data_5U4Z # _entry.id 5U4Z # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.321 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5U4Z WWPDB D_1000217820 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5U4Z _pdbx_database_status.recvd_initial_deposition_date 2016-12-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Soprano, A.S.' 1 'Giuseppe, P.O.' 2 'Nascimento, A.F.Z.' 3 'Benedetti, C.E.' 4 'Murakami, M.T.' 5 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of citrus MAF1 in space group P 31 2 1' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Soprano, A.S.' 1 ? primary 'Giuseppe, P.O.' 2 ? primary 'Nascimento, A.F.Z.' 3 ? primary 'Benedetti, C.E.' 4 ? primary 'Murakami, M.T.' 5 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 5U4Z _cell.details ? _cell.formula_units_Z ? _cell.length_a 86.106 _cell.length_a_esd ? _cell.length_b 86.106 _cell.length_b_esd ? _cell.length_c 182.167 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5U4Z _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Repressor of RNA polymerase III transcription' 31098.385 2 ? ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 3 water nat water 18.015 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)GSSHHHHHHSSGLVPRGSH(MSE)AS(MSE)TGGQQ(MSE)GRGSEFELRRP(MSE)KFLEYTPLDRINDFLDHL NLGERTIKGCLEAYSCKHTGTDKRLSISLEHEILDYLGKSLDTDSSSPAEFLLSRSSRKALIYLVLTLYH(MSE)YPDYD FSAVKAHQFFTEESWNTFKQIFETY(MSE)FEASKEWSETYGGSSLLETLYKALDEVVKLPECEIYSYNPDSDSDPFLEK GAIWSFNFFFYNRKLKRVVSFRFSCLSNLVAEGFLVNDSTYEEDGEIFDD(MSE)D(MSE) ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEFELRRPMKFLEYTPLDRINDFLDHLNLGERTIKGCLEAYSCKHTG TDKRLSISLEHEILDYLGKSLDTDSSSPAEFLLSRSSRKALIYLVLTLYHMYPDYDFSAVKAHQFFTEESWNTFKQIFET YMFEASKEWSETYGGSSLLETLYKALDEVVKLPECEIYSYNPDSDSDPFLEKGAIWSFNFFFYNRKLKRVVSFRFSCLSN LVAEGFLVNDSTYEEDGEIFDDMDM ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MSE n 1 22 ALA n 1 23 SER n 1 24 MSE n 1 25 THR n 1 26 GLY n 1 27 GLY n 1 28 GLN n 1 29 GLN n 1 30 MSE n 1 31 GLY n 1 32 ARG n 1 33 GLY n 1 34 SER n 1 35 GLU n 1 36 PHE n 1 37 GLU n 1 38 LEU n 1 39 ARG n 1 40 ARG n 1 41 PRO n 1 42 MSE n 1 43 LYS n 1 44 PHE n 1 45 LEU n 1 46 GLU n 1 47 TYR n 1 48 THR n 1 49 PRO n 1 50 LEU n 1 51 ASP n 1 52 ARG n 1 53 ILE n 1 54 ASN n 1 55 ASP n 1 56 PHE n 1 57 LEU n 1 58 ASP n 1 59 HIS n 1 60 LEU n 1 61 ASN n 1 62 LEU n 1 63 GLY n 1 64 GLU n 1 65 ARG n 1 66 THR n 1 67 ILE n 1 68 LYS n 1 69 GLY n 1 70 CYS n 1 71 LEU n 1 72 GLU n 1 73 ALA n 1 74 TYR n 1 75 SER n 1 76 CYS n 1 77 LYS n 1 78 HIS n 1 79 THR n 1 80 GLY n 1 81 THR n 1 82 ASP n 1 83 LYS n 1 84 ARG n 1 85 LEU n 1 86 SER n 1 87 ILE n 1 88 SER n 1 89 LEU n 1 90 GLU n 1 91 HIS n 1 92 GLU n 1 93 ILE n 1 94 LEU n 1 95 ASP n 1 96 TYR n 1 97 LEU n 1 98 GLY n 1 99 LYS n 1 100 SER n 1 101 LEU n 1 102 ASP n 1 103 THR n 1 104 ASP n 1 105 SER n 1 106 SER n 1 107 SER n 1 108 PRO n 1 109 ALA n 1 110 GLU n 1 111 PHE n 1 112 LEU n 1 113 LEU n 1 114 SER n 1 115 ARG n 1 116 SER n 1 117 SER n 1 118 ARG n 1 119 LYS n 1 120 ALA n 1 121 LEU n 1 122 ILE n 1 123 TYR n 1 124 LEU n 1 125 VAL n 1 126 LEU n 1 127 THR n 1 128 LEU n 1 129 TYR n 1 130 HIS n 1 131 MSE n 1 132 TYR n 1 133 PRO n 1 134 ASP n 1 135 TYR n 1 136 ASP n 1 137 PHE n 1 138 SER n 1 139 ALA n 1 140 VAL n 1 141 LYS n 1 142 ALA n 1 143 HIS n 1 144 GLN n 1 145 PHE n 1 146 PHE n 1 147 THR n 1 148 GLU n 1 149 GLU n 1 150 SER n 1 151 TRP n 1 152 ASN n 1 153 THR n 1 154 PHE n 1 155 LYS n 1 156 GLN n 1 157 ILE n 1 158 PHE n 1 159 GLU n 1 160 THR n 1 161 TYR n 1 162 MSE n 1 163 PHE n 1 164 GLU n 1 165 ALA n 1 166 SER n 1 167 LYS n 1 168 GLU n 1 169 TRP n 1 170 SER n 1 171 GLU n 1 172 THR n 1 173 TYR n 1 174 GLY n 1 175 GLY n 1 176 SER n 1 177 SER n 1 178 LEU n 1 179 LEU n 1 180 GLU n 1 181 THR n 1 182 LEU n 1 183 TYR n 1 184 LYS n 1 185 ALA n 1 186 LEU n 1 187 ASP n 1 188 GLU n 1 189 VAL n 1 190 VAL n 1 191 LYS n 1 192 LEU n 1 193 PRO n 1 194 GLU n 1 195 CYS n 1 196 GLU n 1 197 ILE n 1 198 TYR n 1 199 SER n 1 200 TYR n 1 201 ASN n 1 202 PRO n 1 203 ASP n 1 204 SER n 1 205 ASP n 1 206 SER n 1 207 ASP n 1 208 PRO n 1 209 PHE n 1 210 LEU n 1 211 GLU n 1 212 LYS n 1 213 GLY n 1 214 ALA n 1 215 ILE n 1 216 TRP n 1 217 SER n 1 218 PHE n 1 219 ASN n 1 220 PHE n 1 221 PHE n 1 222 PHE n 1 223 TYR n 1 224 ASN n 1 225 ARG n 1 226 LYS n 1 227 LEU n 1 228 LYS n 1 229 ARG n 1 230 VAL n 1 231 VAL n 1 232 SER n 1 233 PHE n 1 234 ARG n 1 235 PHE n 1 236 SER n 1 237 CYS n 1 238 LEU n 1 239 SER n 1 240 ASN n 1 241 LEU n 1 242 VAL n 1 243 ALA n 1 244 GLU n 1 245 GLY n 1 246 PHE n 1 247 LEU n 1 248 VAL n 1 249 ASN n 1 250 ASP n 1 251 SER n 1 252 THR n 1 253 TYR n 1 254 GLU n 1 255 GLU n 1 256 ASP n 1 257 GLY n 1 258 GLU n 1 259 ILE n 1 260 PHE n 1 261 ASP n 1 262 ASP n 1 263 MSE n 1 264 ASP n 1 265 MSE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 265 _entity_src_gen.gene_src_common_name 'Sweet orange' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene MAF1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Citrus sinensis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2711 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code G9I821_CITSI _struct_ref.pdbx_db_accession G9I821 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KFLEYTPLDRINDFLDHLNLGERTIKGCLEAYSCKHTGTDKRLSISLEHEILDYLGKSLDTDSSSPAEFLLSRSSRKALI YLVLTLYHMYPDYDFSAVKAHQFFTEESWNTFKQIFETYMFEASKEWSETYGGSSLLETLYKALDEVVKLPECEIYSYNP DSDSDPFLEKGAIWSFNFFFYNRKLKRVVSFRFSCLSNLVAEGFLVNDSTYEEDGEIFDDMD ; _struct_ref.pdbx_align_begin 2 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5U4Z A 43 ? 264 ? G9I821 2 ? 223 ? 2 223 2 1 5U4Z B 43 ? 264 ? G9I821 2 ? 223 ? 2 223 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5U4Z MSE A 1 ? UNP G9I821 ? ? 'initiating methionine' -40 1 1 5U4Z GLY A 2 ? UNP G9I821 ? ? 'expression tag' -39 2 1 5U4Z SER A 3 ? UNP G9I821 ? ? 'expression tag' -38 3 1 5U4Z SER A 4 ? UNP G9I821 ? ? 'expression tag' -37 4 1 5U4Z HIS A 5 ? UNP G9I821 ? ? 'expression tag' -36 5 1 5U4Z HIS A 6 ? UNP G9I821 ? ? 'expression tag' -35 6 1 5U4Z HIS A 7 ? UNP G9I821 ? ? 'expression tag' -34 7 1 5U4Z HIS A 8 ? UNP G9I821 ? ? 'expression tag' -33 8 1 5U4Z HIS A 9 ? UNP G9I821 ? ? 'expression tag' -32 9 1 5U4Z HIS A 10 ? UNP G9I821 ? ? 'expression tag' -31 10 1 5U4Z SER A 11 ? UNP G9I821 ? ? 'expression tag' -30 11 1 5U4Z SER A 12 ? UNP G9I821 ? ? 'expression tag' -29 12 1 5U4Z GLY A 13 ? UNP G9I821 ? ? 'expression tag' -28 13 1 5U4Z LEU A 14 ? UNP G9I821 ? ? 'expression tag' -27 14 1 5U4Z VAL A 15 ? UNP G9I821 ? ? 'expression tag' -26 15 1 5U4Z PRO A 16 ? UNP G9I821 ? ? 'expression tag' -25 16 1 5U4Z ARG A 17 ? UNP G9I821 ? ? 'expression tag' -24 17 1 5U4Z GLY A 18 ? UNP G9I821 ? ? 'expression tag' -23 18 1 5U4Z SER A 19 ? UNP G9I821 ? ? 'expression tag' -22 19 1 5U4Z HIS A 20 ? UNP G9I821 ? ? 'expression tag' -21 20 1 5U4Z MSE A 21 ? UNP G9I821 ? ? 'expression tag' -20 21 1 5U4Z ALA A 22 ? UNP G9I821 ? ? 'expression tag' -19 22 1 5U4Z SER A 23 ? UNP G9I821 ? ? 'expression tag' -18 23 1 5U4Z MSE A 24 ? UNP G9I821 ? ? 'expression tag' -17 24 1 5U4Z THR A 25 ? UNP G9I821 ? ? 'expression tag' -16 25 1 5U4Z GLY A 26 ? UNP G9I821 ? ? 'expression tag' -15 26 1 5U4Z GLY A 27 ? UNP G9I821 ? ? 'expression tag' -14 27 1 5U4Z GLN A 28 ? UNP G9I821 ? ? 'expression tag' -13 28 1 5U4Z GLN A 29 ? UNP G9I821 ? ? 'expression tag' -12 29 1 5U4Z MSE A 30 ? UNP G9I821 ? ? 'expression tag' -11 30 1 5U4Z GLY A 31 ? UNP G9I821 ? ? 'expression tag' -10 31 1 5U4Z ARG A 32 ? UNP G9I821 ? ? 'expression tag' -9 32 1 5U4Z GLY A 33 ? UNP G9I821 ? ? 'expression tag' -8 33 1 5U4Z SER A 34 ? UNP G9I821 ? ? 'expression tag' -7 34 1 5U4Z GLU A 35 ? UNP G9I821 ? ? 'expression tag' -6 35 1 5U4Z PHE A 36 ? UNP G9I821 ? ? 'expression tag' -5 36 1 5U4Z GLU A 37 ? UNP G9I821 ? ? 'expression tag' -4 37 1 5U4Z LEU A 38 ? UNP G9I821 ? ? 'expression tag' -3 38 1 5U4Z ARG A 39 ? UNP G9I821 ? ? 'expression tag' -2 39 1 5U4Z ARG A 40 ? UNP G9I821 ? ? 'expression tag' -1 40 1 5U4Z PRO A 41 ? UNP G9I821 ? ? 'expression tag' 0 41 1 5U4Z MSE A 42 ? UNP G9I821 ? ? 'expression tag' 1 42 1 5U4Z MSE A 265 ? UNP G9I821 ? ? 'expression tag' 224 43 2 5U4Z MSE B 1 ? UNP G9I821 ? ? 'initiating methionine' -40 44 2 5U4Z GLY B 2 ? UNP G9I821 ? ? 'expression tag' -39 45 2 5U4Z SER B 3 ? UNP G9I821 ? ? 'expression tag' -38 46 2 5U4Z SER B 4 ? UNP G9I821 ? ? 'expression tag' -37 47 2 5U4Z HIS B 5 ? UNP G9I821 ? ? 'expression tag' -36 48 2 5U4Z HIS B 6 ? UNP G9I821 ? ? 'expression tag' -35 49 2 5U4Z HIS B 7 ? UNP G9I821 ? ? 'expression tag' -34 50 2 5U4Z HIS B 8 ? UNP G9I821 ? ? 'expression tag' -33 51 2 5U4Z HIS B 9 ? UNP G9I821 ? ? 'expression tag' -32 52 2 5U4Z HIS B 10 ? UNP G9I821 ? ? 'expression tag' -31 53 2 5U4Z SER B 11 ? UNP G9I821 ? ? 'expression tag' -30 54 2 5U4Z SER B 12 ? UNP G9I821 ? ? 'expression tag' -29 55 2 5U4Z GLY B 13 ? UNP G9I821 ? ? 'expression tag' -28 56 2 5U4Z LEU B 14 ? UNP G9I821 ? ? 'expression tag' -27 57 2 5U4Z VAL B 15 ? UNP G9I821 ? ? 'expression tag' -26 58 2 5U4Z PRO B 16 ? UNP G9I821 ? ? 'expression tag' -25 59 2 5U4Z ARG B 17 ? UNP G9I821 ? ? 'expression tag' -24 60 2 5U4Z GLY B 18 ? UNP G9I821 ? ? 'expression tag' -23 61 2 5U4Z SER B 19 ? UNP G9I821 ? ? 'expression tag' -22 62 2 5U4Z HIS B 20 ? UNP G9I821 ? ? 'expression tag' -21 63 2 5U4Z MSE B 21 ? UNP G9I821 ? ? 'expression tag' -20 64 2 5U4Z ALA B 22 ? UNP G9I821 ? ? 'expression tag' -19 65 2 5U4Z SER B 23 ? UNP G9I821 ? ? 'expression tag' -18 66 2 5U4Z MSE B 24 ? UNP G9I821 ? ? 'expression tag' -17 67 2 5U4Z THR B 25 ? UNP G9I821 ? ? 'expression tag' -16 68 2 5U4Z GLY B 26 ? UNP G9I821 ? ? 'expression tag' -15 69 2 5U4Z GLY B 27 ? UNP G9I821 ? ? 'expression tag' -14 70 2 5U4Z GLN B 28 ? UNP G9I821 ? ? 'expression tag' -13 71 2 5U4Z GLN B 29 ? UNP G9I821 ? ? 'expression tag' -12 72 2 5U4Z MSE B 30 ? UNP G9I821 ? ? 'expression tag' -11 73 2 5U4Z GLY B 31 ? UNP G9I821 ? ? 'expression tag' -10 74 2 5U4Z ARG B 32 ? UNP G9I821 ? ? 'expression tag' -9 75 2 5U4Z GLY B 33 ? UNP G9I821 ? ? 'expression tag' -8 76 2 5U4Z SER B 34 ? UNP G9I821 ? ? 'expression tag' -7 77 2 5U4Z GLU B 35 ? UNP G9I821 ? ? 'expression tag' -6 78 2 5U4Z PHE B 36 ? UNP G9I821 ? ? 'expression tag' -5 79 2 5U4Z GLU B 37 ? UNP G9I821 ? ? 'expression tag' -4 80 2 5U4Z LEU B 38 ? UNP G9I821 ? ? 'expression tag' -3 81 2 5U4Z ARG B 39 ? UNP G9I821 ? ? 'expression tag' -2 82 2 5U4Z ARG B 40 ? UNP G9I821 ? ? 'expression tag' -1 83 2 5U4Z PRO B 41 ? UNP G9I821 ? ? 'expression tag' 0 84 2 5U4Z MSE B 42 ? UNP G9I821 ? ? 'expression tag' 1 85 2 5U4Z MSE B 265 ? UNP G9I821 ? ? 'expression tag' 224 86 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5U4Z _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.13 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 60.76 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.6 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1 M ammonium di-hydrogen phosphate, 0.1 M Tris-sodium pH 5.6, 10% glycerol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-11-16 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALBA BEAMLINE XALOC' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.979 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline XALOC _diffrn_source.pdbx_synchrotron_site ALBA # _reflns.B_iso_Wilson_estimate 69.534 _reflns.entry_id 5U4Z _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.850 _reflns.d_resolution_low 47.086 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 35279 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I -3.000 _reflns.percent_possible_obs 100.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.4 _reflns.pdbx_Rmerge_I_obs 0.214 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.940 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.468 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.225 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 372748 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.850 3.020 ? 1.050 ? ? ? ? ? 99.900 ? ? ? ? 2.668 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 1 ? ? 3.020 3.230 ? 2.080 ? ? ? ? ? 99.900 ? ? ? ? 1.395 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 ? ? 3.230 3.490 ? 4.030 ? ? ? ? ? 100.000 ? ? ? ? 0.691 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 3 1 ? ? 3.490 3.820 ? 7.050 ? ? ? ? ? 100.000 ? ? ? ? 0.374 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 4 1 ? ? 3.820 4.270 ? 11.770 ? ? ? ? ? 100.000 ? ? ? ? 0.209 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 5 1 ? ? 4.270 4.920 ? 20.280 ? ? ? ? ? 100.000 ? ? ? ? 0.111 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 6 1 ? ? 4.920 6.010 ? 19.510 ? ? ? ? ? 100.000 ? ? ? ? 0.113 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 7 1 ? ? 6.010 8.430 ? 25.150 ? ? ? ? ? 100.000 ? ? ? ? 0.084 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 8 1 ? ? 8.430 47.086 ? 53.040 ? ? ? ? ? 99.400 ? ? ? ? 0.037 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 9 1 ? ? # _refine.aniso_B[1][1] 2.2000 _refine.aniso_B[1][2] 1.1000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 2.2000 _refine.aniso_B[2][3] -0.0000 _refine.aniso_B[3][3] -7.1400 _refine.B_iso_max 153.120 _refine.B_iso_mean 81.1650 _refine.B_iso_min 50.750 _refine.correlation_coeff_Fo_to_Fc 0.9560 _refine.correlation_coeff_Fo_to_Fc_free 0.9350 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5U4Z _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.8500 _refine.ls_d_res_low 20.0000 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 17882 _refine.ls_number_reflns_R_free 975 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.5800 _refine.ls_percent_reflns_R_free 5.2000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1994 _refine.ls_R_factor_R_free 0.2330 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1975 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free 0.2009 _refine.ls_wR_factor_R_work 0.1655 _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.4090 _refine.pdbx_overall_ESU_R_Free 0.2770 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 14.4930 _refine.overall_SU_ML 0.2580 _refine.overall_SU_R_Cruickshank_DPI 0.4087 _refine.overall_SU_R_free 0.2769 _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set 0.7799 _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.8500 _refine_hist.d_res_low 20.0000 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.number_atoms_solvent 1 _refine_hist.number_atoms_total 2995 _refine_hist.pdbx_number_residues_total 358 _refine_hist.pdbx_B_iso_mean_ligand 104.55 _refine_hist.pdbx_B_iso_mean_solvent 64.47 _refine_hist.pdbx_number_atoms_protein 2984 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.013 0.019 3071 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.003 0.020 2805 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.546 1.961 4149 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.025 3.000 6471 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 4.932 5.000 353 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 30.536 23.506 154 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 16.265 15.000 518 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 11.908 15.000 16 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.084 0.200 444 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 0.020 3385 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 755 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 4.415 7.790 1427 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 4.413 7.790 1426 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 6.776 11.687 1775 ? r_mcangle_it ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.8500 _refine_ls_shell.d_res_low 2.9220 _refine_ls_shell.number_reflns_all 1355 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 70 _refine_ls_shell.number_reflns_R_work 1285 _refine_ls_shell.percent_reflns_obs 100.0000 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.4360 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.3940 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5U4Z _struct.title 'Crystal structure of citrus MAF1 in space group P 31 2 1' _struct.pdbx_descriptor 'Repressor of RNA polymerase III transcription' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5U4Z _struct_keywords.text 'repressor of RNA polymerase III, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? E N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 48 ? LEU A 57 ? THR A 7 LEU A 16 1 ? 10 HELX_P HELX_P2 AA2 GLY A 80 ? LEU A 97 ? GLY A 39 LEU A 56 1 ? 18 HELX_P HELX_P3 AA3 SER A 114 ? SER A 116 ? SER A 73 SER A 75 5 ? 3 HELX_P HELX_P4 AA4 SER A 117 ? TYR A 132 ? SER A 76 TYR A 91 1 ? 16 HELX_P HELX_P5 AA5 SER A 138 ? PHE A 145 ? SER A 97 PHE A 104 1 ? 8 HELX_P HELX_P6 AA6 SER A 150 ? MSE A 162 ? SER A 109 MSE A 121 1 ? 13 HELX_P HELX_P7 AA7 MSE A 162 ? TYR A 173 ? MSE A 121 TYR A 132 1 ? 12 HELX_P HELX_P8 AA8 LEU A 178 ? VAL A 190 ? LEU A 137 VAL A 149 1 ? 13 HELX_P HELX_P9 AA9 LYS A 191 ? CYS A 195 ? LYS A 150 CYS A 154 5 ? 5 HELX_P HELX_P10 AB1 PRO B 49 ? ASP B 58 ? PRO B 8 ASP B 17 1 ? 10 HELX_P HELX_P11 AB2 GLY B 80 ? ASP B 95 ? GLY B 39 ASP B 54 1 ? 16 HELX_P HELX_P12 AB3 SER B 114 ? SER B 116 ? SER B 73 SER B 75 5 ? 3 HELX_P HELX_P13 AB4 SER B 117 ? TYR B 132 ? SER B 76 TYR B 91 1 ? 16 HELX_P HELX_P14 AB5 SER B 138 ? PHE B 145 ? SER B 97 PHE B 104 1 ? 8 HELX_P HELX_P15 AB6 SER B 150 ? TYR B 173 ? SER B 109 TYR B 132 1 ? 24 HELX_P HELX_P16 AB7 SER B 177 ? VAL B 190 ? SER B 136 VAL B 149 1 ? 14 HELX_P HELX_P17 AB8 LYS B 191 ? CYS B 195 ? LYS B 150 CYS B 154 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale both ? A HIS 130 C ? ? ? 1_555 A MSE 131 N ? ? A HIS 89 A MSE 90 1_555 ? ? ? ? ? ? ? 1.315 ? covale2 covale both ? A MSE 131 C ? ? ? 1_555 A TYR 132 N ? ? A MSE 90 A TYR 91 1_555 ? ? ? ? ? ? ? 1.323 ? covale3 covale both ? A TYR 161 C ? ? ? 1_555 A MSE 162 N ? ? A TYR 120 A MSE 121 1_555 ? ? ? ? ? ? ? 1.323 ? covale4 covale both ? A MSE 162 C ? ? ? 1_555 A PHE 163 N ? ? A MSE 121 A PHE 122 1_555 ? ? ? ? ? ? ? 1.327 ? covale5 covale both ? B HIS 130 C ? ? ? 1_555 B MSE 131 N ? ? B HIS 89 B MSE 90 1_555 ? ? ? ? ? ? ? 1.321 ? covale6 covale both ? B MSE 131 C ? ? ? 1_555 B TYR 132 N ? ? B MSE 90 B TYR 91 1_555 ? ? ? ? ? ? ? 1.329 ? covale7 covale both ? B TYR 161 C ? ? ? 1_555 B MSE 162 N ? ? B TYR 120 B MSE 121 1_555 ? ? ? ? ? ? ? 1.329 ? covale8 covale both ? B MSE 162 C ? ? ? 1_555 B PHE 163 N ? ? B MSE 121 B PHE 122 1_555 ? ? ? ? ? ? ? 1.337 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 60 ? ASN A 61 ? LEU A 19 ASN A 20 AA1 2 ARG A 65 ? SER A 75 ? ARG A 24 SER A 34 AA1 3 ARG A 229 ? SER A 239 ? ARG A 188 SER A 198 AA1 4 TRP A 216 ? ASN A 224 ? TRP A 175 ASN A 183 AA1 5 GLU A 196 ? TYR A 200 ? GLU A 155 TYR A 159 AA1 6 PHE A 146 ? GLU A 149 ? PHE A 105 GLU A 108 AA2 1 LEU B 60 ? ASN B 61 ? LEU B 19 ASN B 20 AA2 2 ARG B 65 ? SER B 75 ? ARG B 24 SER B 34 AA2 3 ARG B 229 ? SER B 239 ? ARG B 188 SER B 198 AA2 4 SER B 217 ? ASN B 224 ? SER B 176 ASN B 183 AA2 5 GLU B 196 ? TYR B 200 ? GLU B 155 TYR B 159 AA2 6 PHE B 146 ? GLU B 148 ? PHE B 105 GLU B 107 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 60 ? N LEU A 19 O ILE A 67 ? O ILE A 26 AA1 2 3 N THR A 66 ? N THR A 25 O LEU A 238 ? O LEU A 197 AA1 3 4 O PHE A 233 ? O PHE A 192 N PHE A 220 ? N PHE A 179 AA1 4 5 O PHE A 221 ? O PHE A 180 N TYR A 198 ? N TYR A 157 AA1 5 6 O ILE A 197 ? O ILE A 156 N GLU A 149 ? N GLU A 108 AA2 1 2 N LEU B 60 ? N LEU B 19 O ILE B 67 ? O ILE B 26 AA2 2 3 N THR B 66 ? N THR B 25 O LEU B 238 ? O LEU B 197 AA2 3 4 O PHE B 233 ? O PHE B 192 N PHE B 220 ? N PHE B 179 AA2 4 5 O ASN B 219 ? O ASN B 178 N TYR B 200 ? N TYR B 159 AA2 5 6 O SER B 199 ? O SER B 158 N THR B 147 ? N THR B 106 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 301 ? 6 'binding site for residue SO4 A 301' AC2 Software A SO4 302 ? 4 'binding site for residue SO4 A 302' AC3 Software B ASP 10 ? 7 'binding site for Ligand ASP B 10 bound to THR B 7' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 LEU A 97 ? LEU A 56 . ? 1_555 ? 2 AC1 6 ARG A 115 ? ARG A 74 . ? 1_555 ? 3 AC1 6 HOH E . ? HOH A 401 . ? 1_555 ? 4 AC1 6 SER B 150 ? SER B 109 . ? 1_555 ? 5 AC1 6 TRP B 151 ? TRP B 110 . ? 1_555 ? 6 AC1 6 ASN B 152 ? ASN B 111 . ? 1_555 ? 7 AC2 4 SER A 150 ? SER A 109 . ? 1_555 ? 8 AC2 4 TRP A 151 ? TRP A 110 . ? 1_555 ? 9 AC2 4 ASN A 152 ? ASN A 111 . ? 1_555 ? 10 AC2 4 ARG B 115 ? ARG B 74 . ? 1_555 ? 11 AC3 7 THR B 48 ? THR B 7 . ? 1_555 ? 12 AC3 7 PRO B 49 ? PRO B 8 . ? 1_555 ? 13 AC3 7 LEU B 50 ? LEU B 9 . ? 1_555 ? 14 AC3 7 ARG B 52 ? ARG B 11 . ? 1_555 ? 15 AC3 7 ILE B 53 ? ILE B 12 . ? 1_555 ? 16 AC3 7 ASN B 54 ? ASN B 13 . ? 1_555 ? 17 AC3 7 ASP B 55 ? ASP B 14 . ? 1_555 ? # _atom_sites.entry_id 5U4Z _atom_sites.fract_transf_matrix[1][1] 0.011614 _atom_sites.fract_transf_matrix[1][2] 0.006705 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013410 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005489 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 -40 ? ? ? A . n A 1 2 GLY 2 -39 ? ? ? A . n A 1 3 SER 3 -38 ? ? ? A . n A 1 4 SER 4 -37 ? ? ? A . n A 1 5 HIS 5 -36 ? ? ? A . n A 1 6 HIS 6 -35 ? ? ? A . n A 1 7 HIS 7 -34 ? ? ? A . n A 1 8 HIS 8 -33 ? ? ? A . n A 1 9 HIS 9 -32 ? ? ? A . n A 1 10 HIS 10 -31 ? ? ? A . n A 1 11 SER 11 -30 ? ? ? A . n A 1 12 SER 12 -29 ? ? ? A . n A 1 13 GLY 13 -28 ? ? ? A . n A 1 14 LEU 14 -27 ? ? ? A . n A 1 15 VAL 15 -26 ? ? ? A . n A 1 16 PRO 16 -25 ? ? ? A . n A 1 17 ARG 17 -24 ? ? ? A . n A 1 18 GLY 18 -23 ? ? ? A . n A 1 19 SER 19 -22 ? ? ? A . n A 1 20 HIS 20 -21 ? ? ? A . n A 1 21 MSE 21 -20 ? ? ? A . n A 1 22 ALA 22 -19 ? ? ? A . n A 1 23 SER 23 -18 ? ? ? A . n A 1 24 MSE 24 -17 ? ? ? A . n A 1 25 THR 25 -16 ? ? ? A . n A 1 26 GLY 26 -15 ? ? ? A . n A 1 27 GLY 27 -14 ? ? ? A . n A 1 28 GLN 28 -13 ? ? ? A . n A 1 29 GLN 29 -12 ? ? ? A . n A 1 30 MSE 30 -11 ? ? ? A . n A 1 31 GLY 31 -10 ? ? ? A . n A 1 32 ARG 32 -9 ? ? ? A . n A 1 33 GLY 33 -8 ? ? ? A . n A 1 34 SER 34 -7 ? ? ? A . n A 1 35 GLU 35 -6 ? ? ? A . n A 1 36 PHE 36 -5 ? ? ? A . n A 1 37 GLU 37 -4 ? ? ? A . n A 1 38 LEU 38 -3 ? ? ? A . n A 1 39 ARG 39 -2 ? ? ? A . n A 1 40 ARG 40 -1 ? ? ? A . n A 1 41 PRO 41 0 ? ? ? A . n A 1 42 MSE 42 1 ? ? ? A . n A 1 43 LYS 43 2 ? ? ? A . n A 1 44 PHE 44 3 ? ? ? A . n A 1 45 LEU 45 4 ? ? ? A . n A 1 46 GLU 46 5 ? ? ? A . n A 1 47 TYR 47 6 6 TYR TYR A . n A 1 48 THR 48 7 7 THR THR A . n A 1 49 PRO 49 8 8 PRO PRO A . n A 1 50 LEU 50 9 9 LEU LEU A . n A 1 51 ASP 51 10 10 ASP ASP A . n A 1 52 ARG 52 11 11 ARG ARG A . n A 1 53 ILE 53 12 12 ILE ILE A . n A 1 54 ASN 54 13 13 ASN ASN A . n A 1 55 ASP 55 14 14 ASP ASP A . n A 1 56 PHE 56 15 15 PHE PHE A . n A 1 57 LEU 57 16 16 LEU LEU A . n A 1 58 ASP 58 17 17 ASP ASP A . n A 1 59 HIS 59 18 18 HIS HIS A . n A 1 60 LEU 60 19 19 LEU LEU A . n A 1 61 ASN 61 20 20 ASN ASN A . n A 1 62 LEU 62 21 21 LEU LEU A . n A 1 63 GLY 63 22 22 GLY GLY A . n A 1 64 GLU 64 23 23 GLU GLU A . n A 1 65 ARG 65 24 24 ARG ARG A . n A 1 66 THR 66 25 25 THR THR A . n A 1 67 ILE 67 26 26 ILE ILE A . n A 1 68 LYS 68 27 27 LYS LYS A . n A 1 69 GLY 69 28 28 GLY GLY A . n A 1 70 CYS 70 29 29 CYS CYS A . n A 1 71 LEU 71 30 30 LEU LEU A . n A 1 72 GLU 72 31 31 GLU GLU A . n A 1 73 ALA 73 32 32 ALA ALA A . n A 1 74 TYR 74 33 33 TYR TYR A . n A 1 75 SER 75 34 34 SER SER A . n A 1 76 CYS 76 35 35 CYS CYS A . n A 1 77 LYS 77 36 36 LYS LYS A . n A 1 78 HIS 78 37 37 HIS HIS A . n A 1 79 THR 79 38 38 THR THR A . n A 1 80 GLY 80 39 39 GLY GLY A . n A 1 81 THR 81 40 40 THR THR A . n A 1 82 ASP 82 41 41 ASP ASP A . n A 1 83 LYS 83 42 42 LYS LYS A . n A 1 84 ARG 84 43 43 ARG ARG A . n A 1 85 LEU 85 44 44 LEU LEU A . n A 1 86 SER 86 45 45 SER SER A . n A 1 87 ILE 87 46 46 ILE ILE A . n A 1 88 SER 88 47 47 SER SER A . n A 1 89 LEU 89 48 48 LEU LEU A . n A 1 90 GLU 90 49 49 GLU GLU A . n A 1 91 HIS 91 50 50 HIS HIS A . n A 1 92 GLU 92 51 51 GLU GLU A . n A 1 93 ILE 93 52 52 ILE ILE A . n A 1 94 LEU 94 53 53 LEU LEU A . n A 1 95 ASP 95 54 54 ASP ASP A . n A 1 96 TYR 96 55 55 TYR TYR A . n A 1 97 LEU 97 56 56 LEU LEU A . n A 1 98 GLY 98 57 ? ? ? A . n A 1 99 LYS 99 58 ? ? ? A . n A 1 100 SER 100 59 ? ? ? A . n A 1 101 LEU 101 60 ? ? ? A . n A 1 102 ASP 102 61 ? ? ? A . n A 1 103 THR 103 62 ? ? ? A . n A 1 104 ASP 104 63 ? ? ? A . n A 1 105 SER 105 64 ? ? ? A . n A 1 106 SER 106 65 ? ? ? A . n A 1 107 SER 107 66 ? ? ? A . n A 1 108 PRO 108 67 ? ? ? A . n A 1 109 ALA 109 68 ? ? ? A . n A 1 110 GLU 110 69 ? ? ? A . n A 1 111 PHE 111 70 ? ? ? A . n A 1 112 LEU 112 71 71 LEU LEU A . n A 1 113 LEU 113 72 72 LEU LEU A . n A 1 114 SER 114 73 73 SER SER A . n A 1 115 ARG 115 74 74 ARG ARG A . n A 1 116 SER 116 75 75 SER SER A . n A 1 117 SER 117 76 76 SER SER A . n A 1 118 ARG 118 77 77 ARG ARG A . n A 1 119 LYS 119 78 78 LYS LYS A . n A 1 120 ALA 120 79 79 ALA ALA A . n A 1 121 LEU 121 80 80 LEU LEU A . n A 1 122 ILE 122 81 81 ILE ILE A . n A 1 123 TYR 123 82 82 TYR TYR A . n A 1 124 LEU 124 83 83 LEU LEU A . n A 1 125 VAL 125 84 84 VAL VAL A . n A 1 126 LEU 126 85 85 LEU LEU A . n A 1 127 THR 127 86 86 THR THR A . n A 1 128 LEU 128 87 87 LEU LEU A . n A 1 129 TYR 129 88 88 TYR TYR A . n A 1 130 HIS 130 89 89 HIS HIS A . n A 1 131 MSE 131 90 90 MSE MSE A . n A 1 132 TYR 132 91 91 TYR TYR A . n A 1 133 PRO 133 92 92 PRO PRO A . n A 1 134 ASP 134 93 93 ASP ASP A . n A 1 135 TYR 135 94 94 TYR TYR A . n A 1 136 ASP 136 95 95 ASP ASP A . n A 1 137 PHE 137 96 96 PHE PHE A . n A 1 138 SER 138 97 97 SER SER A . n A 1 139 ALA 139 98 98 ALA ALA A . n A 1 140 VAL 140 99 99 VAL VAL A . n A 1 141 LYS 141 100 100 LYS LYS A . n A 1 142 ALA 142 101 101 ALA ALA A . n A 1 143 HIS 143 102 102 HIS HIS A . n A 1 144 GLN 144 103 103 GLN GLN A . n A 1 145 PHE 145 104 104 PHE PHE A . n A 1 146 PHE 146 105 105 PHE PHE A . n A 1 147 THR 147 106 106 THR THR A . n A 1 148 GLU 148 107 107 GLU GLU A . n A 1 149 GLU 149 108 108 GLU GLU A . n A 1 150 SER 150 109 109 SER SER A . n A 1 151 TRP 151 110 110 TRP TRP A . n A 1 152 ASN 152 111 111 ASN ASN A . n A 1 153 THR 153 112 112 THR THR A . n A 1 154 PHE 154 113 113 PHE PHE A . n A 1 155 LYS 155 114 114 LYS LYS A . n A 1 156 GLN 156 115 115 GLN GLN A . n A 1 157 ILE 157 116 116 ILE ILE A . n A 1 158 PHE 158 117 117 PHE PHE A . n A 1 159 GLU 159 118 118 GLU GLU A . n A 1 160 THR 160 119 119 THR THR A . n A 1 161 TYR 161 120 120 TYR TYR A . n A 1 162 MSE 162 121 121 MSE MSE A . n A 1 163 PHE 163 122 122 PHE PHE A . n A 1 164 GLU 164 123 123 GLU GLU A . n A 1 165 ALA 165 124 124 ALA ALA A . n A 1 166 SER 166 125 125 SER SER A . n A 1 167 LYS 167 126 126 LYS LYS A . n A 1 168 GLU 168 127 127 GLU GLU A . n A 1 169 TRP 169 128 128 TRP TRP A . n A 1 170 SER 170 129 129 SER SER A . n A 1 171 GLU 171 130 130 GLU GLU A . n A 1 172 THR 172 131 131 THR THR A . n A 1 173 TYR 173 132 132 TYR TYR A . n A 1 174 GLY 174 133 133 GLY GLY A . n A 1 175 GLY 175 134 ? ? ? A . n A 1 176 SER 176 135 ? ? ? A . n A 1 177 SER 177 136 136 SER SER A . n A 1 178 LEU 178 137 137 LEU LEU A . n A 1 179 LEU 179 138 138 LEU LEU A . n A 1 180 GLU 180 139 139 GLU GLU A . n A 1 181 THR 181 140 140 THR THR A . n A 1 182 LEU 182 141 141 LEU LEU A . n A 1 183 TYR 183 142 142 TYR TYR A . n A 1 184 LYS 184 143 143 LYS LYS A . n A 1 185 ALA 185 144 144 ALA ALA A . n A 1 186 LEU 186 145 145 LEU LEU A . n A 1 187 ASP 187 146 146 ASP ASP A . n A 1 188 GLU 188 147 147 GLU GLU A . n A 1 189 VAL 189 148 148 VAL VAL A . n A 1 190 VAL 190 149 149 VAL VAL A . n A 1 191 LYS 191 150 150 LYS LYS A . n A 1 192 LEU 192 151 151 LEU LEU A . n A 1 193 PRO 193 152 152 PRO PRO A . n A 1 194 GLU 194 153 153 GLU GLU A . n A 1 195 CYS 195 154 154 CYS CYS A . n A 1 196 GLU 196 155 155 GLU GLU A . n A 1 197 ILE 197 156 156 ILE ILE A . n A 1 198 TYR 198 157 157 TYR TYR A . n A 1 199 SER 199 158 158 SER SER A . n A 1 200 TYR 200 159 159 TYR TYR A . n A 1 201 ASN 201 160 160 ASN ASN A . n A 1 202 PRO 202 161 161 PRO PRO A . n A 1 203 ASP 203 162 162 ASP ASP A . n A 1 204 SER 204 163 163 SER SER A . n A 1 205 ASP 205 164 164 ASP ASP A . n A 1 206 SER 206 165 165 SER SER A . n A 1 207 ASP 207 166 166 ASP ASP A . n A 1 208 PRO 208 167 167 PRO PRO A . n A 1 209 PHE 209 168 168 PHE PHE A . n A 1 210 LEU 210 169 169 LEU LEU A . n A 1 211 GLU 211 170 170 GLU GLU A . n A 1 212 LYS 212 171 171 LYS LYS A . n A 1 213 GLY 213 172 172 GLY GLY A . n A 1 214 ALA 214 173 173 ALA ALA A . n A 1 215 ILE 215 174 174 ILE ILE A . n A 1 216 TRP 216 175 175 TRP TRP A . n A 1 217 SER 217 176 176 SER SER A . n A 1 218 PHE 218 177 177 PHE PHE A . n A 1 219 ASN 219 178 178 ASN ASN A . n A 1 220 PHE 220 179 179 PHE PHE A . n A 1 221 PHE 221 180 180 PHE PHE A . n A 1 222 PHE 222 181 181 PHE PHE A . n A 1 223 TYR 223 182 182 TYR TYR A . n A 1 224 ASN 224 183 183 ASN ASN A . n A 1 225 ARG 225 184 184 ARG ARG A . n A 1 226 LYS 226 185 185 LYS LYS A . n A 1 227 LEU 227 186 186 LEU LEU A . n A 1 228 LYS 228 187 187 LYS LYS A . n A 1 229 ARG 229 188 188 ARG ARG A . n A 1 230 VAL 230 189 189 VAL VAL A . n A 1 231 VAL 231 190 190 VAL VAL A . n A 1 232 SER 232 191 191 SER SER A . n A 1 233 PHE 233 192 192 PHE PHE A . n A 1 234 ARG 234 193 193 ARG ARG A . n A 1 235 PHE 235 194 194 PHE PHE A . n A 1 236 SER 236 195 195 SER SER A . n A 1 237 CYS 237 196 196 CYS CYS A . n A 1 238 LEU 238 197 197 LEU LEU A . n A 1 239 SER 239 198 198 SER SER A . n A 1 240 ASN 240 199 199 ASN ASN A . n A 1 241 LEU 241 200 200 LEU LEU A . n A 1 242 VAL 242 201 201 VAL VAL A . n A 1 243 ALA 243 202 202 ALA ALA A . n A 1 244 GLU 244 203 ? ? ? A . n A 1 245 GLY 245 204 ? ? ? A . n A 1 246 PHE 246 205 ? ? ? A . n A 1 247 LEU 247 206 ? ? ? A . n A 1 248 VAL 248 207 ? ? ? A . n A 1 249 ASN 249 208 ? ? ? A . n A 1 250 ASP 250 209 ? ? ? A . n A 1 251 SER 251 210 ? ? ? A . n A 1 252 THR 252 211 ? ? ? A . n A 1 253 TYR 253 212 ? ? ? A . n A 1 254 GLU 254 213 ? ? ? A . n A 1 255 GLU 255 214 ? ? ? A . n A 1 256 ASP 256 215 ? ? ? A . n A 1 257 GLY 257 216 ? ? ? A . n A 1 258 GLU 258 217 ? ? ? A . n A 1 259 ILE 259 218 ? ? ? A . n A 1 260 PHE 260 219 ? ? ? A . n A 1 261 ASP 261 220 ? ? ? A . n A 1 262 ASP 262 221 ? ? ? A . n A 1 263 MSE 263 222 ? ? ? A . n A 1 264 ASP 264 223 ? ? ? A . n A 1 265 MSE 265 224 ? ? ? A . n B 1 1 MSE 1 -40 ? ? ? B . n B 1 2 GLY 2 -39 ? ? ? B . n B 1 3 SER 3 -38 ? ? ? B . n B 1 4 SER 4 -37 ? ? ? B . n B 1 5 HIS 5 -36 ? ? ? B . n B 1 6 HIS 6 -35 ? ? ? B . n B 1 7 HIS 7 -34 ? ? ? B . n B 1 8 HIS 8 -33 ? ? ? B . n B 1 9 HIS 9 -32 ? ? ? B . n B 1 10 HIS 10 -31 ? ? ? B . n B 1 11 SER 11 -30 ? ? ? B . n B 1 12 SER 12 -29 ? ? ? B . n B 1 13 GLY 13 -28 ? ? ? B . n B 1 14 LEU 14 -27 ? ? ? B . n B 1 15 VAL 15 -26 ? ? ? B . n B 1 16 PRO 16 -25 ? ? ? B . n B 1 17 ARG 17 -24 ? ? ? B . n B 1 18 GLY 18 -23 ? ? ? B . n B 1 19 SER 19 -22 ? ? ? B . n B 1 20 HIS 20 -21 ? ? ? B . n B 1 21 MSE 21 -20 ? ? ? B . n B 1 22 ALA 22 -19 ? ? ? B . n B 1 23 SER 23 -18 ? ? ? B . n B 1 24 MSE 24 -17 ? ? ? B . n B 1 25 THR 25 -16 ? ? ? B . n B 1 26 GLY 26 -15 ? ? ? B . n B 1 27 GLY 27 -14 ? ? ? B . n B 1 28 GLN 28 -13 ? ? ? B . n B 1 29 GLN 29 -12 ? ? ? B . n B 1 30 MSE 30 -11 ? ? ? B . n B 1 31 GLY 31 -10 ? ? ? B . n B 1 32 ARG 32 -9 ? ? ? B . n B 1 33 GLY 33 -8 ? ? ? B . n B 1 34 SER 34 -7 ? ? ? B . n B 1 35 GLU 35 -6 ? ? ? B . n B 1 36 PHE 36 -5 ? ? ? B . n B 1 37 GLU 37 -4 ? ? ? B . n B 1 38 LEU 38 -3 ? ? ? B . n B 1 39 ARG 39 -2 ? ? ? B . n B 1 40 ARG 40 -1 ? ? ? B . n B 1 41 PRO 41 0 ? ? ? B . n B 1 42 MSE 42 1 ? ? ? B . n B 1 43 LYS 43 2 ? ? ? B . n B 1 44 PHE 44 3 ? ? ? B . n B 1 45 LEU 45 4 ? ? ? B . n B 1 46 GLU 46 5 ? ? ? B . n B 1 47 TYR 47 6 ? ? ? B . n B 1 48 THR 48 7 7 THR THR B . n B 1 49 PRO 49 8 8 PRO PRO B . n B 1 50 LEU 50 9 9 LEU LEU B . n B 1 51 ASP 51 10 10 ASP ASP B . n B 1 52 ARG 52 11 11 ARG ARG B . n B 1 53 ILE 53 12 12 ILE ILE B . n B 1 54 ASN 54 13 13 ASN ASN B . n B 1 55 ASP 55 14 14 ASP ASP B . n B 1 56 PHE 56 15 15 PHE PHE B . n B 1 57 LEU 57 16 16 LEU LEU B . n B 1 58 ASP 58 17 17 ASP ASP B . n B 1 59 HIS 59 18 18 HIS HIS B . n B 1 60 LEU 60 19 19 LEU LEU B . n B 1 61 ASN 61 20 20 ASN ASN B . n B 1 62 LEU 62 21 21 LEU LEU B . n B 1 63 GLY 63 22 22 GLY GLY B . n B 1 64 GLU 64 23 23 GLU GLU B . n B 1 65 ARG 65 24 24 ARG ARG B . n B 1 66 THR 66 25 25 THR THR B . n B 1 67 ILE 67 26 26 ILE ILE B . n B 1 68 LYS 68 27 27 LYS LYS B . n B 1 69 GLY 69 28 28 GLY GLY B . n B 1 70 CYS 70 29 29 CYS CYS B . n B 1 71 LEU 71 30 30 LEU LEU B . n B 1 72 GLU 72 31 31 GLU GLU B . n B 1 73 ALA 73 32 32 ALA ALA B . n B 1 74 TYR 74 33 33 TYR TYR B . n B 1 75 SER 75 34 34 SER SER B . n B 1 76 CYS 76 35 35 CYS CYS B . n B 1 77 LYS 77 36 36 LYS LYS B . n B 1 78 HIS 78 37 37 HIS HIS B . n B 1 79 THR 79 38 38 THR THR B . n B 1 80 GLY 80 39 39 GLY GLY B . n B 1 81 THR 81 40 40 THR THR B . n B 1 82 ASP 82 41 41 ASP ASP B . n B 1 83 LYS 83 42 42 LYS LYS B . n B 1 84 ARG 84 43 43 ARG ARG B . n B 1 85 LEU 85 44 44 LEU LEU B . n B 1 86 SER 86 45 45 SER SER B . n B 1 87 ILE 87 46 46 ILE ILE B . n B 1 88 SER 88 47 47 SER SER B . n B 1 89 LEU 89 48 48 LEU LEU B . n B 1 90 GLU 90 49 49 GLU GLU B . n B 1 91 HIS 91 50 50 HIS HIS B . n B 1 92 GLU 92 51 51 GLU GLU B . n B 1 93 ILE 93 52 52 ILE ILE B . n B 1 94 LEU 94 53 53 LEU LEU B . n B 1 95 ASP 95 54 54 ASP ASP B . n B 1 96 TYR 96 55 ? ? ? B . n B 1 97 LEU 97 56 ? ? ? B . n B 1 98 GLY 98 57 ? ? ? B . n B 1 99 LYS 99 58 ? ? ? B . n B 1 100 SER 100 59 ? ? ? B . n B 1 101 LEU 101 60 ? ? ? B . n B 1 102 ASP 102 61 ? ? ? B . n B 1 103 THR 103 62 ? ? ? B . n B 1 104 ASP 104 63 ? ? ? B . n B 1 105 SER 105 64 ? ? ? B . n B 1 106 SER 106 65 ? ? ? B . n B 1 107 SER 107 66 ? ? ? B . n B 1 108 PRO 108 67 ? ? ? B . n B 1 109 ALA 109 68 ? ? ? B . n B 1 110 GLU 110 69 ? ? ? B . n B 1 111 PHE 111 70 ? ? ? B . n B 1 112 LEU 112 71 71 LEU LEU B . n B 1 113 LEU 113 72 72 LEU LEU B . n B 1 114 SER 114 73 73 SER SER B . n B 1 115 ARG 115 74 74 ARG ARG B . n B 1 116 SER 116 75 75 SER SER B . n B 1 117 SER 117 76 76 SER SER B . n B 1 118 ARG 118 77 77 ARG ARG B . n B 1 119 LYS 119 78 78 LYS LYS B . n B 1 120 ALA 120 79 79 ALA ALA B . n B 1 121 LEU 121 80 80 LEU LEU B . n B 1 122 ILE 122 81 81 ILE ILE B . n B 1 123 TYR 123 82 82 TYR TYR B . n B 1 124 LEU 124 83 83 LEU LEU B . n B 1 125 VAL 125 84 84 VAL VAL B . n B 1 126 LEU 126 85 85 LEU LEU B . n B 1 127 THR 127 86 86 THR THR B . n B 1 128 LEU 128 87 87 LEU LEU B . n B 1 129 TYR 129 88 88 TYR TYR B . n B 1 130 HIS 130 89 89 HIS HIS B . n B 1 131 MSE 131 90 90 MSE MSE B . n B 1 132 TYR 132 91 91 TYR TYR B . n B 1 133 PRO 133 92 92 PRO PRO B . n B 1 134 ASP 134 93 93 ASP ASP B . n B 1 135 TYR 135 94 94 TYR TYR B . n B 1 136 ASP 136 95 95 ASP ASP B . n B 1 137 PHE 137 96 96 PHE PHE B . n B 1 138 SER 138 97 97 SER SER B . n B 1 139 ALA 139 98 98 ALA ALA B . n B 1 140 VAL 140 99 99 VAL VAL B . n B 1 141 LYS 141 100 100 LYS LYS B . n B 1 142 ALA 142 101 101 ALA ALA B . n B 1 143 HIS 143 102 102 HIS HIS B . n B 1 144 GLN 144 103 103 GLN GLN B . n B 1 145 PHE 145 104 104 PHE PHE B . n B 1 146 PHE 146 105 105 PHE PHE B . n B 1 147 THR 147 106 106 THR THR B . n B 1 148 GLU 148 107 107 GLU GLU B . n B 1 149 GLU 149 108 108 GLU GLU B . n B 1 150 SER 150 109 109 SER SER B . n B 1 151 TRP 151 110 110 TRP TRP B . n B 1 152 ASN 152 111 111 ASN ASN B . n B 1 153 THR 153 112 112 THR THR B . n B 1 154 PHE 154 113 113 PHE PHE B . n B 1 155 LYS 155 114 114 LYS LYS B . n B 1 156 GLN 156 115 115 GLN GLN B . n B 1 157 ILE 157 116 116 ILE ILE B . n B 1 158 PHE 158 117 117 PHE PHE B . n B 1 159 GLU 159 118 118 GLU GLU B . n B 1 160 THR 160 119 119 THR THR B . n B 1 161 TYR 161 120 120 TYR TYR B . n B 1 162 MSE 162 121 121 MSE MSE B . n B 1 163 PHE 163 122 122 PHE PHE B . n B 1 164 GLU 164 123 123 GLU GLU B . n B 1 165 ALA 165 124 124 ALA ALA B . n B 1 166 SER 166 125 125 SER SER B . n B 1 167 LYS 167 126 126 LYS LYS B . n B 1 168 GLU 168 127 127 GLU GLU B . n B 1 169 TRP 169 128 128 TRP TRP B . n B 1 170 SER 170 129 129 SER SER B . n B 1 171 GLU 171 130 130 GLU GLU B . n B 1 172 THR 172 131 131 THR THR B . n B 1 173 TYR 173 132 132 TYR TYR B . n B 1 174 GLY 174 133 133 GLY GLY B . n B 1 175 GLY 175 134 134 GLY GLY B . n B 1 176 SER 176 135 135 SER SER B . n B 1 177 SER 177 136 136 SER SER B . n B 1 178 LEU 178 137 137 LEU LEU B . n B 1 179 LEU 179 138 138 LEU LEU B . n B 1 180 GLU 180 139 139 GLU GLU B . n B 1 181 THR 181 140 140 THR THR B . n B 1 182 LEU 182 141 141 LEU LEU B . n B 1 183 TYR 183 142 142 TYR TYR B . n B 1 184 LYS 184 143 143 LYS LYS B . n B 1 185 ALA 185 144 144 ALA ALA B . n B 1 186 LEU 186 145 145 LEU LEU B . n B 1 187 ASP 187 146 146 ASP ASP B . n B 1 188 GLU 188 147 147 GLU GLU B . n B 1 189 VAL 189 148 148 VAL VAL B . n B 1 190 VAL 190 149 149 VAL VAL B . n B 1 191 LYS 191 150 150 LYS LYS B . n B 1 192 LEU 192 151 151 LEU LEU B . n B 1 193 PRO 193 152 152 PRO PRO B . n B 1 194 GLU 194 153 153 GLU GLU B . n B 1 195 CYS 195 154 154 CYS CYS B . n B 1 196 GLU 196 155 155 GLU GLU B . n B 1 197 ILE 197 156 156 ILE ILE B . n B 1 198 TYR 198 157 157 TYR TYR B . n B 1 199 SER 199 158 158 SER SER B . n B 1 200 TYR 200 159 159 TYR TYR B . n B 1 201 ASN 201 160 160 ASN ASN B . n B 1 202 PRO 202 161 161 PRO PRO B . n B 1 203 ASP 203 162 162 ASP ASP B . n B 1 204 SER 204 163 163 SER SER B . n B 1 205 ASP 205 164 164 ASP ASP B . n B 1 206 SER 206 165 165 SER SER B . n B 1 207 ASP 207 166 166 ASP ASP B . n B 1 208 PRO 208 167 167 PRO PRO B . n B 1 209 PHE 209 168 168 PHE PHE B . n B 1 210 LEU 210 169 169 LEU LEU B . n B 1 211 GLU 211 170 170 GLU GLU B . n B 1 212 LYS 212 171 171 LYS LYS B . n B 1 213 GLY 213 172 172 GLY GLY B . n B 1 214 ALA 214 173 173 ALA ALA B . n B 1 215 ILE 215 174 174 ILE ILE B . n B 1 216 TRP 216 175 175 TRP TRP B . n B 1 217 SER 217 176 176 SER SER B . n B 1 218 PHE 218 177 177 PHE PHE B . n B 1 219 ASN 219 178 178 ASN ASN B . n B 1 220 PHE 220 179 179 PHE PHE B . n B 1 221 PHE 221 180 180 PHE PHE B . n B 1 222 PHE 222 181 181 PHE PHE B . n B 1 223 TYR 223 182 182 TYR TYR B . n B 1 224 ASN 224 183 183 ASN ASN B . n B 1 225 ARG 225 184 184 ARG ARG B . n B 1 226 LYS 226 185 185 LYS LYS B . n B 1 227 LEU 227 186 186 LEU LEU B . n B 1 228 LYS 228 187 187 LYS LYS B . n B 1 229 ARG 229 188 188 ARG ARG B . n B 1 230 VAL 230 189 189 VAL VAL B . n B 1 231 VAL 231 190 190 VAL VAL B . n B 1 232 SER 232 191 191 SER SER B . n B 1 233 PHE 233 192 192 PHE PHE B . n B 1 234 ARG 234 193 193 ARG ARG B . n B 1 235 PHE 235 194 194 PHE PHE B . n B 1 236 SER 236 195 195 SER SER B . n B 1 237 CYS 237 196 196 CYS CYS B . n B 1 238 LEU 238 197 197 LEU LEU B . n B 1 239 SER 239 198 198 SER SER B . n B 1 240 ASN 240 199 199 ASN ASN B . n B 1 241 LEU 241 200 ? ? ? B . n B 1 242 VAL 242 201 ? ? ? B . n B 1 243 ALA 243 202 ? ? ? B . n B 1 244 GLU 244 203 ? ? ? B . n B 1 245 GLY 245 204 ? ? ? B . n B 1 246 PHE 246 205 ? ? ? B . n B 1 247 LEU 247 206 ? ? ? B . n B 1 248 VAL 248 207 ? ? ? B . n B 1 249 ASN 249 208 ? ? ? B . n B 1 250 ASP 250 209 ? ? ? B . n B 1 251 SER 251 210 ? ? ? B . n B 1 252 THR 252 211 ? ? ? B . n B 1 253 TYR 253 212 ? ? ? B . n B 1 254 GLU 254 213 ? ? ? B . n B 1 255 GLU 255 214 ? ? ? B . n B 1 256 ASP 256 215 ? ? ? B . n B 1 257 GLY 257 216 ? ? ? B . n B 1 258 GLU 258 217 ? ? ? B . n B 1 259 ILE 259 218 ? ? ? B . n B 1 260 PHE 260 219 ? ? ? B . n B 1 261 ASP 261 220 ? ? ? B . n B 1 262 ASP 262 221 ? ? ? B . n B 1 263 MSE 263 222 ? ? ? B . n B 1 264 ASP 264 223 ? ? ? B . n B 1 265 MSE 265 224 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 SO4 1 301 1 SO4 SO4 A . D 2 SO4 1 302 2 SO4 SO4 A . E 3 HOH 1 401 1 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 131 A MSE 90 ? MET 'modified residue' 2 A MSE 162 A MSE 121 ? MET 'modified residue' 3 B MSE 131 B MSE 90 ? MET 'modified residue' 4 B MSE 162 B MSE 121 ? MET 'modified residue' # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA monomeric 1 2 author_and_software_defined_assembly PISA monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,C,D,E 2 1 B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-07-19 2 'Structure model' 1 1 2019-04-17 3 'Structure model' 1 2 2020-01-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Author supporting evidence' 3 2 'Structure model' 'Data collection' 4 2 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Author supporting evidence' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_audit_support 2 2 'Structure model' pdbx_validate_close_contact 3 2 'Structure model' struct_conn 4 3 'Structure model' pdbx_audit_support # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_audit_support.funding_organization' 2 3 'Structure model' '_pdbx_audit_support.funding_organization' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.20 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? SHELXDE ? ? ? . 5 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 CG2 B THR 7 ? ? OD2 B ASP 10 ? ? 1.44 2 1 OH B TYR 33 ? ? OD2 B ASP 41 ? ? 2.11 3 1 O A SER 129 ? ? O A TYR 132 ? ? 2.14 4 1 OD1 B ASN 20 ? ? ND2 B ASN 199 ? ? 2.19 5 1 OH A TYR 33 ? ? OD2 A ASP 41 ? ? 2.19 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 ASP _pdbx_validate_symm_contact.auth_seq_id_1 93 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 CG2 _pdbx_validate_symm_contact.auth_asym_id_2 B _pdbx_validate_symm_contact.auth_comp_id_2 THR _pdbx_validate_symm_contact.auth_seq_id_2 38 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 5_544 _pdbx_validate_symm_contact.dist 2.13 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 49 ? ? -38.17 -38.78 2 1 MSE A 121 ? ? -105.43 43.98 3 1 LYS A 150 ? ? -63.51 98.66 4 1 ASN A 199 ? ? -95.56 33.01 5 1 HIS B 18 ? ? 32.12 60.05 6 1 GLU B 23 ? ? 69.57 -9.82 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE -40 ? A MSE 1 2 1 Y 1 A GLY -39 ? A GLY 2 3 1 Y 1 A SER -38 ? A SER 3 4 1 Y 1 A SER -37 ? A SER 4 5 1 Y 1 A HIS -36 ? A HIS 5 6 1 Y 1 A HIS -35 ? A HIS 6 7 1 Y 1 A HIS -34 ? A HIS 7 8 1 Y 1 A HIS -33 ? A HIS 8 9 1 Y 1 A HIS -32 ? A HIS 9 10 1 Y 1 A HIS -31 ? A HIS 10 11 1 Y 1 A SER -30 ? A SER 11 12 1 Y 1 A SER -29 ? A SER 12 13 1 Y 1 A GLY -28 ? A GLY 13 14 1 Y 1 A LEU -27 ? A LEU 14 15 1 Y 1 A VAL -26 ? A VAL 15 16 1 Y 1 A PRO -25 ? A PRO 16 17 1 Y 1 A ARG -24 ? A ARG 17 18 1 Y 1 A GLY -23 ? A GLY 18 19 1 Y 1 A SER -22 ? A SER 19 20 1 Y 1 A HIS -21 ? A HIS 20 21 1 Y 1 A MSE -20 ? A MSE 21 22 1 Y 1 A ALA -19 ? A ALA 22 23 1 Y 1 A SER -18 ? A SER 23 24 1 Y 1 A MSE -17 ? A MSE 24 25 1 Y 1 A THR -16 ? A THR 25 26 1 Y 1 A GLY -15 ? A GLY 26 27 1 Y 1 A GLY -14 ? A GLY 27 28 1 Y 1 A GLN -13 ? A GLN 28 29 1 Y 1 A GLN -12 ? A GLN 29 30 1 Y 1 A MSE -11 ? A MSE 30 31 1 Y 1 A GLY -10 ? A GLY 31 32 1 Y 1 A ARG -9 ? A ARG 32 33 1 Y 1 A GLY -8 ? A GLY 33 34 1 Y 1 A SER -7 ? A SER 34 35 1 Y 1 A GLU -6 ? A GLU 35 36 1 Y 1 A PHE -5 ? A PHE 36 37 1 Y 1 A GLU -4 ? A GLU 37 38 1 Y 1 A LEU -3 ? A LEU 38 39 1 Y 1 A ARG -2 ? A ARG 39 40 1 Y 1 A ARG -1 ? A ARG 40 41 1 Y 1 A PRO 0 ? A PRO 41 42 1 Y 1 A MSE 1 ? A MSE 42 43 1 Y 1 A LYS 2 ? A LYS 43 44 1 Y 1 A PHE 3 ? A PHE 44 45 1 Y 1 A LEU 4 ? A LEU 45 46 1 Y 1 A GLU 5 ? A GLU 46 47 1 Y 1 A GLY 57 ? A GLY 98 48 1 Y 1 A LYS 58 ? A LYS 99 49 1 Y 1 A SER 59 ? A SER 100 50 1 Y 1 A LEU 60 ? A LEU 101 51 1 Y 1 A ASP 61 ? A ASP 102 52 1 Y 1 A THR 62 ? A THR 103 53 1 Y 1 A ASP 63 ? A ASP 104 54 1 Y 1 A SER 64 ? A SER 105 55 1 Y 1 A SER 65 ? A SER 106 56 1 Y 1 A SER 66 ? A SER 107 57 1 Y 1 A PRO 67 ? A PRO 108 58 1 Y 1 A ALA 68 ? A ALA 109 59 1 Y 1 A GLU 69 ? A GLU 110 60 1 Y 1 A PHE 70 ? A PHE 111 61 1 Y 1 A GLY 134 ? A GLY 175 62 1 Y 1 A SER 135 ? A SER 176 63 1 Y 1 A GLU 203 ? A GLU 244 64 1 Y 1 A GLY 204 ? A GLY 245 65 1 Y 1 A PHE 205 ? A PHE 246 66 1 Y 1 A LEU 206 ? A LEU 247 67 1 Y 1 A VAL 207 ? A VAL 248 68 1 Y 1 A ASN 208 ? A ASN 249 69 1 Y 1 A ASP 209 ? A ASP 250 70 1 Y 1 A SER 210 ? A SER 251 71 1 Y 1 A THR 211 ? A THR 252 72 1 Y 1 A TYR 212 ? A TYR 253 73 1 Y 1 A GLU 213 ? A GLU 254 74 1 Y 1 A GLU 214 ? A GLU 255 75 1 Y 1 A ASP 215 ? A ASP 256 76 1 Y 1 A GLY 216 ? A GLY 257 77 1 Y 1 A GLU 217 ? A GLU 258 78 1 Y 1 A ILE 218 ? A ILE 259 79 1 Y 1 A PHE 219 ? A PHE 260 80 1 Y 1 A ASP 220 ? A ASP 261 81 1 Y 1 A ASP 221 ? A ASP 262 82 1 Y 1 A MSE 222 ? A MSE 263 83 1 Y 1 A ASP 223 ? A ASP 264 84 1 Y 1 A MSE 224 ? A MSE 265 85 1 Y 1 B MSE -40 ? B MSE 1 86 1 Y 1 B GLY -39 ? B GLY 2 87 1 Y 1 B SER -38 ? B SER 3 88 1 Y 1 B SER -37 ? B SER 4 89 1 Y 1 B HIS -36 ? B HIS 5 90 1 Y 1 B HIS -35 ? B HIS 6 91 1 Y 1 B HIS -34 ? B HIS 7 92 1 Y 1 B HIS -33 ? B HIS 8 93 1 Y 1 B HIS -32 ? B HIS 9 94 1 Y 1 B HIS -31 ? B HIS 10 95 1 Y 1 B SER -30 ? B SER 11 96 1 Y 1 B SER -29 ? B SER 12 97 1 Y 1 B GLY -28 ? B GLY 13 98 1 Y 1 B LEU -27 ? B LEU 14 99 1 Y 1 B VAL -26 ? B VAL 15 100 1 Y 1 B PRO -25 ? B PRO 16 101 1 Y 1 B ARG -24 ? B ARG 17 102 1 Y 1 B GLY -23 ? B GLY 18 103 1 Y 1 B SER -22 ? B SER 19 104 1 Y 1 B HIS -21 ? B HIS 20 105 1 Y 1 B MSE -20 ? B MSE 21 106 1 Y 1 B ALA -19 ? B ALA 22 107 1 Y 1 B SER -18 ? B SER 23 108 1 Y 1 B MSE -17 ? B MSE 24 109 1 Y 1 B THR -16 ? B THR 25 110 1 Y 1 B GLY -15 ? B GLY 26 111 1 Y 1 B GLY -14 ? B GLY 27 112 1 Y 1 B GLN -13 ? B GLN 28 113 1 Y 1 B GLN -12 ? B GLN 29 114 1 Y 1 B MSE -11 ? B MSE 30 115 1 Y 1 B GLY -10 ? B GLY 31 116 1 Y 1 B ARG -9 ? B ARG 32 117 1 Y 1 B GLY -8 ? B GLY 33 118 1 Y 1 B SER -7 ? B SER 34 119 1 Y 1 B GLU -6 ? B GLU 35 120 1 Y 1 B PHE -5 ? B PHE 36 121 1 Y 1 B GLU -4 ? B GLU 37 122 1 Y 1 B LEU -3 ? B LEU 38 123 1 Y 1 B ARG -2 ? B ARG 39 124 1 Y 1 B ARG -1 ? B ARG 40 125 1 Y 1 B PRO 0 ? B PRO 41 126 1 Y 1 B MSE 1 ? B MSE 42 127 1 Y 1 B LYS 2 ? B LYS 43 128 1 Y 1 B PHE 3 ? B PHE 44 129 1 Y 1 B LEU 4 ? B LEU 45 130 1 Y 1 B GLU 5 ? B GLU 46 131 1 Y 1 B TYR 6 ? B TYR 47 132 1 Y 1 B TYR 55 ? B TYR 96 133 1 Y 1 B LEU 56 ? B LEU 97 134 1 Y 1 B GLY 57 ? B GLY 98 135 1 Y 1 B LYS 58 ? B LYS 99 136 1 Y 1 B SER 59 ? B SER 100 137 1 Y 1 B LEU 60 ? B LEU 101 138 1 Y 1 B ASP 61 ? B ASP 102 139 1 Y 1 B THR 62 ? B THR 103 140 1 Y 1 B ASP 63 ? B ASP 104 141 1 Y 1 B SER 64 ? B SER 105 142 1 Y 1 B SER 65 ? B SER 106 143 1 Y 1 B SER 66 ? B SER 107 144 1 Y 1 B PRO 67 ? B PRO 108 145 1 Y 1 B ALA 68 ? B ALA 109 146 1 Y 1 B GLU 69 ? B GLU 110 147 1 Y 1 B PHE 70 ? B PHE 111 148 1 Y 1 B LEU 200 ? B LEU 241 149 1 Y 1 B VAL 201 ? B VAL 242 150 1 Y 1 B ALA 202 ? B ALA 243 151 1 Y 1 B GLU 203 ? B GLU 244 152 1 Y 1 B GLY 204 ? B GLY 245 153 1 Y 1 B PHE 205 ? B PHE 246 154 1 Y 1 B LEU 206 ? B LEU 247 155 1 Y 1 B VAL 207 ? B VAL 248 156 1 Y 1 B ASN 208 ? B ASN 249 157 1 Y 1 B ASP 209 ? B ASP 250 158 1 Y 1 B SER 210 ? B SER 251 159 1 Y 1 B THR 211 ? B THR 252 160 1 Y 1 B TYR 212 ? B TYR 253 161 1 Y 1 B GLU 213 ? B GLU 254 162 1 Y 1 B GLU 214 ? B GLU 255 163 1 Y 1 B ASP 215 ? B ASP 256 164 1 Y 1 B GLY 216 ? B GLY 257 165 1 Y 1 B GLU 217 ? B GLU 258 166 1 Y 1 B ILE 218 ? B ILE 259 167 1 Y 1 B PHE 219 ? B PHE 260 168 1 Y 1 B ASP 220 ? B ASP 261 169 1 Y 1 B ASP 221 ? B ASP 262 170 1 Y 1 B MSE 222 ? B MSE 263 171 1 Y 1 B ASP 223 ? B ASP 264 172 1 Y 1 B MSE 224 ? B MSE 265 # _pdbx_audit_support.funding_organization 'Sao Paulo Research Foundation (FAPESP)' _pdbx_audit_support.country Brazil _pdbx_audit_support.grant_number 12/06736-6 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 water HOH #