data_5UFT # _entry.id 5UFT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5UFT pdb_00005uft 10.2210/pdb5uft/pdb WWPDB D_1000224758 ? ? # _pdbx_database_related.db_name TargetTrack _pdbx_database_related.details . _pdbx_database_related.db_id SSGCID-BrabA.17776.a _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5UFT _pdbx_database_status.recvd_initial_deposition_date 2017-01-05 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _audit_author.name 'Seattle Structural Genomics Center for Infectious Disease (SSGCID)' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'to be published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal Structure of a Nitrogen-fixing NifU-like protein (N-terminal) from Brucella abortus' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Dranow, D.M.' 1 ? primary 'Mayclin, S.J.' 2 ? primary 'Buchko, G.W.' 3 ? primary 'Lorimer, D.D.' 4 ? primary 'Edwards, T.E.' 5 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 5UFT _cell.details ? _cell.formula_units_Z ? _cell.length_a 42.960 _cell.length_a_esd ? _cell.length_b 42.960 _cell.length_b_esd ? _cell.length_c 149.310 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5UFT _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Nitrogen-fixing NifU-like, N-terminal' 16410.768 1 ? ? ? ? 2 water nat water 18.015 15 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPGSMIDDIYNKRILEFAGNMERIGQLAEPDAVATVHSKLCGSTVTVYLKMRDGVVTDFAHEVKACALGQASSSVMARNV IGATADELRAARDAMYRMLKENGPAPEGRFADMKYFEPVRDYKARHASTLLTFDAVADCIRQIEEKAKAA ; _entity_poly.pdbx_seq_one_letter_code_can ;GPGSMIDDIYNKRILEFAGNMERIGQLAEPDAVATVHSKLCGSTVTVYLKMRDGVVTDFAHEVKACALGQASSSVMARNV IGATADELRAARDAMYRMLKENGPAPEGRFADMKYFEPVRDYKARHASTLLTFDAVADCIRQIEEKAKAA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier SSGCID-BrabA.17776.a # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 GLY n 1 4 SER n 1 5 MET n 1 6 ILE n 1 7 ASP n 1 8 ASP n 1 9 ILE n 1 10 TYR n 1 11 ASN n 1 12 LYS n 1 13 ARG n 1 14 ILE n 1 15 LEU n 1 16 GLU n 1 17 PHE n 1 18 ALA n 1 19 GLY n 1 20 ASN n 1 21 MET n 1 22 GLU n 1 23 ARG n 1 24 ILE n 1 25 GLY n 1 26 GLN n 1 27 LEU n 1 28 ALA n 1 29 GLU n 1 30 PRO n 1 31 ASP n 1 32 ALA n 1 33 VAL n 1 34 ALA n 1 35 THR n 1 36 VAL n 1 37 HIS n 1 38 SER n 1 39 LYS n 1 40 LEU n 1 41 CYS n 1 42 GLY n 1 43 SER n 1 44 THR n 1 45 VAL n 1 46 THR n 1 47 VAL n 1 48 TYR n 1 49 LEU n 1 50 LYS n 1 51 MET n 1 52 ARG n 1 53 ASP n 1 54 GLY n 1 55 VAL n 1 56 VAL n 1 57 THR n 1 58 ASP n 1 59 PHE n 1 60 ALA n 1 61 HIS n 1 62 GLU n 1 63 VAL n 1 64 LYS n 1 65 ALA n 1 66 CYS n 1 67 ALA n 1 68 LEU n 1 69 GLY n 1 70 GLN n 1 71 ALA n 1 72 SER n 1 73 SER n 1 74 SER n 1 75 VAL n 1 76 MET n 1 77 ALA n 1 78 ARG n 1 79 ASN n 1 80 VAL n 1 81 ILE n 1 82 GLY n 1 83 ALA n 1 84 THR n 1 85 ALA n 1 86 ASP n 1 87 GLU n 1 88 LEU n 1 89 ARG n 1 90 ALA n 1 91 ALA n 1 92 ARG n 1 93 ASP n 1 94 ALA n 1 95 MET n 1 96 TYR n 1 97 ARG n 1 98 MET n 1 99 LEU n 1 100 LYS n 1 101 GLU n 1 102 ASN n 1 103 GLY n 1 104 PRO n 1 105 ALA n 1 106 PRO n 1 107 GLU n 1 108 GLY n 1 109 ARG n 1 110 PHE n 1 111 ALA n 1 112 ASP n 1 113 MET n 1 114 LYS n 1 115 TYR n 1 116 PHE n 1 117 GLU n 1 118 PRO n 1 119 VAL n 1 120 ARG n 1 121 ASP n 1 122 TYR n 1 123 LYS n 1 124 ALA n 1 125 ARG n 1 126 HIS n 1 127 ALA n 1 128 SER n 1 129 THR n 1 130 LEU n 1 131 LEU n 1 132 THR n 1 133 PHE n 1 134 ASP n 1 135 ALA n 1 136 VAL n 1 137 ALA n 1 138 ASP n 1 139 CYS n 1 140 ILE n 1 141 ARG n 1 142 GLN n 1 143 ILE n 1 144 GLU n 1 145 GLU n 1 146 LYS n 1 147 ALA n 1 148 LYS n 1 149 ALA n 1 150 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 150 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene BAB1_1096 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 2308 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Brucella abortus (strain 2308)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 359391 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name BrabA.17776.a.A1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q2YQ04_BRUA2 _struct_ref.pdbx_db_accession Q2YQ04 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MIDDIYNKRILEFAGNMERIGQLAEPDAVATVHSKLCGSTVTVYLKMRDGVVTDFAHEVKACALGQASSSVMARNVIGAT ADELRAARDAMYRMLKENGPAPEGRFADMKYFEPVRDYKARHASTLLTFDAVADCIRQIEEKAKAA ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5UFT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 150 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q2YQ04 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 146 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 146 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5UFT GLY A 1 ? UNP Q2YQ04 ? ? 'expression tag' -3 1 1 5UFT PRO A 2 ? UNP Q2YQ04 ? ? 'expression tag' -2 2 1 5UFT GLY A 3 ? UNP Q2YQ04 ? ? 'expression tag' -1 3 1 5UFT SER A 4 ? UNP Q2YQ04 ? ? 'expression tag' 0 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5UFT _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.42 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 49.25 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 290 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;BrabA.17776.a.A1.PB00075 at 15 mg/ml mixed 1:1 with an equal volume CSHT (b10): 30% (w/v) PEG-4000, 0.1 M Tris-HCl, pH=8.5, 0.2 M sodium acetate hydrate, cryoprotected with 20% ethylene glycol ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details 'Beryllium Lenses' _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 300 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-11-17 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Diamond [111]' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97856 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 21-ID-G' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97856 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 21-ID-G _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 52.990 _reflns.entry_id 5UFT _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.350 _reflns.d_resolution_low 29.799 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7179 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I -3.000 _reflns.percent_possible_obs 99.800 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.880 _reflns.pdbx_Rmerge_I_obs 0.045 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 23.280 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.000 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.350 2.410 ? 3.610 ? ? ? ? ? 100.000 ? ? ? ? 0.558 ? ? ? ? ? ? ? ? 7.218 ? ? ? ? ? ? ? 1 1 0.900 ? 2.410 2.480 ? 4.160 ? ? ? ? ? 100.000 ? ? ? ? 0.462 ? ? ? ? ? ? ? ? 7.172 ? ? ? ? ? ? ? 2 1 0.924 ? 2.480 2.550 ? 5.380 ? ? ? ? ? 100.000 ? ? ? ? 0.370 ? ? ? ? ? ? ? ? 7.181 ? ? ? ? ? ? ? 3 1 0.975 ? 2.550 2.630 ? 8.070 ? ? ? ? ? 100.000 ? ? ? ? 0.234 ? ? ? ? ? ? ? ? 7.141 ? ? ? ? ? ? ? 4 1 0.983 ? 2.630 2.710 ? 7.910 ? ? ? ? ? 100.000 ? ? ? ? 0.239 ? ? ? ? ? ? ? ? 7.088 ? ? ? ? ? ? ? 5 1 0.979 ? 2.710 2.810 ? 10.340 ? ? ? ? ? 99.800 ? ? ? ? 0.176 ? ? ? ? ? ? ? ? 7.163 ? ? ? ? ? ? ? 6 1 0.992 ? 2.810 2.920 ? 13.570 ? ? ? ? ? 100.000 ? ? ? ? 0.135 ? ? ? ? ? ? ? ? 7.023 ? ? ? ? ? ? ? 7 1 0.990 ? 2.920 3.030 ? 18.050 ? ? ? ? ? 99.800 ? ? ? ? 0.097 ? ? ? ? ? ? ? ? 7.174 ? ? ? ? ? ? ? 8 1 0.996 ? 3.030 3.170 ? 22.530 ? ? ? ? ? 99.800 ? ? ? ? 0.073 ? ? ? ? ? ? ? ? 6.960 ? ? ? ? ? ? ? 9 1 0.997 ? 3.170 3.320 ? 27.640 ? ? ? ? ? 100.000 ? ? ? ? 0.059 ? ? ? ? ? ? ? ? 7.077 ? ? ? ? ? ? ? 10 1 0.998 ? 3.320 3.500 ? 32.740 ? ? ? ? ? 100.000 ? ? ? ? 0.049 ? ? ? ? ? ? ? ? 6.786 ? ? ? ? ? ? ? 11 1 0.998 ? 3.500 3.720 ? 38.540 ? ? ? ? ? 100.000 ? ? ? ? 0.041 ? ? ? ? ? ? ? ? 6.729 ? ? ? ? ? ? ? 12 1 0.998 ? 3.720 3.970 ? 42.280 ? ? ? ? ? 100.000 ? ? ? ? 0.034 ? ? ? ? ? ? ? ? 6.716 ? ? ? ? ? ? ? 13 1 0.999 ? 3.970 4.290 ? 45.420 ? ? ? ? ? 100.000 ? ? ? ? 0.033 ? ? ? ? ? ? ? ? 6.564 ? ? ? ? ? ? ? 14 1 0.999 ? 4.290 4.700 ? 47.840 ? ? ? ? ? 100.000 ? ? ? ? 0.031 ? ? ? ? ? ? ? ? 6.428 ? ? ? ? ? ? ? 15 1 0.999 ? 4.700 5.260 ? 49.560 ? ? ? ? ? 100.000 ? ? ? ? 0.027 ? ? ? ? ? ? ? ? 6.621 ? ? ? ? ? ? ? 16 1 0.999 ? 5.260 6.070 ? 46.740 ? ? ? ? ? 100.000 ? ? ? ? 0.026 ? ? ? ? ? ? ? ? 6.418 ? ? ? ? ? ? ? 17 1 1.000 ? 6.070 7.430 ? 48.180 ? ? ? ? ? 100.000 ? ? ? ? 0.024 ? ? ? ? ? ? ? ? 6.089 ? ? ? ? ? ? ? 18 1 0.999 ? 7.430 10.510 ? 50.700 ? ? ? ? ? 100.000 ? ? ? ? 0.020 ? ? ? ? ? ? ? ? 5.807 ? ? ? ? ? ? ? 19 1 1.000 ? 10.510 29.799 ? 43.260 ? ? ? ? ? 89.400 ? ? ? ? 0.023 ? ? ? ? ? ? ? ? 4.731 ? ? ? ? ? ? ? 20 1 0.999 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 109.430 _refine.B_iso_mean 65.3505 _refine.B_iso_min 46.960 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5UFT _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.3500 _refine.ls_d_res_low 29.7990 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6948 _refine.ls_number_reflns_R_free 696 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.6700 _refine.ls_percent_reflns_R_free 10.0200 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2280 _refine.ls_R_factor_R_free 0.2594 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2246 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2qq4 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 27.9500 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2800 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.3500 _refine_hist.d_res_low 29.7990 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 15 _refine_hist.number_atoms_total 1089 _refine_hist.pdbx_number_residues_total 144 _refine_hist.pdbx_B_iso_mean_solvent 57.59 _refine_hist.pdbx_number_atoms_protein 1074 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.002 ? 1095 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.422 ? 1483 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.039 ? 170 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 197 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 13.573 ? 672 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.3501 2.5315 1285 . 129 1156 91.0000 . . . 0.3259 0.0000 0.3133 . . . . . . 5 . . . 'X-RAY DIFFRACTION' 2.5315 2.7861 1307 . 129 1178 95.0000 . . . 0.3163 0.0000 0.2998 . . . . . . 5 . . . 'X-RAY DIFFRACTION' 2.7861 3.1888 1384 . 138 1246 98.0000 . . . 0.3855 0.0000 0.2904 . . . . . . 5 . . . 'X-RAY DIFFRACTION' 3.1888 4.0160 1436 . 142 1294 100.0000 . . . 0.2866 0.0000 0.2345 . . . . . . 5 . . . 'X-RAY DIFFRACTION' 4.0160 29.8013 1536 . 158 1378 99.0000 . . . 0.1962 0.0000 0.1786 . . . . . . 5 . . . # _struct.entry_id 5UFT _struct.title 'Crystal Structure of a Nitrogen-fixing NifU-like protein (N-terminal) from Brucella abortus' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5UFT _struct_keywords.text ;SSGCID, Brucella abortus, iron ion binding, iron-sulfur cluster binding/assembly, NifU, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, METAL BINDING PROTEIN ; _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 MET A 5 ? TYR A 10 ? MET A 1 TYR A 6 1 ? 6 HELX_P HELX_P2 AA2 ASN A 11 ? ASN A 20 ? ASN A 7 ASN A 16 1 ? 10 HELX_P HELX_P3 AA3 CYS A 66 ? VAL A 80 ? CYS A 62 VAL A 76 1 ? 15 HELX_P HELX_P4 AA4 THR A 84 ? GLU A 101 ? THR A 80 GLU A 97 1 ? 18 HELX_P HELX_P5 AA5 GLU A 107 ? ALA A 124 ? GLU A 103 ALA A 120 5 ? 18 HELX_P HELX_P6 AA6 ARG A 125 ? LEU A 130 ? ARG A 121 LEU A 126 1 ? 6 HELX_P HELX_P7 AA7 LEU A 130 ? LYS A 146 ? LEU A 126 LYS A 142 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ALA A 32 ? SER A 38 ? ALA A 28 SER A 34 AA1 2 SER A 43 ? ARG A 52 ? SER A 39 ARG A 48 AA1 3 VAL A 55 ? LYS A 64 ? VAL A 51 LYS A 60 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ALA A 34 ? N ALA A 30 O VAL A 47 ? O VAL A 43 AA1 2 3 N TYR A 48 ? N TYR A 44 O ALA A 60 ? O ALA A 56 # _atom_sites.entry_id 5UFT _atom_sites.fract_transf_matrix[1][1] 0.023277 _atom_sites.fract_transf_matrix[1][2] 0.013439 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.026879 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006697 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -3 ? ? ? A . n A 1 2 PRO 2 -2 ? ? ? A . n A 1 3 GLY 3 -1 ? ? ? A . n A 1 4 SER 4 0 0 SER SER A . n A 1 5 MET 5 1 1 MET MET A . n A 1 6 ILE 6 2 2 ILE ILE A . n A 1 7 ASP 7 3 3 ASP ASP A . n A 1 8 ASP 8 4 4 ASP ASP A . n A 1 9 ILE 9 5 5 ILE ILE A . n A 1 10 TYR 10 6 6 TYR TYR A . n A 1 11 ASN 11 7 7 ASN ASN A . n A 1 12 LYS 12 8 8 LYS LYS A . n A 1 13 ARG 13 9 9 ARG ARG A . n A 1 14 ILE 14 10 10 ILE ILE A . n A 1 15 LEU 15 11 11 LEU LEU A . n A 1 16 GLU 16 12 12 GLU GLU A . n A 1 17 PHE 17 13 13 PHE PHE A . n A 1 18 ALA 18 14 14 ALA ALA A . n A 1 19 GLY 19 15 15 GLY GLY A . n A 1 20 ASN 20 16 16 ASN ASN A . n A 1 21 MET 21 17 17 MET MET A . n A 1 22 GLU 22 18 18 GLU GLU A . n A 1 23 ARG 23 19 19 ARG ARG A . n A 1 24 ILE 24 20 20 ILE ILE A . n A 1 25 GLY 25 21 21 GLY GLY A . n A 1 26 GLN 26 22 22 GLN GLN A . n A 1 27 LEU 27 23 23 LEU LEU A . n A 1 28 ALA 28 24 24 ALA ALA A . n A 1 29 GLU 29 25 25 GLU GLU A . n A 1 30 PRO 30 26 26 PRO PRO A . n A 1 31 ASP 31 27 27 ASP ASP A . n A 1 32 ALA 32 28 28 ALA ALA A . n A 1 33 VAL 33 29 29 VAL VAL A . n A 1 34 ALA 34 30 30 ALA ALA A . n A 1 35 THR 35 31 31 THR THR A . n A 1 36 VAL 36 32 32 VAL VAL A . n A 1 37 HIS 37 33 33 HIS HIS A . n A 1 38 SER 38 34 34 SER SER A . n A 1 39 LYS 39 35 35 LYS LYS A . n A 1 40 LEU 40 36 36 LEU LEU A . n A 1 41 CYS 41 37 37 CYS CYS A . n A 1 42 GLY 42 38 38 GLY GLY A . n A 1 43 SER 43 39 39 SER SER A . n A 1 44 THR 44 40 40 THR THR A . n A 1 45 VAL 45 41 41 VAL VAL A . n A 1 46 THR 46 42 42 THR THR A . n A 1 47 VAL 47 43 43 VAL VAL A . n A 1 48 TYR 48 44 44 TYR TYR A . n A 1 49 LEU 49 45 45 LEU LEU A . n A 1 50 LYS 50 46 46 LYS LYS A . n A 1 51 MET 51 47 47 MET MET A . n A 1 52 ARG 52 48 48 ARG ARG A . n A 1 53 ASP 53 49 49 ASP ASP A . n A 1 54 GLY 54 50 50 GLY GLY A . n A 1 55 VAL 55 51 51 VAL VAL A . n A 1 56 VAL 56 52 52 VAL VAL A . n A 1 57 THR 57 53 53 THR THR A . n A 1 58 ASP 58 54 54 ASP ASP A . n A 1 59 PHE 59 55 55 PHE PHE A . n A 1 60 ALA 60 56 56 ALA ALA A . n A 1 61 HIS 61 57 57 HIS HIS A . n A 1 62 GLU 62 58 58 GLU GLU A . n A 1 63 VAL 63 59 59 VAL VAL A . n A 1 64 LYS 64 60 60 LYS LYS A . n A 1 65 ALA 65 61 61 ALA ALA A . n A 1 66 CYS 66 62 62 CYS CYS A . n A 1 67 ALA 67 63 63 ALA ALA A . n A 1 68 LEU 68 64 64 LEU LEU A . n A 1 69 GLY 69 65 65 GLY GLY A . n A 1 70 GLN 70 66 66 GLN GLN A . n A 1 71 ALA 71 67 67 ALA ALA A . n A 1 72 SER 72 68 68 SER SER A . n A 1 73 SER 73 69 69 SER SER A . n A 1 74 SER 74 70 70 SER SER A . n A 1 75 VAL 75 71 71 VAL VAL A . n A 1 76 MET 76 72 72 MET MET A . n A 1 77 ALA 77 73 73 ALA ALA A . n A 1 78 ARG 78 74 74 ARG ARG A . n A 1 79 ASN 79 75 75 ASN ASN A . n A 1 80 VAL 80 76 76 VAL VAL A . n A 1 81 ILE 81 77 77 ILE ILE A . n A 1 82 GLY 82 78 78 GLY GLY A . n A 1 83 ALA 83 79 79 ALA ALA A . n A 1 84 THR 84 80 80 THR THR A . n A 1 85 ALA 85 81 81 ALA ALA A . n A 1 86 ASP 86 82 82 ASP ASP A . n A 1 87 GLU 87 83 83 GLU GLU A . n A 1 88 LEU 88 84 84 LEU LEU A . n A 1 89 ARG 89 85 85 ARG ARG A . n A 1 90 ALA 90 86 86 ALA ALA A . n A 1 91 ALA 91 87 87 ALA ALA A . n A 1 92 ARG 92 88 88 ARG ARG A . n A 1 93 ASP 93 89 89 ASP ASP A . n A 1 94 ALA 94 90 90 ALA ALA A . n A 1 95 MET 95 91 91 MET MET A . n A 1 96 TYR 96 92 92 TYR TYR A . n A 1 97 ARG 97 93 93 ARG ARG A . n A 1 98 MET 98 94 94 MET MET A . n A 1 99 LEU 99 95 95 LEU LEU A . n A 1 100 LYS 100 96 96 LYS LYS A . n A 1 101 GLU 101 97 97 GLU GLU A . n A 1 102 ASN 102 98 98 ASN ASN A . n A 1 103 GLY 103 99 99 GLY GLY A . n A 1 104 PRO 104 100 100 PRO PRO A . n A 1 105 ALA 105 101 101 ALA ALA A . n A 1 106 PRO 106 102 102 PRO PRO A . n A 1 107 GLU 107 103 103 GLU GLU A . n A 1 108 GLY 108 104 104 GLY GLY A . n A 1 109 ARG 109 105 105 ARG ARG A . n A 1 110 PHE 110 106 106 PHE PHE A . n A 1 111 ALA 111 107 107 ALA ALA A . n A 1 112 ASP 112 108 108 ASP ASP A . n A 1 113 MET 113 109 109 MET MET A . n A 1 114 LYS 114 110 110 LYS LYS A . n A 1 115 TYR 115 111 111 TYR TYR A . n A 1 116 PHE 116 112 112 PHE PHE A . n A 1 117 GLU 117 113 113 GLU GLU A . n A 1 118 PRO 118 114 114 PRO PRO A . n A 1 119 VAL 119 115 115 VAL VAL A . n A 1 120 ARG 120 116 116 ARG ARG A . n A 1 121 ASP 121 117 117 ASP ASP A . n A 1 122 TYR 122 118 118 TYR TYR A . n A 1 123 LYS 123 119 119 LYS LYS A . n A 1 124 ALA 124 120 120 ALA ALA A . n A 1 125 ARG 125 121 121 ARG ARG A . n A 1 126 HIS 126 122 122 HIS HIS A . n A 1 127 ALA 127 123 123 ALA ALA A . n A 1 128 SER 128 124 124 SER SER A . n A 1 129 THR 129 125 125 THR THR A . n A 1 130 LEU 130 126 126 LEU LEU A . n A 1 131 LEU 131 127 127 LEU LEU A . n A 1 132 THR 132 128 128 THR THR A . n A 1 133 PHE 133 129 129 PHE PHE A . n A 1 134 ASP 134 130 130 ASP ASP A . n A 1 135 ALA 135 131 131 ALA ALA A . n A 1 136 VAL 136 132 132 VAL VAL A . n A 1 137 ALA 137 133 133 ALA ALA A . n A 1 138 ASP 138 134 134 ASP ASP A . n A 1 139 CYS 139 135 135 CYS CYS A . n A 1 140 ILE 140 136 136 ILE ILE A . n A 1 141 ARG 141 137 137 ARG ARG A . n A 1 142 GLN 142 138 138 GLN GLN A . n A 1 143 ILE 143 139 139 ILE ILE A . n A 1 144 GLU 144 140 140 GLU GLU A . n A 1 145 GLU 145 141 141 GLU GLU A . n A 1 146 LYS 146 142 142 LYS LYS A . n A 1 147 ALA 147 143 143 ALA ALA A . n A 1 148 LYS 148 144 ? ? ? A . n A 1 149 ALA 149 145 ? ? ? A . n A 1 150 ALA 150 146 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NIAID, National Institute of Allergy and Infectious Diseases' _pdbx_SG_project.full_name_of_center 'Seattle Structural Genomics Center for Infectious Disease' _pdbx_SG_project.initial_of_center SSGCID # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 6 HOH HOH A . B 2 HOH 2 202 4 HOH HOH A . B 2 HOH 3 203 9 HOH HOH A . B 2 HOH 4 204 11 HOH HOH A . B 2 HOH 5 205 16 HOH HOH A . B 2 HOH 6 206 12 HOH HOH A . B 2 HOH 7 207 1 HOH HOH A . B 2 HOH 8 208 10 HOH HOH A . B 2 HOH 9 209 3 HOH HOH A . B 2 HOH 10 210 7 HOH HOH A . B 2 HOH 11 211 15 HOH HOH A . B 2 HOH 12 212 13 HOH HOH A . B 2 HOH 13 213 2 HOH HOH A . B 2 HOH 14 214 14 HOH HOH A . B 2 HOH 15 215 17 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-01-25 2 'Structure model' 1 1 2023-10-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined 7.6081 21.9586 57.1997 0.3217 0.9254 0.5393 0.0694 0.0460 0.1576 1.1537 3.8364 2.9274 1.1255 1.0525 -0.1697 -0.1903 0.5494 -0.2016 0.8666 -0.2138 0.1418 0.2071 -0.0814 -0.4915 'X-RAY DIFFRACTION' 2 ? refined -9.2130 13.6207 54.0201 0.4647 1.3178 0.5250 0.0050 0.0293 0.2930 4.6627 5.9790 5.0551 1.6938 0.7191 4.9935 0.6995 -0.3603 -0.0738 -1.0608 0.3422 0.1254 0.3405 0.0871 -0.9512 'X-RAY DIFFRACTION' 3 ? refined -6.7697 20.0527 63.0760 0.4370 1.5195 0.6733 0.1723 0.0832 0.2351 3.0084 0.2866 1.3122 -0.4021 0.9482 -0.4355 0.0257 -0.2288 -0.7383 0.3047 0.8243 -0.1266 -0.1776 -0.0069 -0.3826 'X-RAY DIFFRACTION' 4 ? refined 5.6855 34.1965 60.5016 0.5760 0.9937 0.7323 0.2032 -0.0141 0.2241 3.7029 2.8857 3.4420 0.6988 1.0070 0.5716 -0.4267 0.0725 0.3109 0.3705 1.0658 0.2110 0.0088 -0.8116 -0.6587 'X-RAY DIFFRACTION' 5 ? refined 8.7902 24.0126 61.5904 0.3310 0.8829 0.5075 0.0925 -0.0153 0.1776 2.2559 3.5974 2.3849 1.7586 0.6827 0.9843 -0.1708 0.2866 -0.0285 0.5526 0.1433 -0.1917 0.0172 -0.1485 -0.2739 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 104 A 143 ;chain 'A' and (resid 104 through 143 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 0 A 7 ;chain 'A' and (resid 0 through 7 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 8 A 15 ;chain 'A' and (resid 8 through 15 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 4 4 A 16 A 38 ;chain 'A' and (resid 16 through 38 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 5 5 A 39 A 103 ;chain 'A' and (resid 39 through 103 ) ; ? ? ? ? ? # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? 'Wolfgang Kabsch' ? ? ? ? ? ? http://www.mpimf-heidelberg.mpg.de/~kabsch/xds/html_doc/xscale_program.html ? XSCALE ? ? package . 1 ? refinement ? ? 'Paul D. Adams' PDAdams@lbl.gov ? ? ? ? C++ http://www.phenix-online.org/ ? PHENIX ? ? package dev_2621 2 ? 'data extraction' ? ? PDB deposit@deposit.rcsb.org 'July. 13, 2016' ? ? ? C++ http://sw-tools.pdb.org/apps/PDB_EXTRACT/ ? PDB_EXTRACT ? ? package 3.22 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MR-Rosetta ? ? ? . 5 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id MET _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 1 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 63.85 _pdbx_validate_torsion.psi -54.37 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 8 ? CG ? A LYS 12 CG 2 1 Y 1 A LYS 8 ? CD ? A LYS 12 CD 3 1 Y 1 A LYS 8 ? CE ? A LYS 12 CE 4 1 Y 1 A LYS 8 ? NZ ? A LYS 12 NZ 5 1 Y 1 A GLU 12 ? CG ? A GLU 16 CG 6 1 Y 1 A GLU 12 ? CD ? A GLU 16 CD 7 1 Y 1 A GLU 12 ? OE1 ? A GLU 16 OE1 8 1 Y 1 A GLU 12 ? OE2 ? A GLU 16 OE2 9 1 Y 1 A GLN 22 ? CG ? A GLN 26 CG 10 1 Y 1 A GLN 22 ? CD ? A GLN 26 CD 11 1 Y 1 A GLN 22 ? OE1 ? A GLN 26 OE1 12 1 Y 1 A GLN 22 ? NE2 ? A GLN 26 NE2 13 1 Y 1 A HIS 33 ? CG ? A HIS 37 CG 14 1 Y 1 A HIS 33 ? ND1 ? A HIS 37 ND1 15 1 Y 1 A HIS 33 ? CD2 ? A HIS 37 CD2 16 1 Y 1 A HIS 33 ? CE1 ? A HIS 37 CE1 17 1 Y 1 A HIS 33 ? NE2 ? A HIS 37 NE2 18 1 Y 1 A LEU 36 ? CG ? A LEU 40 CG 19 1 Y 1 A LEU 36 ? CD1 ? A LEU 40 CD1 20 1 Y 1 A LEU 36 ? CD2 ? A LEU 40 CD2 21 1 Y 1 A LYS 60 ? CG ? A LYS 64 CG 22 1 Y 1 A LYS 60 ? CD ? A LYS 64 CD 23 1 Y 1 A LYS 60 ? CE ? A LYS 64 CE 24 1 Y 1 A LYS 60 ? NZ ? A LYS 64 NZ 25 1 Y 1 A LYS 119 ? CG ? A LYS 123 CG 26 1 Y 1 A LYS 119 ? CD ? A LYS 123 CD 27 1 Y 1 A LYS 119 ? CE ? A LYS 123 CE 28 1 Y 1 A LYS 119 ? NZ ? A LYS 123 NZ 29 1 Y 1 A GLU 141 ? CG ? A GLU 145 CG 30 1 Y 1 A GLU 141 ? CD ? A GLU 145 CD 31 1 Y 1 A GLU 141 ? OE1 ? A GLU 145 OE1 32 1 Y 1 A GLU 141 ? OE2 ? A GLU 145 OE2 33 1 Y 1 A LYS 142 ? CG ? A LYS 146 CG 34 1 Y 1 A LYS 142 ? CD ? A LYS 146 CD 35 1 Y 1 A LYS 142 ? CE ? A LYS 146 CE 36 1 Y 1 A LYS 142 ? NZ ? A LYS 146 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -3 ? A GLY 1 2 1 Y 1 A PRO -2 ? A PRO 2 3 1 Y 1 A GLY -1 ? A GLY 3 4 1 Y 1 A LYS 144 ? A LYS 148 5 1 Y 1 A ALA 145 ? A ALA 149 6 1 Y 1 A ALA 146 ? A ALA 150 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TYR N N N N 321 TYR CA C N S 322 TYR C C N N 323 TYR O O N N 324 TYR CB C N N 325 TYR CG C Y N 326 TYR CD1 C Y N 327 TYR CD2 C Y N 328 TYR CE1 C Y N 329 TYR CE2 C Y N 330 TYR CZ C Y N 331 TYR OH O N N 332 TYR OXT O N N 333 TYR H H N N 334 TYR H2 H N N 335 TYR HA H N N 336 TYR HB2 H N N 337 TYR HB3 H N N 338 TYR HD1 H N N 339 TYR HD2 H N N 340 TYR HE1 H N N 341 TYR HE2 H N N 342 TYR HH H N N 343 TYR HXT H N N 344 VAL N N N N 345 VAL CA C N S 346 VAL C C N N 347 VAL O O N N 348 VAL CB C N N 349 VAL CG1 C N N 350 VAL CG2 C N N 351 VAL OXT O N N 352 VAL H H N N 353 VAL H2 H N N 354 VAL HA H N N 355 VAL HB H N N 356 VAL HG11 H N N 357 VAL HG12 H N N 358 VAL HG13 H N N 359 VAL HG21 H N N 360 VAL HG22 H N N 361 VAL HG23 H N N 362 VAL HXT H N N 363 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TYR N CA sing N N 306 TYR N H sing N N 307 TYR N H2 sing N N 308 TYR CA C sing N N 309 TYR CA CB sing N N 310 TYR CA HA sing N N 311 TYR C O doub N N 312 TYR C OXT sing N N 313 TYR CB CG sing N N 314 TYR CB HB2 sing N N 315 TYR CB HB3 sing N N 316 TYR CG CD1 doub Y N 317 TYR CG CD2 sing Y N 318 TYR CD1 CE1 sing Y N 319 TYR CD1 HD1 sing N N 320 TYR CD2 CE2 doub Y N 321 TYR CD2 HD2 sing N N 322 TYR CE1 CZ doub Y N 323 TYR CE1 HE1 sing N N 324 TYR CE2 CZ sing Y N 325 TYR CE2 HE2 sing N N 326 TYR CZ OH sing N N 327 TYR OH HH sing N N 328 TYR OXT HXT sing N N 329 VAL N CA sing N N 330 VAL N H sing N N 331 VAL N H2 sing N N 332 VAL CA C sing N N 333 VAL CA CB sing N N 334 VAL CA HA sing N N 335 VAL C O doub N N 336 VAL C OXT sing N N 337 VAL CB CG1 sing N N 338 VAL CB CG2 sing N N 339 VAL CB HB sing N N 340 VAL CG1 HG11 sing N N 341 VAL CG1 HG12 sing N N 342 VAL CG1 HG13 sing N N 343 VAL CG2 HG21 sing N N 344 VAL CG2 HG22 sing N N 345 VAL CG2 HG23 sing N N 346 VAL OXT HXT sing N N 347 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2QQ4 _pdbx_initial_refinement_model.details ? #