D 1 7 ASN 7 136 ? ? ? D . n D 1 8 GLU 8 137 137 GLU GLU D . n D 1 9 SER 9 138 138 SER SER D . n D 1 10 THR 10 139 139 THR THR D . n D 1 11 PRO 11 140 140 PRO PRO D . n D 1 12 ILE 12 141 141 ILE ILE D . n D 1 13 GLN 13 142 142 GLN GLN D . n D 1 14 GLN 14 143 143 GLN GLN D . n D 1 15 LEU 15 144 144 LEU LEU D . n D 1 16 LEU 16 145 145 LEU LEU D . n D 1 17 GLU 17 146 146 GLU GLU D . n D 1 18 HIS 18 147 147 HIS HIS D . n D 1 19 PHE 19 148 148 PHE PHE D . n D 1 20 LEU 20 149 149 LEU LEU D . n D 1 21 ARG 21 150 150 ARG ARG D . n D 1 22 GLN 22 151 151 GLN GLN D . n D 1 23 LEU 23 152 152 LEU LEU D . n D 1 24 GLN 24 153 153 GLN GLN D . n D 1 25 ARG 25 154 154 ARG ARG D . n D 1 26 LYS 26 155 155 LYS LYS D . n D 1 27 ASP 27 156 156 ASP ASP D . n D 1 28 PRO 28 157 157 PRO PRO D . n D 1 29 HIS 29 158 158 HIS HIS D . n D 1 30 GLY 30 159 159 GLY GLY D . n D 1 31 PHE 31 160 160 PHE PHE D . n D 1 32 PHE 32 161 161 PHE PHE D . n D 1 33 ALA 33 162 162 ALA ALA D . n D 1 34 PHE 34 163 163 PHE PHE D . n D 1 35 PRO 35 164 164 PRO PRO D . n D 1 36 VAL 36 165 165 VAL VAL D . n D 1 37 THR 37 166 166 THR THR D . n D 1 38 ASP 38 167 167 ASP ASP D . n D 1 39 ALA 39 168 168 ALA ALA D . n D 1 40 ILE 40 169 169 ILE ILE D . n D 1 41 ALA 41 170 170 ALA ALA D . n D 1 42 PRO 42 171 171 PRO PRO D . n D 1 43 GLY 43 172 172 GLY GLY D . n D 1 44 TYR 44 173 173 TYR TYR D . n D 1 45 SER 45 174 174 SER SER D . n D 1 46 MET 46 175 175 MET MET D . n D 1 47 ILE 47 176 176 ILE ILE D . n D 1 48 ILE 48 177 177 ILE ILE D . n D 1 49 LYS 49 178 178 LYS LYS D . n D 1 50 HIS 50 179 179 HIS HIS D . n D 1 51 PRO 51 180 180 PRO PRO D . n D 1 52 MET 52 181 181 MET MET D . n D 1 53 ASP 53 182 182 ASP ASP D . n D 1 54 PHE 54 183 183 PHE PHE D . n D 1 55 GLY 55 184 184 GLY GLY D . n D 1 56 THR 56 185 185 THR THR D . n D 1 57 MET 57 186 186 MET MET D . n D 1 58 LYS 58 187 187 LYS LYS D . n D 1 59 ASP 59 188 188 ASP ASP D . n D 1 60 LYS 60 189 189 LYS LYS D . n D 1 61 ILE 61 190 190 ILE ILE D . n D 1 62 VAL 62 191 191 VAL VAL D . n D 1 63 ALA 63 192 192 ALA ALA D . n D 1 64 ASN 64 193 193 ASN ASN D . n D 1 65 GLU 65 194 194 GLU GLU D . n D 1 66 TYR 66 195 195 TYR TYR D . n D 1 67 LYS 67 196 196 LYS LYS D . n D 1 68 SER 68 197 197 SER SER D . n D 1 69 VAL 69 198 198 VAL VAL D . n D 1 70 THR 70 199 199 THR THR D . n D 1 71 GLU 71 200 200 GLU GLU D . n D 1 72 PHE 72 201 201 PHE PHE D . n D 1 73 LYS 73 202 202 LYS LYS D . n D 1 74 ALA 74 203 203 ALA ALA D . n D 1 75 ASP 75 204 204 ASP ASP D . n D 1 76 PHE 76 205 205 PHE PHE D . n D 1 77 LYS 77 206 206 LYS LYS D . n D 1 78 LEU 78 207 207 LEU LEU D . n D 1 79 MET 79 208 208 MET MET D . n D 1 80 CYS 80 209 209 CYS CYS D . n D 1 81 ASP 81 210 210 ASP ASP D . n D 1 82 ASN 82 211 211 ASN ASN D . n D 1 83 ALA 83 212 212 ALA ALA D . n D 1 84 MET 84 213 213 MET MET D . n D 1 85 THR 85 214 214 THR THR D . n D 1 86 TYR 86 215 215 TYR TYR D . n D 1 87 ASN 87 216 216 ASN ASN D . n D 1 88 ARG 88 217 217 ARG ARG D . n D 1 89 PRO 89 218 218 PRO PRO D . n D 1 90 ASP 90 219 219 ASP ASP D . n D 1 91 THR 91 220 220 THR THR D . n D 1 92 VAL 92 221 221 VAL VAL D . n D 1 93 TYR 93 222 222 TYR TYR D . n D 1 94 TYR 94 223 223 TYR TYR D . n D 1 95 LYS 95 224 224 LYS LYS D . n D 1 96 LEU 96 225 225 LEU LEU D . n D 1 97 ALA 97 226 226 ALA ALA D . n D 1 98 LYS 98 227 227 LYS LYS D . n D 1 99 LYS 99 228 228 LYS LYS D . n D 1 100 ILE 100 229 229 ILE ILE D . n D 1 101 LEU 101 230 230 LEU LEU D . n D 1 102 HIS 102 231 231 HIS HIS D . n D 1 103 ALA 103 232 232 ALA ALA D . n D 1 104 GLY 104 233 233 GLY GLY D . n D 1 105 PHE 105 234 234 PHE PHE D . n D 1 106 LYS 106 235 235 LYS LYS D . n D 1 107 MET 107 236 236 MET MET D . n D 1 108 MET 108 237 237 MET MET D . n D 1 109 SER 109 238 238 SER SER D . n D 1 110 LYS 110 239 239 LYS LYS D . n D 1 111 GLN 111 240 240 GLN GLN D . n D 1 112 ALA 112 241 241 ALA ALA D . n D 1 113 ALA 113 242 242 ALA ALA D . n D 1 114 LEU 114 243 243 LEU LEU D . n D 1 115 LEU 115 244 244 LEU LEU D . n D 1 116 GLY 116 245 245 GLY GLY D . n D 1 117 ASN 117 246 ? ? ? D . n D 1 118 GLU 118 247 ? ? ? D . n D 1 119 ASP 119 248 ? ? ? D . n D 1 120 THR 120 249 ? ? ? D . n D 1 121 ALA 121 250 ? ? ? D . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code E 2 7P7 1 4000 4000 7P7 ZYX A . F 2 7P7 1 4000 4000 7P7 ZYX B . G 2 7P7 1 4000 4000 7P7 ZYX C . H 2 7P7 1 4000 4000 7P7 ZYX D . I 3 HOH 1 4101 27 HOH HOH A . I 3 HOH 2 4102 4 HOH HOH A . I 3 HOH 3 4103 22 HOH HOH A . I 3 HOH 4 4104 21 HOH HOH A . I 3 HOH 5 4105 24 HOH HOH A . I 3 HOH 6 4106 20 HOH HOH A . I 3 HOH 7 4107 11 HOH HOH A . I 3 HOH 8 4108 13 HOH HOH A . I 3 HOH 9 4109 34 HOH HOH A . I 3 HOH 10 4110 29 HOH HOH A . I 3 HOH 11 4111 8 HOH HOH A . J 3 HOH 1 4101 15 HOH HOH B . J 3 HOH 2 4102 33 HOH HOH B . J 3 HOH 3 4103 32 HOH HOH B . J 3 HOH 4 4104 31 HOH HOH B . J 3 HOH 5 4105 1 HOH HOH B . J 3 HOH 6 4106 5 HOH HOH B . J 3 HOH 7 4107 26 HOH HOH B . J 3 HOH 8 4108 17 HOH HOH B . J 3 HOH 9 4109 12 HOH HOH B . J 3 HOH 10 4110 23 HOH HOH B . J 3 HOH 11 4111 14 HOH HOH B . J 3 HOH 12 4112 7 HOH HOH B . J 3 HOH 13 4113 16 HOH HOH B . J 3 HOH 14 4114 18 HOH HOH B . J 3 HOH 15 4115 28 HOH HOH B . K 3 HOH 1 4101 38 HOH HOH C . K 3 HOH 2 4102 2 HOH HOH C . K 3 HOH 3 4103 9 HOH HOH C . K 3 HOH 4 4104 25 HOH HOH C . K 3 HOH 5 4105 10 HOH HOH C . K 3 HOH 6 4106 3 HOH HOH C . K 3 HOH 7 4107 39 HOH HOH C . K 3 HOH 8 4108 6 HOH HOH C . L 3 HOH 1 4101 35 HOH HOH D . L 3 HOH 2 4102 19 HOH HOH D . L 3 HOH 3 4103 30 HOH HOH D . L 3 HOH 4 4104 37 HOH HOH D . L 3 HOH 5 4105 36 HOH HOH D . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 author_defined_assembly ? monomeric 1 3 author_defined_assembly ? monomeric 1 4 author_defined_assembly ? monomeric 1 5 software_defined_assembly PISA tetrameric 4 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,E,I 2 1 B,F,J 3 1 C,G,K 4 1 D,H,L 5 1 A,B,C,D,E,F,G,H,I,J,K,L # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 5 'ABSA (A^2)' 5640 ? 5 MORE -33 ? 5 'SSA (A^2)' 23500 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-09-27 2 'Structure model' 1 1 2023-10-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model 5 2 'Structure model' struct_ncs_dom_lim # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id' 4 2 'Structure model' '_struct_ncs_dom_lim.beg_label_asym_id' 5 2 'Structure model' '_struct_ncs_dom_lim.beg_label_comp_id' 6 2 'Structure model' '_struct_ncs_dom_lim.beg_label_seq_id' 7 2 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id' 8 2 'Structure model' '_struct_ncs_dom_lim.end_label_asym_id' 9 2 'Structure model' '_struct_ncs_dom_lim.end_label_comp_id' 10 2 'Structure model' '_struct_ncs_dom_lim.end_label_seq_id' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined -34.7398 -12.2464 -13.4036 0.3420 0.6482 0.5577 -0.0295 0.0552 -0.0610 4.1825 7.1946 2.3108 -0.6565 -1.2231 0.9617 -0.4085 0.1736 -0.0203 -0.7465 0.0693 -1.4390 0.7162 0.2971 -0.1895 'X-RAY DIFFRACTION' 2 ? refined -46.6807 -1.8963 -4.8207 0.6402 0.8197 0.9542 0.0345 0.2216 0.0612 5.0305 6.6204 7.0608 -1.0195 4.7320 -5.0812 -0.5613 -0.4792 -0.2993 -0.5702 3.3244 0.1176 1.7776 -1.2388 -0.2761 'X-RAY DIFFRACTION' 3 ? refined -55.3671 -10.0984 -5.1239 0.4388 0.7245 0.7628 0.0377 0.0745 0.0020 3.6982 3.9807 2.0775 0.5969 0.4165 1.6031 -0.4107 -0.2300 0.2534 -0.6477 -1.0123 0.4785 1.0831 1.0531 -0.4383 'X-RAY DIFFRACTION' 4 ? refined -59.2843 -13.0572 -12.5796 0.4602 0.9128 0.7826 0.0253 0.0157 -0.0439 4.4551 4.1882 2.1009 -1.0166 -0.0007 1.4964 -0.6504 0.3032 0.2827 -0.5011 -0.4430 0.8587 -0.1914 0.1774 0.0670 'X-RAY DIFFRACTION' 5 ? refined -42.9146 -16.8361 -10.6438 0.3446 0.6534 0.7257 0.0153 0.1021 -0.0559 4.0866 3.3217 1.3136 -1.1882 0.7231 0.7718 -0.9507 1.0761 0.0571 -0.0702 -0.4704 0.8617 0.0816 0.1225 0.0779 'X-RAY DIFFRACTION' 6 ? refined -40.4284 -21.8477 -17.5283 1.0329 0.6400 0.6103 -0.0220 0.1214 -0.1765 1.8260 2.9366 2.9540 0.3567 2.1751 -0.6271 -0.4967 -0.4148 0.2322 -0.1707 -1.6735 -0.4075 0.7852 2.6817 1.3417 'X-RAY DIFFRACTION' 7 ? refined -49.5650 -9.6928 -18.5495 0.3635 0.8059 0.4725 0.0749 -0.0277 -0.1296 4.1789 4.3663 4.3550 0.3662 0.0611 -1.1890 -0.2610 0.3261 -0.1459 0.8810 -0.0850 0.2813 -0.2409 -0.3567 -0.2487 'X-RAY DIFFRACTION' 8 ? refined -45.2870 -0.8949 -18.3406 0.4173 0.7396 0.5745 0.0864 -0.0110 -0.0149 5.7203 2.1070 2.6046 0.7806 -5.0272 -0.6205 0.1069 0.4213 -0.3787 0.5799 1.0330 0.3739 -0.0660 -0.4290 -0.2639 'X-RAY DIFFRACTION' 9 ? refined -23.3695 -2.0151 -31.1853 0.6184 0.9277 0.7076 -0.0502 0.0398 -0.1118 1.3423 1.8981 3.4535 1.4601 0.5961 -0.0179 -0.7505 -0.6118 0.1077 -0.3300 0.4327 1.0732 -0.7291 -1.5335 0.4823 'X-RAY DIFFRACTION' 10 ? refined -20.3649 -8.9177 -11.2580 0.3405 0.7921 0.5241 0.0168 0.0665 -0.1226 5.6949 2.9629 3.3141 -2.1262 4.7452 -1.6218 -0.2061 0.4537 -0.1890 -1.4407 0.0183 -0.1042 0.2729 -0.1208 -1.0732 'X-RAY DIFFRACTION' 11 ? refined -8.2853 -7.7230 -13.8832 0.4063 0.7410 0.5961 -0.0422 0.0505 -0.1598 5.7713 2.0099 4.7522 -0.2693 2.0589 0.4603 -0.2482 0.0999 0.1275 -0.4996 0.2809 -0.8195 0.0540 0.0141 0.4775 'X-RAY DIFFRACTION' 12 ? refined -18.4173 -18.1436 -18.3278 0.4426 0.4327 0.4748 -0.0065 0.1060 -0.0549 5.2584 4.6278 4.4050 -1.8903 1.1561 0.0018 0.0512 -0.0063 0.0996 -0.1290 -0.5375 -0.2052 -0.1607 0.2621 0.0110 'X-RAY DIFFRACTION' 13 ? refined -32.7632 -17.8297 14.2690 0.4134 1.5251 0.9141 -0.0351 0.1137 0.2568 4.0038 5.3963 8.3916 2.3860 5.0624 3.8579 0.1728 1.0591 -0.4729 -0.3492 -1.1772 -1.4192 0.1325 0.2057 2.8862 'X-RAY DIFFRACTION' 14 ? refined -46.7473 -14.3561 4.6430 0.6084 1.0317 0.5449 -0.0405 -0.0113 0.0970 7.2682 6.0647 5.7442 -0.0049 -1.9523 -1.2227 0.6143 -1.0146 0.2958 0.4940 0.5926 -1.0274 -0.7378 -0.0503 -0.0205 'X-RAY DIFFRACTION' 15 ? refined -48.9000 -13.5399 15.4176 0.5792 1.0229 0.6365 0.0076 0.0657 0.1412 3.5830 2.1217 2.9701 -1.5674 0.1246 -0.1894 -0.4094 -0.0400 0.2530 -0.7899 -0.3267 0.3479 0.1005 0.0010 0.3056 'X-RAY DIFFRACTION' 16 ? refined -49.6587 -22.9760 12.7710 0.6830 0.9548 0.9240 -0.0683 0.0829 0.1734 6.8403 5.0293 2.3175 -4.7846 1.2996 -1.9321 0.3113 -0.2535 0.1937 -0.1310 -2.3830 0.8105 -0.7157 0.6099 0.7964 'X-RAY DIFFRACTION' 17 ? refined -41.2923 -28.0946 9.3122 0.6425 1.0593 1.3252 0.0182 0.0358 0.4033 3.9625 3.1704 4.6940 -2.4380 4.6744 -1.5237 0.3986 0.0123 -0.4299 -1.1554 -1.6403 -0.6791 -0.3797 0.2499 0.0754 'X-RAY DIFFRACTION' 18 ? refined -16.5717 -18.8329 9.5276 0.4367 1.5786 0.9706 0.0853 -0.0135 0.0882 2.1087 5.4190 4.6675 -2.4768 -1.8426 -0.5831 -0.6128 0.2414 -0.2746 -2.3387 -0.5911 0.6985 -0.7345 -0.0311 -0.0261 'X-RAY DIFFRACTION' 19 ? refined 4.9184 -16.9808 8.4059 0.7254 2.2579 0.9775 -0.2686 0.0017 0.0992 3.9396 1.6532 5.6705 1.8569 1.9455 -0.8034 1.3556 -1.2390 -0.6755 -1.3053 0.4452 0.7511 0.5215 0.6127 0.3801 'X-RAY DIFFRACTION' 20 ? refined -9.9467 -24.0468 7.4137 0.5507 1.9695 1.2945 0.0971 0.0696 0.2226 0.6389 1.8019 0.3553 0.7613 -0.4270 -0.9460 -0.6351 -0.2446 0.6416 0.1079 -0.1031 -0.6869 -0.4933 0.9984 0.7842 'X-RAY DIFFRACTION' 21 ? refined -9.8388 -25.1622 14.6376 0.4910 2.2729 1.3266 0.2378 -0.1195 0.4002 0.5637 2.8226 1.0385 -1.1005 0.3766 -1.5215 -1.1804 1.2820 -0.5696 -1.4779 -2.1766 0.9266 0.1248 1.9198 2.6496 'X-RAY DIFFRACTION' 22 ? refined -4.3568 -12.4038 20.1191 0.6829 2.3117 1.2399 0.0441 -0.0537 -0.4853 4.5085 5.4483 7.4292 -3.0281 1.3374 -2.0714 -1.2398 1.1230 0.6701 -1.5635 -0.4692 -1.3693 0.3904 0.1341 0.8160 'X-RAY DIFFRACTION' 23 ? refined -22.9152 -22.9696 23.1094 0.8780 2.0628 0.8260 0.1038 0.1374 0.4453 9.4774 1.5806 1.9113 -0.9419 1.4865 1.4543 0.5308 0.3970 -0.5891 -0.0975 -0.4463 0.2567 0.6612 -0.0630 1.3929 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 137 A 155 ;chain 'A' and (resid 137 through 155 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 156 A 160 ;chain 'A' and (resid 156 through 160 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 161 A 170 ;chain 'A' and (resid 161 through 170 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 4 4 A 171 A 182 ;chain 'A' and (resid 171 through 182 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 5 5 A 183 A 191 ;chain 'A' and (resid 183 through 191 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 6 6 A 192 A 197 ;chain 'A' and (resid 192 through 197 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 7 7 A 198 A 215 ;chain 'A' and (resid 198 through 215 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 8 8 A 216 A 244 ;chain 'A' and (resid 216 through 244 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 9 9 A 245 A 250 ;chain 'A' and (resid 245 through 250 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 10 10 B 137 B 165 ;chain 'B' and (resid 137 through 165 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 11 11 B 166 B 220 ;chain 'B' and (resid 166 through 220 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 12 12 B 221 B 247 ;chain 'B' and (resid 221 through 247 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 13 13 C 137 C 155 ;chain 'C' and (resid 137 through 155 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 14 14 C 156 C 165 ;chain 'C' and (resid 156 through 165 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 15 15 C 166 C 197 ;chain 'C' and (resid 166 through 197 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 16 16 C 198 C 220 ;chain 'C' and (resid 198 through 220 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 17 17 C 221 C 244 ;chain 'C' and (resid 221 through 244 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 18 18 D 137 D 167 ;chain 'D' and (resid 137 through 167 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 19 19 D 168 D 176 ;chain 'D' and (resid 168 through 176 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 20 20 D 177 D 191 ;chain 'D' and (resid 177 through 191 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 21 21 D 192 D 215 ;chain 'D' and (resid 192 through 215 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 22 22 D 216 D 231 ;chain 'D' and (resid 216 through 231 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 23 23 D 232 D 245 ;chain 'D' and (resid 232 through 245 ) ; ? ? ? ? ? # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.11.1_2575 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.5.27 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.20 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 5 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O D SER 174 ? ? O D HOH 4101 ? ? 1.88 2 1 OH A TYR 173 ? ? O A HOH 4101 ? ? 2.05 3 1 OH B TYR 173 ? ? O B HOH 4101 ? ? 2.10 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 B _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 4108 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 B _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 4110 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 12_554 _pdbx_validate_symm_contact.dist 1.88 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP B 219 ? ? -96.61 34.17 2 1 PHE D 234 ? ? -73.87 -70.57 3 1 LEU D 244 ? ? -174.73 104.27 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 137 ? CG ? A GLU 8 CG 2 1 Y 1 A GLU 137 ? CD ? A GLU 8 CD 3 1 Y 1 A GLU 137 ? OE1 ? A GLU 8 OE1 4 1 Y 1 A GLU 137 ? OE2 ? A GLU 8 OE2 5 1 Y 1 A LYS 178 ? CG ? A LYS 49 CG 6 1 Y 1 A LYS 178 ? CD ? A LYS 49 CD 7 1 Y 1 A LYS 178 ? CE ? A LYS 49 CE 8 1 Y 1 A LYS 178 ? NZ ? A LYS 49 NZ 9 1 Y 1 A LYS 196 ? CG ? A LYS 67 CG 10 1 Y 1 A LYS 196 ? CD ? A LYS 67 CD 11 1 Y 1 A LYS 196 ? CE ? A LYS 67 CE 12 1 Y 1 A LYS 196 ? NZ ? A LYS 67 NZ 13 1 Y 1 A ARG 217 ? CG ? A ARG 88 CG 14 1 Y 1 A ARG 217 ? CD ? A ARG 88 CD 15 1 Y 1 A ARG 217 ? NE ? A ARG 88 NE 16 1 Y 1 A ARG 217 ? CZ ? A ARG 88 CZ 17 1 Y 1 A ARG 217 ? NH1 ? A ARG 88 NH1 18 1 Y 1 A ARG 217 ? NH2 ? A ARG 88 NH2 19 1 Y 1 B GLU 137 ? CG ? B GLU 8 CG 20 1 Y 1 B GLU 137 ? CD ? B GLU 8 CD 21 1 Y 1 B GLU 137 ? OE1 ? B GLU 8 OE1 22 1 Y 1 B GLU 137 ? OE2 ? B GLU 8 OE2 23 1 Y 1 B LYS 178 ? CG ? B LYS 49 CG 24 1 Y 1 B LYS 178 ? CD ? B LYS 49 CD 25 1 Y 1 B LYS 178 ? CE ? B LYS 49 CE 26 1 Y 1 B LYS 178 ? NZ ? B LYS 49 NZ 27 1 Y 1 B LYS 196 ? CG ? B LYS 67 CG 28 1 Y 1 B LYS 196 ? CD ? B LYS 67 CD 29 1 Y 1 B LYS 196 ? CE ? B LYS 67 CE 30 1 Y 1 B LYS 196 ? NZ ? B LYS 67 NZ 31 1 Y 1 B ARG 217 ? CG ? B ARG 88 CG 32 1 Y 1 B ARG 217 ? CD ? B ARG 88 CD 33 1 Y 1 B ARG 217 ? NE ? B ARG 88 NE 34 1 Y 1 B ARG 217 ? CZ ? B ARG 88 CZ 35 1 Y 1 B ARG 217 ? NH1 ? B ARG 88 NH1 36 1 Y 1 B ARG 217 ? NH2 ? B ARG 88 NH2 37 1 Y 1 B GLU 247 ? CG ? B GLU 118 CG 38 1 Y 1 B GLU 247 ? CD ? B GLU 118 CD 39 1 Y 1 B GLU 247 ? OE1 ? B GLU 118 OE1 40 1 Y 1 B GLU 247 ? OE2 ? B GLU 118 OE2 41 1 Y 1 C GLU 137 ? CG ? C GLU 8 CG 42 1 Y 1 C GLU 137 ? CD ? C GLU 8 CD 43 1 Y 1 C GLU 137 ? OE1 ? C GLU 8 OE1 44 1 Y 1 C GLU 137 ? OE2 ? C GLU 8 OE2 45 1 Y 1 C LYS 178 ? CG ? C LYS 49 CG 46 1 Y 1 C LYS 178 ? CD ? C LYS 49 CD 47 1 Y 1 C LYS 178 ? CE ? C LYS 49 CE 48 1 Y 1 C LYS 178 ? NZ ? C LYS 49 NZ 49 1 Y 1 C LYS 196 ? CG ? C LYS 67 CG 50 1 Y 1 C LYS 196 ? CD ? C LYS 67 CD 51 1 Y 1 C LYS 196 ? CE ? C LYS 67 CE 52 1 Y 1 C LYS 196 ? NZ ? C LYS 67 NZ 53 1 Y 1 C ARG 217 ? CG ? C ARG 88 CG 54 1 Y 1 C ARG 217 ? CD ? C ARG 88 CD 55 1 Y 1 C ARG 217 ? NE ? C ARG 88 NE 56 1 Y 1 C ARG 217 ? CZ ? C ARG 88 CZ 57 1 Y 1 C ARG 217 ? NH1 ? C ARG 88 NH1 58 1 Y 1 C ARG 217 ? NH2 ? C ARG 88 NH2 59 1 Y 1 C LYS 227 ? CG ? C LYS 98 CG 60 1 Y 1 C LYS 227 ? CD ? C LYS 98 CD 61 1 Y 1 C LYS 227 ? CE ? C LYS 98 CE 62 1 Y 1 C LYS 227 ? NZ ? C LYS 98 NZ 63 1 Y 1 C LYS 228 ? CG ? C LYS 99 CG 64 1 Y 1 C LYS 228 ? CD ? C LYS 99 CD 65 1 Y 1 C LYS 228 ? CE ? C LYS 99 CE 66 1 Y 1 C LYS 228 ? NZ ? C LYS 99 NZ 67 1 Y 1 C HIS 231 ? CG ? C HIS 102 CG 68 1 Y 1 C HIS 231 ? ND1 ? C HIS 102 ND1 69 1 Y 1 C HIS 231 ? CD2 ? C HIS 102 CD2 70 1 Y 1 C HIS 231 ? CE1 ? C HIS 102 CE1 71 1 Y 1 C HIS 231 ? NE2 ? C HIS 102 NE2 72 1 Y 1 C LYS 235 ? CG ? C LYS 106 CG 73 1 Y 1 C LYS 235 ? CD ? C LYS 106 CD 74 1 Y 1 C LYS 235 ? CE ? C LYS 106 CE 75 1 Y 1 C LYS 235 ? NZ ? C LYS 106 NZ 76 1 Y 1 C LYS 239 ? CG ? C LYS 110 CG 77 1 Y 1 C LYS 239 ? CD ? C LYS 110 CD 78 1 Y 1 C LYS 239 ? CE ? C LYS 110 CE 79 1 Y 1 C LYS 239 ? NZ ? C LYS 110 NZ 80 1 Y 1 C LEU 243 ? CG ? C LEU 114 CG 81 1 Y 1 C LEU 243 ? CD1 ? C LEU 114 CD1 82 1 Y 1 C LEU 243 ? CD2 ? C LEU 114 CD2 83 1 Y 1 C LEU 244 ? CG ? C LEU 115 CG 84 1 Y 1 C LEU 244 ? CD1 ? C LEU 115 CD1 85 1 Y 1 C LEU 244 ? CD2 ? C LEU 115 CD2 86 1 Y 1 D GLU 137 ? CG ? D GLU 8 CG 87 1 Y 1 D GLU 137 ? CD ? D GLU 8 CD 88 1 Y 1 D GLU 137 ? OE1 ? D GLU 8 OE1 89 1 Y 1 D GLU 137 ? OE2 ? D GLU 8 OE2 90 1 Y 1 D LEU 145 ? CG ? D LEU 16 CG 91 1 Y 1 D LEU 145 ? CD1 ? D LEU 16 CD1 92 1 Y 1 D LEU 145 ? CD2 ? D LEU 16 CD2 93 1 Y 1 D GLU 146 ? CG ? D GLU 17 CG 94 1 Y 1 D GLU 146 ? CD ? D GLU 17 CD 95 1 Y 1 D GLU 146 ? OE1 ? D GLU 17 OE1 96 1 Y 1 D GLU 146 ? OE2 ? D GLU 17 OE2 97 1 Y 1 D ARG 154 ? CG ? D ARG 25 CG 98 1 Y 1 D ARG 154 ? CD ? D ARG 25 CD 99 1 Y 1 D ARG 154 ? NE ? D ARG 25 NE 100 1 Y 1 D ARG 154 ? CZ ? D ARG 25 CZ 101 1 Y 1 D ARG 154 ? NH1 ? D ARG 25 NH1 102 1 Y 1 D ARG 154 ? NH2 ? D ARG 25 NH2 103 1 Y 1 D LYS 155 ? CG ? D LYS 26 CG 104 1 Y 1 D LYS 155 ? CD ? D LYS 26 CD 105 1 Y 1 D LYS 155 ? CE ? D LYS 26 CE 106 1 Y 1 D LYS 155 ? NZ ? D LYS 26 NZ 107 1 Y 1 D MET 175 ? CG ? D MET 46 CG 108 1 Y 1 D MET 175 ? SD ? D MET 46 SD 109 1 Y 1 D MET 175 ? CE ? D MET 46 CE 110 1 Y 1 D ILE 176 ? CG1 ? D ILE 47 CG1 111 1 Y 1 D ILE 176 ? CG2 ? D ILE 47 CG2 112 1 Y 1 D ILE 176 ? CD1 ? D ILE 47 CD1 113 1 Y 1 D ILE 177 ? CG1 ? D ILE 48 CG1 114 1 Y 1 D ILE 177 ? CG2 ? D ILE 48 CG2 115 1 Y 1 D ILE 177 ? CD1 ? D ILE 48 CD1 116 1 Y 1 D LYS 178 ? CG ? D LYS 49 CG 117 1 Y 1 D LYS 178 ? CD ? D LYS 49 CD 118 1 Y 1 D LYS 178 ? CE ? D LYS 49 CE 119 1 Y 1 D LYS 178 ? NZ ? D LYS 49 NZ 120 1 Y 1 D LYS 187 ? CG ? D LYS 58 CG 121 1 Y 1 D LYS 187 ? CD ? D LYS 58 CD 122 1 Y 1 D LYS 187 ? CE ? D LYS 58 CE 123 1 Y 1 D LYS 187 ? NZ ? D LYS 58 NZ 124 1 Y 1 D LYS 189 ? CG ? D LYS 60 CG 125 1 Y 1 D LYS 189 ? CD ? D LYS 60 CD 126 1 Y 1 D LYS 189 ? CE ? D LYS 60 CE 127 1 Y 1 D LYS 189 ? NZ ? D LYS 60 NZ 128 1 Y 1 D ASN 193 ? CG ? D ASN 64 CG 129 1 Y 1 D ASN 193 ? OD1 ? D ASN 64 OD1 130 1 Y 1 D ASN 193 ? ND2 ? D ASN 64 ND2 131 1 Y 1 D GLU 194 ? CG ? D GLU 65 CG 132 1 Y 1 D GLU 194 ? CD ? D GLU 65 CD 133 1 Y 1 D GLU 194 ? OE1 ? D GLU 65 OE1 134 1 Y 1 D GLU 194 ? OE2 ? D GLU 65 OE2 135 1 Y 1 D LYS 196 ? CG ? D LYS 67 CG 136 1 Y 1 D LYS 196 ? CD ? D LYS 67 CD 137 1 Y 1 D LYS 196 ? CE ? D LYS 67 CE 138 1 Y 1 D LYS 196 ? NZ ? D LYS 67 NZ 139 1 Y 1 D THR 199 ? OG1 ? D THR 70 OG1 140 1 Y 1 D THR 199 ? CG2 ? D THR 70 CG2 141 1 Y 1 D LYS 202 ? CG ? D LYS 73 CG 142 1 Y 1 D LYS 202 ? CD ? D LYS 73 CD 143 1 Y 1 D LYS 202 ? CE ? D LYS 73 CE 144 1 Y 1 D LYS 202 ? NZ ? D LYS 73 NZ 145 1 Y 1 D LYS 206 ? CG ? D LYS 77 CG 146 1 Y 1 D LYS 206 ? CD ? D LYS 77 CD 147 1 Y 1 D LYS 206 ? CE ? D LYS 77 CE 148 1 Y 1 D LYS 206 ? NZ ? D LYS 77 NZ 149 1 Y 1 D LEU 207 ? CG ? D LEU 78 CG 150 1 Y 1 D LEU 207 ? CD1 ? D LEU 78 CD1 151 1 Y 1 D LEU 207 ? CD2 ? D LEU 78 CD2 152 1 Y 1 D ARG 217 ? CG ? D ARG 88 CG 153 1 Y 1 D ARG 217 ? CD ? D ARG 88 CD 154 1 Y 1 D ARG 217 ? NE ? D ARG 88 NE 155 1 Y 1 D ARG 217 ? CZ ? D ARG 88 CZ 156 1 Y 1 D ARG 217 ? NH1 ? D ARG 88 NH1 157 1 Y 1 D ARG 217 ? NH2 ? D ARG 88 NH2 158 1 Y 1 D ASP 219 ? CG ? D ASP 90 CG 159 1 Y 1 D ASP 219 ? OD1 ? D ASP 90 OD1 160 1 Y 1 D ASP 219 ? OD2 ? D ASP 90 OD2 161 1 Y 1 D VAL 221 ? CG1 ? D VAL 92 CG1 162 1 Y 1 D VAL 221 ? CG2 ? D VAL 92 CG2 163 1 Y 1 D LYS 224 ? CG ? D LYS 95 CG 164 1 Y 1 D LYS 224 ? CD ? D LYS 95 CD 165 1 Y 1 D LYS 224 ? CE ? D LYS 95 CE 166 1 Y 1 D LYS 224 ? NZ ? D LYS 95 NZ 167 1 Y 1 D LEU 225 ? CG ? D LEU 96 CG 168 1 Y 1 D LEU 225 ? CD1 ? D LEU 96 CD1 169 1 Y 1 D LEU 225 ? CD2 ? D LEU 96 CD2 170 1 Y 1 D LYS 227 ? CG ? D LYS 98 CG 171 1 Y 1 D LYS 227 ? CD ? D LYS 98 CD 172 1 Y 1 D LYS 227 ? CE ? D LYS 98 CE 173 1 Y 1 D LYS 227 ? NZ ? D LYS 98 NZ 174 1 Y 1 D LYS 228 ? CG ? D LYS 99 CG 175 1 Y 1 D LYS 228 ? CD ? D LYS 99 CD 176 1 Y 1 D LYS 228 ? CE ? D LYS 99 CE 177 1 Y 1 D LYS 228 ? NZ ? D LYS 99 NZ 178 1 Y 1 D HIS 231 ? CG ? D HIS 102 CG 179 1 Y 1 D HIS 231 ? ND1 ? D HIS 102 ND1 180 1 Y 1 D HIS 231 ? CD2 ? D HIS 102 CD2 181 1 Y 1 D HIS 231 ? CE1 ? D HIS 102 CE1 182 1 Y 1 D HIS 231 ? NE2 ? D HIS 102 NE2 183 1 Y 1 D LYS 235 ? CG ? D LYS 106 CG 184 1 Y 1 D LYS 235 ? CD ? D LYS 106 CD 185 1 Y 1 D LYS 235 ? CE ? D LYS 106 CE 186 1 Y 1 D LYS 235 ? NZ ? D LYS 106 NZ 187 1 Y 1 D LYS 239 ? CG ? D LYS 110 CG 188 1 Y 1 D LYS 239 ? CD ? D LYS 110 CD 189 1 Y 1 D LYS 239 ? CE ? D LYS 110 CE 190 1 Y 1 D LYS 239 ? NZ ? D LYS 110 NZ 191 1 Y 1 D LEU 243 ? CG ? D LEU 114 CG 192 1 Y 1 D LEU 243 ? CD1 ? D LEU 114 CD1 193 1 Y 1 D LEU 243 ? CD2 ? D LEU 114 CD2 194 1 Y 1 D LEU 244 ? CG ? D LEU 115 CG 195 1 Y 1 D LEU 244 ? CD1 ? D LEU 115 CD1 196 1 Y 1 D LEU 244 ? CD2 ? D LEU 115 CD2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 130 ? A GLY 1 2 1 Y 1 A PRO 131 ? A PRO 2 3 1 Y 1 A HIS 132 ? A HIS 3 4 1 Y 1 A MET 133 ? A MET 4 5 1 Y 1 A ALA 134 ? A ALA 5 6 1 Y 1 A GLU 135 ? A GLU 6 7 1 Y 1 A ASN 136 ? A ASN 7 8 1 Y 1 B GLY 130 ? B GLY 1 9 1 Y 1 B PRO 131 ? B PRO 2 10 1 Y 1 B HIS 132 ? B HIS 3 11 1 Y 1 B MET 133 ? B MET 4 12 1 Y 1 B ALA 134 ? B ALA 5 13 1 Y 1 B GLU 135 ? B GLU 6 14 1 Y 1 B ASN 136 ? B ASN 7 15 1 Y 1 B ASP 248 ? B ASP 119 16 1 Y 1 B THR 249 ? B THR 120 17 1 Y 1 B ALA 250 ? B ALA 121 18 1 Y 1 C GLY 130 ? C GLY 1 19 1 Y 1 C PRO 131 ? C PRO 2 20 1 Y 1 C HIS 132 ? C HIS 3 21 1 Y 1 C MET 133 ? C MET 4 22 1 Y 1 C ALA 134 ? C ALA 5 23 1 Y 1 C GLU 135 ? C GLU 6 24 1 Y 1 C ASN 136 ? C ASN 7 25 1 Y 1 C GLY 245 ? C GLY 116 26 1 Y 1 C ASN 246 ? C ASN 117 27 1 Y 1 C GLU 247 ? C GLU 118 28 1 Y 1 C ASP 248 ? C ASP 119 29 1 Y 1 C THR 249 ? C THR 120 30 1 Y 1 C ALA 250 ? C ALA 121 31 1 Y 1 D GLY 130 ? D GLY 1 32 1 Y 1 D PRO 131 ? D PRO 2 33 1 Y 1 D HIS 132 ? D HIS 3 34 1 Y 1 D MET 133 ? D MET 4 35 1 Y 1 D ALA 134 ? D ALA 5 36 1 Y 1 D GLU 135 ? D GLU 6 37 1 Y 1 D ASN 136 ? D ASN 7 38 1 Y 1 D ASN 246 ? D ASN 117 39 1 Y 1 D GLU 247 ? D GLU 118 40 1 Y 1 D ASP 248 ? D ASP 119 41 1 Y 1 D THR 249 ? D THR 120 42 1 Y 1 D ALA 250 ? D ALA 121 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 7P7 C1 C Y N 1 7P7 C2 C Y N 2 7P7 C3 C Y N 3 7P7 C4 C N N 4 7P7 C5 C N N 5 7P7 C6 C N N 6 7P7 S S Y N 7 7P7 O1 O N N 8 7P7 O2 O N N 9 7P7 N1 N N N 10 7P7 C7 C N N 11 7P7 C8 C N N 12 7P7 N2 N N N 13 7P7 N N N N 14 7P7 C C N N 15 7P7 O O N N 16 7P7 C10 C Y N 17 7P7 C11 C N N 18 7P7 C12 C Y N 19 7P7 C13 C Y N 20 7P7 C14 C Y N 21 7P7 C15 C N N 22 7P7 C16 C Y N 23 7P7 C17 C N N 24 7P7 C18 C N N 25 7P7 C19 C N N 26 7P7 C20 C N N 27 7P7 C21 C N N 28 7P7 C22 C N N 29 7P7 C23 C N N 30 7P7 C24 C N N 31 7P7 C25 C Y N 32 7P7 C26 C Y N 33 7P7 C27 C Y N 34 7P7 C28 C Y N 35 7P7 C29 C Y N 36 7P7 C30 C N N 37 7P7 C31 C N S 38 7P7 C32 C N N 39 7P7 C33 C N N 40 7P7 C34 C N N 41 7P7 C35 C N N 42 7P7 C36 C Y N 43 7P7 C37 C N N 44 7P7 C38 C Y N 45 7P7 C39 C Y N 46 7P7 C40 C N N 47 7P7 C41 C N N 48 7P7 C9 C N N 49 7P7 N3 N N N 50 7P7 N4 N N N 51 7P7 N5 N N N 52 7P7 O10 O N N 53 7P7 O3 O N N 54 7P7 O4 O N N 55 7P7 O5 O N N 56 7P7 O6 O N N 57 7P7 O7 O N N 58 7P7 O8 O N N 59 7P7 O9 O N N 60 7P7 S1 S N N 61 7P7 H1 H N N 62 7P7 H2 H N N 63 7P7 H3 H N N 64 7P7 H4 H N N 65 7P7 H5 H N N 66 7P7 H6 H N N 67 7P7 H7 H N N 68 7P7 H8 H N N 69 7P7 H9 H N N 70 7P7 H10 H N N 71 7P7 H11 H N N 72 7P7 H12 H N N 73 7P7 H13 H N N 74 7P7 H14 H N N 75 7P7 H15 H N N 76 7P7 H16 H N N 77 7P7 H17 H N N 78 7P7 H18 H N N 79 7P7 H19 H N N 80 7P7 H20 H N N 81 7P7 H21 H N N 82 7P7 H22 H N N 83 7P7 H23 H N N 84 7P7 H24 H N N 85 7P7 H25 H N N 86 7P7 H26 H N N 87 7P7 H27 H N N 88 7P7 H28 H N N 89 7P7 H29 H N N 90 7P7 H30 H N N 91 7P7 H31 H N N 92 7P7 H32 H N N 93 7P7 H33 H N N 94 7P7 H34 H N N 95 7P7 H35 H N N 96 7P7 H36 H N N 97 7P7 H37 H N N 98 7P7 H38 H N N 99 7P7 H39 H N N 100 7P7 H40 H N N 101 7P7 H41 H N N 102 7P7 H42 H N N 103 7P7 H43 H N N 104 7P7 H44 H N N 105 7P7 H45 H N N 106 7P7 H46 H N N 107 ALA N N N N 108 ALA CA C N S 109 ALA C C N N 110 ALA O O N N 111 ALA CB C N N 112 ALA OXT O N N 113 ALA H H N N 114 ALA H2 H N N 115 ALA HA H N N 116 ALA HB1 H N N 117 ALA HB2 H N N 118 ALA HB3 H N N 119 ALA HXT H N N 120 ARG N N N N 121 ARG CA C N S 122 ARG C C N N 123 ARG O O N N 124 ARG CB C N N 125 ARG CG C N N 126 ARG CD C N N 127 ARG NE N N N 128 ARG CZ C N N 129 ARG NH1 N N N 130 ARG NH2 N N N 131 ARG OXT O N N 132 ARG H H N N 133 ARG H2 H N N 134 ARG HA H N N 135 ARG HB2 H N N 136 ARG HB3 H N N 137 ARG HG2 H N N 138 ARG HG3 H N N 139 ARG HD2 H N N 140 ARG HD3 H N N 141 ARG HE H N N 142 ARG HH11 H N N 143 ARG HH12 H N N 144 ARG HH21 H N N 145 ARG HH22 H N N 146 ARG HXT H N N 147 ASN N N N N 148 ASN CA C N S 149 ASN C C N N 150 ASN O O N N 151 ASN CB C N N 152 ASN CG C N N 153 ASN OD1 O N N 154 ASN ND2 N N N 155 ASN OXT O N N 156 ASN H H N N 157 ASN H2 H N N 158 ASN HA H N N 159 ASN HB2 H N N 160 ASN HB3 H N N 161 ASN HD21 H N N 162 ASN HD22 H N N 163 ASN HXT H N N 164 ASP N N N N 165 ASP CA C N S 166 ASP C C N N 167 ASP O O N N 168 ASP CB C N N 169 ASP CG C N N 170 ASP OD1 O N N 171 ASP OD2 O N N 172 ASP OXT O N N 173 ASP H H N N 174 ASP H2 H N N 175 ASP HA H N N 176 ASP HB2 H N N 177 ASP HB3 H N N 178 ASP HD2 H N N 179 ASP HXT H N N 180 CYS N N N N 181 CYS CA C N R 182 CYS C C N N 183 CYS O O N N 184 CYS CB C N N 185 CYS SG S N N 186 CYS OXT O N N 187 CYS H H N N 188 CYS H2 H N N 189 CYS HA H N N 190 CYS HB2 H N N 191 CYS HB3 H N N 192 CYS HG H N N 193 CYS HXT H N N 194 GLN N N N N 195 GLN CA C N S 196 GLN C C N N 197 GLN O O N N 198 GLN CB C N N 199 GLN CG C N N 200 GLN CD C N N 201 GLN OE1 O N N 202 GLN NE2 N N N 203 GLN OXT O N N 204 GLN H H N N 205 GLN H2 H N N 206 GLN HA H N N 207 GLN HB2 H N N 208 GLN HB3 H N N 209 GLN HG2 H N N 210 GLN HG3 H N N 211 GLN HE21 H N N 212 GLN HE22 H N N 213 GLN HXT H N N 214 GLU N N N N 215 GLU CA C N S 216 GLU C C N N 217 GLU O O N N 218 GLU CB C N N 219 GLU CG C N N 220 GLU CD C N N 221 GLU OE1 O N N 222 GLU OE2 O N N 223 GLU OXT O N N 224 GLU H H N N 225 GLU H2 H N N 226 GLU HA H N N 227 GLU HB2 H N N 228 GLU HB3 H N N 229 GLU HG2 H N N 230 GLU HG3 H N N 231 GLU HE2 H N N 232 GLU HXT H N N 233 GLY N N N N 234 GLY CA C N N 235 GLY C C N N 236 GLY O O N N 237 GLY OXT O N N 238 GLY H H N N 239 GLY H2 H N N 240 GLY HA2 H N N 241 GLY HA3 H N N 242 GLY HXT H N N 243 HIS N N N N 244 HIS CA C N S 245 HIS C C N N 246 HIS O O N N 247 HIS CB C N N 248 HIS CG C Y N 249 HIS ND1 N Y N 250 HIS CD2 C Y N 251 HIS CE1 C Y N 252 HIS NE2 N Y N 253 HIS OXT O N N 254 HIS H H N N 255 HIS H2 H N N 256 HIS HA H N N 257 HIS HB2 H N N 258 HIS HB3 H N N 259 HIS HD1 H N N 260 HIS HD2 H N N 261 HIS HE1 H N N 262 HIS HE2 H N N 263 HIS HXT H N N 264 HOH O O N N 265 HOH H1 H N N 266 HOH H2 H N N 267 ILE N N N N 268 ILE CA C N S 269 ILE C C N N 270 ILE O O N N 271 ILE CB C N S 272 ILE CG1 C N N 273 ILE CG2 C N N 274 ILE CD1 C N N 275 ILE OXT O N N 276 ILE H H N N 277 ILE H2 H N N 278 ILE HA H N N 279 ILE HB H N N 280 ILE HG12 H N N 281 ILE HG13 H N N 282 ILE HG21 H N N 283 ILE HG22 H N N 284 ILE HG23 H N N 285 ILE HD11 H N N 286 ILE HD12 H N N 287 ILE HD13 H N N 288 ILE HXT H N N 289 LEU N N N N 290 LEU CA C N S 291 LEU C C N N 292 LEU O O N N 293 LEU CB C N N 294 LEU CG C N N 295 LEU CD1 C N N 296 LEU CD2 C N N 297 LEU OXT O N N 298 LEU H H N N 299 LEU H2 H N N 300 LEU HA H N N 301 LEU HB2 H N N 302 LEU HB3 H N N 303 LEU HG H N N 304 LEU HD11 H N N 305 LEU HD12 H N N 306 LEU HD13 H N N 307 LEU HD21 H N N 308 LEU HD22 H N N 309 LEU HD23 H N N 310 LEU HXT H N N 311 LYS N N N N 312 LYS CA C N S 313 LYS C C N N 314 LYS O O N N 315 LYS CB C N N 316 LYS CG C N N 317 LYS CD C N N 318 LYS CE C N N 319 LYS NZ N N N 320 LYS OXT O N N 321 LYS H H N N 322 LYS H2 H N N 323 LYS HA H N N 324 LYS HB2 H N N 325 LYS HB3 H N N 326 LYS HG2 H N N 327 LYS HG3 H N N 328 LYS HD2 H N N 329 LYS HD3 H N N 330 LYS HE2 H N N 331 LYS HE3 H N N 332 LYS HZ1 H N N 333 LYS HZ2 H N N 334 LYS HZ3 H N N 335 LYS HXT H N N 336 MET N N N N 337 MET CA C N S 338 MET C C N N 339 MET O O N N 340 MET CB C N N 341 MET CG C N N 342 MET SD S N N 343 MET CE C N N 344 MET OXT O N N 345 MET H H N N 346 MET H2 H N N 347 MET HA H N N 348 MET HB2 H N N 349 MET HB3 H N N 350 MET HG2 H N N 351 MET HG3 H N N 352 MET HE1 H N N 353 MET HE2 H N N 354 MET HE3 H N N 355 MET HXT H N N 356 PHE N N N N 357 PHE CA C N S 358 PHE C C N N 359 PHE O O N N 360 PHE CB C N N 361 PHE CG C Y N 362 PHE CD1 C Y N 363 PHE CD2 C Y N 364 PHE CE1 C Y N 365 PHE CE2 C Y N 366 PHE CZ C Y N 367 PHE OXT O N N 368 PHE H H N N 369 PHE H2 H N N 370 PHE HA H N N 371 PHE HB2 H N N 372 PHE HB3 H N N 373 PHE HD1 H N N 374 PHE HD2 H N N 375 PHE HE1 H N N 376 PHE HE2 H N N 377 PHE HZ H N N 378 PHE HXT H N N 379 PRO N N N N 380 PRO CA C N S 381 PRO C C N N 382 PRO O O N N 383 PRO CB C N N 384 PRO CG C N N 385 PRO CD C N N 386 PRO OXT O N N 387 PRO H H N N 388 PRO HA H N N 389 PRO HB2 H N N 390 PRO HB3 H N N 391 PRO HG2 H N N 392 PRO HG3 H N N 393 PRO HD2 H N N 394 PRO HD3 H N N 395 PRO HXT H N N 396 SER N N N N 397 SER CA C N S 398 SER C C N N 399 SER O O N N 400 SER CB C N N 401 SER OG O N N 402 SER OXT O N N 403 SER H H N N 404 SER H2 H N N 405 SER HA H N N 406 SER HB2 H N N 407 SER HB3 H N N 408 SER HG H N N 409 SER HXT H N N 410 THR N N N N 411 THR CA C N S 412 THR C C N N 413 THR O O N N 414 THR CB C N R 415 THR OG1 O N N 416 THR CG2 C N N 417 THR OXT O N N 418 THR H H N N 419 THR H2 H N N 420 THR HA H N N 421 THR HB H N N 422 THR HG1 H N N 423 THR HG21 H N N 424 THR HG22 H N N 425 THR HG23 H N N 426 THR HXT H N N 427 TYR N N N N 428 TYR CA C N S 429 TYR C C N N 430 TYR O O N N 431 TYR CB C N N 432 TYR CG C Y N 433 TYR CD1 C Y N 434 TYR CD2 C Y N 435 TYR CE1 C Y N 436 TYR CE2 C Y N 437 TYR CZ C Y N 438 TYR OH O N N 439 TYR OXT O N N 440 TYR H H N N 441 TYR H2 H N N 442 TYR HA H N N 443 TYR HB2 H N N 444 TYR HB3 H N N 445 TYR HD1 H N N 446 TYR HD2 H N N 447 TYR HE1 H N N 448 TYR HE2 H N N 449 TYR HH H N N 450 TYR HXT H N N 451 VAL N N N N 452 VAL CA C N S 453 VAL C C N N 454 VAL O O N N 455 VAL CB C N N 456 VAL CG1 C N N 457 VAL CG2 C N N 458 VAL OXT O N N 459 VAL H H N N 460 VAL H2 H N N 461 VAL HA H N N 462 VAL HB H N N 463 VAL HG11 H N N 464 VAL HG12 H N N 465 VAL HG13 H N N 466 VAL HG21 H N N 467 VAL HG22 H N N 468 VAL HG23 H N N 469 VAL HXT H N N 470 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 7P7 O1 S1 doub N N 1 7P7 O C doub N N 2 7P7 O2 S1 doub N N 3 7P7 S1 C8 sing N N 4 7P7 S1 C7 sing N N 5 7P7 C41 N5 sing N N 6 7P7 C8 C9 sing N N 7 7P7 C9 C5 sing N N 8 7P7 C N5 sing N N 9 7P7 C C1 sing N N 10 7P7 N5 C40 sing N N 11 7P7 C10 C1 sing Y N 12 7P7 C10 C3 doub Y N 13 7P7 C7 C6 sing N N 14 7P7 C1 C2 doub Y N 15 7P7 C6 C5 sing N N 16 7P7 C5 N sing N N 17 7P7 N C4 sing N N 18 7P7 C40 C11 doub N N 19 7P7 C3 C4 sing N N 20 7P7 C3 S sing Y N 21 7P7 C4 N1 doub N N 22 7P7 C2 C11 sing N N 23 7P7 C2 S sing Y N 24 7P7 C11 C12 sing N N 25 7P7 C12 C39 doub Y N 26 7P7 C12 C13 sing Y N 27 7P7 C39 C38 sing Y N 28 7P7 C13 C14 doub Y N 29 7P7 C38 C16 doub Y N 30 7P7 C14 C16 sing Y N 31 7P7 C14 O3 sing N N 32 7P7 C16 O4 sing N N 33 7P7 C15 O3 sing N N 34 7P7 O4 C17 sing N N 35 7P7 C17 C18 sing N N 36 7P7 C18 N2 sing N N 37 7P7 C18 O10 doub N N 38 7P7 N2 C19 sing N N 39 7P7 C19 C20 sing N N 40 7P7 C20 C21 sing N N 41 7P7 C22 C21 sing N N 42 7P7 C22 C23 sing N N 43 7P7 C24 C23 sing N N 44 7P7 C24 O5 sing N N 45 7P7 C26 C27 doub Y N 46 7P7 C26 C25 sing Y N 47 7P7 C27 C28 sing Y N 48 7P7 O5 C25 sing N N 49 7P7 C25 C36 doub Y N 50 7P7 C28 C29 doub Y N 51 7P7 C36 C29 sing Y N 52 7P7 C36 C37 sing N N 53 7P7 C29 C30 sing N N 54 7P7 C37 O9 doub N N 55 7P7 C37 N3 sing N N 56 7P7 O7 C32 doub N N 57 7P7 C30 N3 sing N N 58 7P7 C30 O8 doub N N 59 7P7 N3 C31 sing N N 60 7P7 C32 C31 sing N N 61 7P7 C32 N4 sing N N 62 7P7 C31 C35 sing N N 63 7P7 N4 C33 sing N N 64 7P7 C35 C34 sing N N 65 7P7 C33 C34 sing N N 66 7P7 C33 O6 doub N N 67 7P7 C5 H1 sing N N 68 7P7 C6 H2 sing N N 69 7P7 C6 H3 sing N N 70 7P7 N1 H4 sing N N 71 7P7 C7 H5 sing N N 72 7P7 C7 H6 sing N N 73 7P7 C8 H7 sing N N 74 7P7 C8 H8 sing N N 75 7P7 N2 H9 sing N N 76 7P7 N H10 sing N N 77 7P7 C10 H11 sing N N 78 7P7 C13 H12 sing N N 79 7P7 C15 H13 sing N N 80 7P7 C15 H14 sing N N 81 7P7 C15 H15 sing N N 82 7P7 C17 H16 sing N N 83 7P7 C17 H17 sing N N 84 7P7 C19 H18 sing N N 85 7P7 C19 H19 sing N N 86 7P7 C20 H20 sing N N 87 7P7 C20 H21 sing N N 88 7P7 C21 H22 sing N N 89 7P7 C21 H23 sing N N 90 7P7 C22 H24 sing N N 91 7P7 C22 H25 sing N N 92 7P7 C23 H26 sing N N 93 7P7 C23 H27 sing N N 94 7P7 C24 H28 sing N N 95 7P7 C24 H29 sing N N 96 7P7 C26 H30 sing N N 97 7P7 C27 H31 sing N N 98 7P7 C28 H32 sing N N 99 7P7 C31 H33 sing N N 100 7P7 C34 H34 sing N N 101 7P7 C34 H35 sing N N 102 7P7 C35 H36 sing N N 103 7P7 C35 H37 sing N N 104 7P7 C38 H38 sing N N 105 7P7 C39 H39 sing N N 106 7P7 C40 H40 sing N N 107 7P7 C41 H41 sing N N 108 7P7 C41 H42 sing N N 109 7P7 C41 H43 sing N N 110 7P7 C9 H44 sing N N 111 7P7 C9 H45 sing N N 112 7P7 N4 H46 sing N N 113 ALA N CA sing N N 114 ALA N H sing N N 115 ALA N H2 sing N N 116 ALA CA C sing N N 117 ALA CA CB sing N N 118 ALA CA HA sing N N 119 ALA C O doub N N 120 ALA C OXT sing N N 121 ALA CB HB1 sing N N 122 ALA CB HB2 sing N N 123 ALA CB HB3 sing N N 124 ALA OXT HXT sing N N 125 ARG N CA sing N N 126 ARG N H sing N N 127 ARG N H2 sing N N 128 ARG CA C sing N N 129 ARG CA CB sing N N 130 ARG CA HA sing N N 131 ARG C O doub N N 132 ARG C OXT sing N N 133 ARG CB CG sing N N 134 ARG CB HB2 sing N N 135 ARG CB HB3 sing N N 136 ARG CG CD sing N N 137 ARG CG HG2 sing N N 138 ARG CG HG3 sing N N 139 ARG CD NE sing N N 140 ARG CD HD2 sing N N 141 ARG CD HD3 sing N N 142 ARG NE CZ sing N N 143 ARG NE HE sing N N 144 ARG CZ NH1 sing N N 145 ARG CZ NH2 doub N N 146 ARG NH1 HH11 sing N N 147 ARG NH1 HH12 sing N N 148 ARG NH2 HH21 sing N N 149 ARG NH2 HH22 sing N N 150 ARG OXT HXT sing N N 151 ASN N CA sing N N 152 ASN N H sing N N 153 ASN N H2 sing N N 154 ASN CA C sing N N 155 ASN CA CB sing N N 156 ASN CA HA sing N N 157 ASN C O doub N N 158 ASN C OXT sing N N 159 ASN CB CG sing N N 160 ASN CB HB2 sing N N 161 ASN CB HB3 sing N N 162 ASN CG OD1 doub N N 163 ASN CG ND2 sing N N 164 ASN ND2 HD21 sing N N 165 ASN ND2 HD22 sing N N 166 ASN OXT HXT sing N N 167 ASP N CA sing N N 168 ASP N H sing N N 169 ASP N H2 sing N N 170 ASP CA C sing N N 171 ASP CA CB sing N N 172 ASP CA HA sing N N 173 ASP C O doub N N 174 ASP C OXT sing N N 175 ASP CB CG sing N N 176 ASP CB HB2 sing N N 177 ASP CB HB3 sing N N 178 ASP CG OD1 doub N N 179 ASP CG OD2 sing N N 180 ASP OD2 HD2 sing N N 181 ASP OXT HXT sing N N 182 CYS N CA sing N N 183 CYS N H sing N N 184 CYS N H2 sing N N 185 CYS CA C sing N N 186 CYS CA CB sing N N 187 CYS CA HA sing N N 188 CYS C O doub N N 189 CYS C OXT sing N N 190 CYS CB SG sing N N 191 CYS CB HB2 sing N N 192 CYS CB HB3 sing N N 193 CYS SG HG sing N N 194 CYS OXT HXT sing N N 195 GLN N CA sing N N 196 GLN N H sing N N 197 GLN N H2 sing N N 198 GLN CA C sing N N 199 GLN CA CB sing N N 200 GLN CA HA sing N N 201 GLN C O doub N N 202 GLN C OXT sing N N 203 GLN CB CG sing N N 204 GLN CB HB2 sing N N 205 GLN CB HB3 sing N N 206 GLN CG CD sing N N 207 GLN CG HG2 sing N N 208 GLN CG HG3 sing N N 209 GLN CD OE1 doub N N 210 GLN CD NE2 sing N N 211 GLN NE2 HE21 sing N N 212 GLN NE2 HE22 sing N N 213 GLN OXT HXT sing N N 214 GLU N CA sing N N 215 GLU N H sing N N 216 GLU N H2 sing N N 217 GLU CA C sing N N 218 GLU CA CB sing N N 219 GLU CA HA sing N N 220 GLU C O doub N N 221 GLU C OXT sing N N 222 GLU CB CG sing N N 223 GLU CB HB2 sing N N 224 GLU CB HB3 sing N N 225 GLU CG CD sing N N 226 GLU CG HG2 sing N N 227 GLU CG HG3 sing N N 228 GLU CD OE1 doub N N 229 GLU CD OE2 sing N N 230 GLU OE2 HE2 sing N N 231 GLU OXT HXT sing N N 232 GLY N CA sing N N 233 GLY N H sing N N 234 GLY N H2 sing N N 235 GLY CA C sing N N 236 GLY CA HA2 sing N N 237 GLY CA HA3 sing N N 238 GLY C O doub N N 239 GLY C OXT sing N N 240 GLY OXT HXT sing N N 241 HIS N CA sing N N 242 HIS N H sing N N 243 HIS N H2 sing N N 244 HIS CA C sing N N 245 HIS CA CB sing N N 246 HIS CA HA sing N N 247 HIS C O doub N N 248 HIS C OXT sing N N 249 HIS CB CG sing N N 250 HIS CB HB2 sing N N 251 HIS CB HB3 sing N N 252 HIS CG ND1 sing Y N 253 HIS CG CD2 doub Y N 254 HIS ND1 CE1 doub Y N 255 HIS ND1 HD1 sing N N 256 HIS CD2 NE2 sing Y N 257 HIS CD2 HD2 sing N N 258 HIS CE1 NE2 sing Y N 259 HIS CE1 HE1 sing N N 260 HIS NE2 HE2 sing N N 261 HIS OXT HXT sing N N 262 HOH O H1 sing N N 263 HOH O H2 sing N N 264 ILE N CA sing N N 265 ILE N H sing N N 266 ILE N H2 sing N N 267 ILE CA C sing N N 268 ILE CA CB sing N N 269 ILE CA HA sing N N 270 ILE C O doub N N 271 ILE C OXT sing N N 272 ILE CB CG1 sing N N 273 ILE CB CG2 sing N N 274 ILE CB HB sing N N 275 ILE CG1 CD1 sing N N 276 ILE CG1 HG12 sing N N 277 ILE CG1 HG13 sing N N 278 ILE CG2 HG21 sing N N 279 ILE CG2 HG22 sing N N 280 ILE CG2 HG23 sing N N 281 ILE CD1 HD11 sing N N 282 ILE CD1 HD12 sing N N 283 ILE CD1 HD13 sing N N 284 ILE OXT HXT sing N N 285 LEU N CA sing N N 286 LEU N H sing N N 287 LEU N H2 sing N N 288 LEU CA C sing N N 289 LEU CA CB sing N N 290 LEU CA HA sing N N 291 LEU C O doub N N 292 LEU C OXT sing N N 293 LEU CB CG sing N N 294 LEU CB HB2 sing N N 295 LEU CB HB3 sing N N 296 LEU CG CD1 sing N N 297 LEU CG CD2 sing N N 298 LEU CG HG sing N N 299 LEU CD1 HD11 sing N N 300 LEU CD1 HD12 sing N N 301 LEU CD1 HD13 sing N N 302 LEU CD2 HD21 sing N N 303 LEU CD2 HD22 sing N N 304 LEU CD2 HD23 sing N N 305 LEU OXT HXT sing N N 306 LYS N CA sing N N 307 LYS N H sing N N 308 LYS N H2 sing N N 309 LYS CA C sing N N 310 LYS CA CB sing N N 311 LYS CA HA sing N N 312 LYS C O doub N N 313 LYS C OXT sing N N 314 LYS CB CG sing N N 315 LYS CB HB2 sing N N 316 LYS CB HB3 sing N N 317 LYS CG CD sing N N 318 LYS CG HG2 sing N N 319 LYS CG HG3 sing N N 320 LYS CD CE sing N N 321 LYS CD HD2 sing N N 322 LYS CD HD3 sing N N 323 LYS CE NZ sing N N 324 LYS CE HE2 sing N N 325 LYS CE HE3 sing N N 326 LYS NZ HZ1 sing N N 327 LYS NZ HZ2 sing N N 328 LYS NZ HZ3 sing N N 329 LYS OXT HXT sing N N 330 MET N CA sing N N 331 MET N H sing N N 332 MET N H2 sing N N 333 MET CA C sing N N 334 MET CA CB sing N N 335 MET CA HA sing N N 336 MET C O doub N N 337 MET C OXT sing N N 338 MET CB CG sing N N 339 MET CB HB2 sing N N 340 MET CB HB3 sing N N 341 MET CG SD sing N N 342 MET CG HG2 sing N N 343 MET CG HG3 sing N N 344 MET SD CE sing N N 345 MET CE HE1 sing N N 346 MET CE HE2 sing N N 347 MET CE HE3 sing N N 348 MET OXT HXT sing N N 349 PHE N CA sing N N 350 PHE N H sing N N 351 PHE N H2 sing N N 352 PHE CA C sing N N 353 PHE CA CB sing N N 354 PHE CA HA sing N N 355 PHE C O doub N N 356 PHE C OXT sing N N 357 PHE CB CG sing N N 358 PHE CB HB2 sing N N 359 PHE CB HB3 sing N N 360 PHE CG CD1 doub Y N 361 PHE CG CD2 sing Y N 362 PHE CD1 CE1 sing Y N 363 PHE CD1 HD1 sing N N 364 PHE CD2 CE2 doub Y N 365 PHE CD2 HD2 sing N N 366 PHE CE1 CZ doub Y N 367 PHE CE1 HE1 sing N N 368 PHE CE2 CZ sing Y N 369 PHE CE2 HE2 sing N N 370 PHE CZ HZ sing N N 371 PHE OXT HXT sing N N 372 PRO N CA sing N N 373 PRO N CD sing N N 374 PRO N H sing N N 375 PRO CA C sing N N 376 PRO CA CB sing N N 377 PRO CA HA sing N N 378 PRO C O doub N N 379 PRO C OXT sing N N 380 PRO CB CG sing N N 381 PRO CB HB2 sing N N 382 PRO CB HB3 sing N N 383 PRO CG CD sing N N 384 PRO CG HG2 sing N N 385 PRO CG HG3 sing N N 386 PRO CD HD2 sing N N 387 PRO CD HD3 sing N N 388 PRO OXT HXT sing N N 389 SER N CA sing N N 390 SER N H sing N N 391 SER N H2 sing N N 392 SER CA C sing N N 393 SER CA CB sing N N 394 SER CA HA sing N N 395 SER C O doub N N 396 SER C OXT sing N N 397 SER CB OG sing N N 398 SER CB HB2 sing N N 399 SER CB HB3 sing N N 400 SER OG HG sing N N 401 SER OXT HXT sing N N 402 THR N CA sing N N 403 THR N H sing N N 404 THR N H2 sing N N 405 THR CA C sing N N 406 THR CA CB sing N N 407 THR CA HA sing N N 408 THR C O doub N N 409 THR C OXT sing N N 410 THR CB OG1 sing N N 411 THR CB CG2 sing N N 412 THR CB HB sing N N 413 THR OG1 HG1 sing N N 414 THR CG2 HG21 sing N N 415 THR CG2 HG22 sing N N 416 THR CG2 HG23 sing N N 417 THR OXT HXT sing N N 418 TYR N CA sing N N 419 TYR N H sing N N 420 TYR N H2 sing N N 421 TYR CA C sing N N 422 TYR CA CB sing N N 423 TYR CA HA sing N N 424 TYR C O doub N N 425 TYR C OXT sing N N 426 TYR CB CG sing N N 427 TYR CB HB2 sing N N 428 TYR CB HB3 sing N N 429 TYR CG CD1 doub Y N 430 TYR CG CD2 sing Y N 431 TYR CD1 CE1 sing Y N 432 TYR CD1 HD1 sing N N 433 TYR CD2 CE2 doub Y N 434 TYR CD2 HD2 sing N N 435 TYR CE1 CZ doub Y N 436 TYR CE1 HE1 sing N N 437 TYR CE2 CZ sing Y N 438 TYR CE2 HE2 sing N N 439 TYR CZ OH sing N N 440 TYR OH HH sing N N 441 TYR OXT HXT sing N N 442 VAL N CA sing N N 443 VAL N H sing N N 444 VAL N H2 sing N N 445 VAL CA C sing N N 446 VAL CA CB sing N N 447 VAL CA HA sing N N 448 VAL C O doub N N 449 VAL C OXT sing N N 450 VAL CB CG1 sing N N 451 VAL CB CG2 sing N N 452 VAL CB HB sing N N 453 VAL CG1 HG11 sing N N 454 VAL CG1 HG12 sing N N 455 VAL CG1 HG13 sing N N 456 VAL CG2 HG21 sing N N 457 VAL CG2 HG22 sing N N 458 VAL CG2 HG23 sing N N 459 VAL OXT HXT sing N N 460 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;N-[6-({2-[(3S)-2,6-dioxopiperidin-3-yl]-1,3-dioxo-2,3-dihydro-1H-isoindol-4-yl}oxy)hexyl]-2-(4-{2-[N-(1,1-dioxo-1lambda~6~-thian-4-yl)carbamimidoyl]-5-methyl-4-oxo-4,5-dihydrothieno[3,2-c]pyridin-7-yl}-2-methoxyphenoxy)acetamide ; 7P7 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4YYD _pdbx_initial_refinement_model.details ? #