data_5UJR # _entry.id 5UJR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5UJR pdb_00005ujr 10.2210/pdb5ujr/pdb WWPDB D_1000225966 ? ? BMRB 30236 ? 10.13018/BMR30236 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-11-29 2 'Structure model' 1 1 2018-01-17 3 'Structure model' 1 2 2023-06-14 4 'Structure model' 1 3 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 3 'Structure model' 'Database references' 3 3 'Structure model' Other 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_audit_support 2 3 'Structure model' database_2 3 3 'Structure model' pdbx_database_status 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 4 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5UJR _pdbx_database_status.recvd_initial_deposition_date 2017-01-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'NMR Solution Structure of the Two-component Bacteriocin CbnXY' _pdbx_database_related.db_id 30236 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Acedo, J.Z.' 1 ? 'Towle, K.M.' 2 ? 'Lohans, C.T.' 3 ? 'McKay, R.T.' 4 ? 'Miskolzie, M.' 5 ? 'Doerksen, T.' 6 ? 'Vederas, J.C.' 7 ? 'Martin-Visscher, L.A.' 8 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country NE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'FEBS Lett.' _citation.journal_id_ASTM FEBLAL _citation.journal_id_CSD 0165 _citation.journal_id_ISSN 1873-3468 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 591 _citation.language ? _citation.page_first 1349 _citation.page_last 1359 _citation.title 'Identification and three-dimensional structure of carnobacteriocin XY, a class IIb bacteriocin produced by Carnobacteria.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/1873-3468.12648 _citation.pdbx_database_id_PubMed 28391617 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Acedo, J.Z.' 1 ? primary 'Towle, K.M.' 2 ? primary 'Lohans, C.T.' 3 ? primary 'Miskolzie, M.' 4 ? primary 'McKay, R.T.' 5 ? primary 'Doerksen, T.A.' 6 ? primary 'Vederas, J.C.' 7 ? primary 'Martin-Visscher, L.A.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Bacteriocin _entity.formula_weight 3590.177 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code WGWKEVVQNGQTIFSAGQKLGNMVGKIVPLPFG _entity_poly.pdbx_seq_one_letter_code_can WGWKEVVQNGQTIFSAGQKLGNMVGKIVPLPFG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 TRP n 1 2 GLY n 1 3 TRP n 1 4 LYS n 1 5 GLU n 1 6 VAL n 1 7 VAL n 1 8 GLN n 1 9 ASN n 1 10 GLY n 1 11 GLN n 1 12 THR n 1 13 ILE n 1 14 PHE n 1 15 SER n 1 16 ALA n 1 17 GLY n 1 18 GLN n 1 19 LYS n 1 20 LEU n 1 21 GLY n 1 22 ASN n 1 23 MET n 1 24 VAL n 1 25 GLY n 1 26 LYS n 1 27 ILE n 1 28 VAL n 1 29 PRO n 1 30 LEU n 1 31 PRO n 1 32 PHE n 1 33 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 33 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Carnobacterium maltaromaticum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2751 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 TRP 1 1 1 TRP TRP A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 TRP 3 3 3 TRP TRP A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 MET 23 23 23 MET MET A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 GLY 33 33 33 GLY GLY A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5UJR _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 5UJR _struct.title 'NMR Solution Structure of the Two-component Bacteriocin CbnXY' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5UJR _struct_keywords.text 'Antimicrobial protein' _struct_keywords.pdbx_keywords 'ANTIMICROBIAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q46313_CARML _struct_ref.pdbx_db_accession Q46313 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code WGWKEVVQNGQTIFSAGQKLGNMVGKIVPLPFG _struct_ref.pdbx_align_begin 19 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5UJR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 33 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q46313 _struct_ref_seq.db_align_beg 19 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 51 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 33 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 2 ? SER A 15 ? GLY A 2 SER A 15 1 ? 14 HELX_P HELX_P2 AA2 SER A 15 ? LEU A 20 ? SER A 15 LEU A 20 1 ? 6 HELX_P HELX_P3 AA3 GLY A 21 ? LYS A 26 ? GLY A 21 LYS A 26 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 3 PRO A 29 ? ? -69.74 -173.95 2 4 PHE A 32 ? ? -62.51 95.02 3 12 LEU A 30 ? ? -113.49 73.92 4 12 PRO A 31 ? ? -69.75 93.98 5 13 ILE A 27 ? ? -87.94 -72.92 6 14 LYS A 26 ? ? 51.27 74.33 7 16 ILE A 27 ? ? -62.54 -72.92 8 17 PRO A 31 ? ? -69.77 84.55 9 18 LEU A 30 ? ? -116.95 73.54 10 19 PRO A 31 ? ? -69.84 95.50 11 20 PHE A 32 ? ? -66.79 99.07 # _pdbx_nmr_ensemble.entry_id 5UJR _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 5UJR _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1 mM [U-99% 13C; U-99% 15N] CbnX, 50 % [U-99% 2H] trifluoroethanol, 50 % water, 0.01 % DSS, trifluoroethanol/water' _pdbx_nmr_sample_details.solvent_system trifluoroethanol/water _pdbx_nmr_sample_details.label CbnX _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 CbnX 1 ? mM '[U-99% 13C; U-99% 15N]' 1 trifluoroethanol 50 ? % '[U-99% 2H]' 1 water 50 ? % none 1 DSS 0.01 ? % none # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.pressure_units mmHg _pdbx_nmr_exptl_sample_conditions.pressure 760 _pdbx_nmr_exptl_sample_conditions.pH 6 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units 'Not defined' _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-1H TOCSY' 1 isotropic 2 1 1 '2D 1H-1H NOESY' 1 isotropic 3 1 1 '2D 1H-15N HSQC' 1 isotropic 4 1 1 '2D 1H-13C HSQC' 1 isotropic 5 1 1 '3D HCCH-TOCSY' 1 isotropic 6 1 1 '3D 1H-15N NOESY' 1 isotropic 7 1 1 '3D 1H-15N TOCSY' 1 isotropic # _pdbx_nmr_refine.entry_id 5UJR _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 4 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 2 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 3 'data analysis' NMRView ? 'Johnson, One Moon Scientific' 4 refinement CYANA ? 'Guntert, Mumenthaler and Wuthrich' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 GLN N N N N 31 GLN CA C N S 32 GLN C C N N 33 GLN O O N N 34 GLN CB C N N 35 GLN CG C N N 36 GLN CD C N N 37 GLN OE1 O N N 38 GLN NE2 N N N 39 GLN OXT O N N 40 GLN H H N N 41 GLN H2 H N N 42 GLN HA H N N 43 GLN HB2 H N N 44 GLN HB3 H N N 45 GLN HG2 H N N 46 GLN HG3 H N N 47 GLN HE21 H N N 48 GLN HE22 H N N 49 GLN HXT H N N 50 GLU N N N N 51 GLU CA C N S 52 GLU C C N N 53 GLU O O N N 54 GLU CB C N N 55 GLU CG C N N 56 GLU CD C N N 57 GLU OE1 O N N 58 GLU OE2 O N N 59 GLU OXT O N N 60 GLU H H N N 61 GLU H2 H N N 62 GLU HA H N N 63 GLU HB2 H N N 64 GLU HB3 H N N 65 GLU HG2 H N N 66 GLU HG3 H N N 67 GLU HE2 H N N 68 GLU HXT H N N 69 GLY N N N N 70 GLY CA C N N 71 GLY C C N N 72 GLY O O N N 73 GLY OXT O N N 74 GLY H H N N 75 GLY H2 H N N 76 GLY HA2 H N N 77 GLY HA3 H N N 78 GLY HXT H N N 79 ILE N N N N 80 ILE CA C N S 81 ILE C C N N 82 ILE O O N N 83 ILE CB C N S 84 ILE CG1 C N N 85 ILE CG2 C N N 86 ILE CD1 C N N 87 ILE OXT O N N 88 ILE H H N N 89 ILE H2 H N N 90 ILE HA H N N 91 ILE HB H N N 92 ILE HG12 H N N 93 ILE HG13 H N N 94 ILE HG21 H N N 95 ILE HG22 H N N 96 ILE HG23 H N N 97 ILE HD11 H N N 98 ILE HD12 H N N 99 ILE HD13 H N N 100 ILE HXT H N N 101 LEU N N N N 102 LEU CA C N S 103 LEU C C N N 104 LEU O O N N 105 LEU CB C N N 106 LEU CG C N N 107 LEU CD1 C N N 108 LEU CD2 C N N 109 LEU OXT O N N 110 LEU H H N N 111 LEU H2 H N N 112 LEU HA H N N 113 LEU HB2 H N N 114 LEU HB3 H N N 115 LEU HG H N N 116 LEU HD11 H N N 117 LEU HD12 H N N 118 LEU HD13 H N N 119 LEU HD21 H N N 120 LEU HD22 H N N 121 LEU HD23 H N N 122 LEU HXT H N N 123 LYS N N N N 124 LYS CA C N S 125 LYS C C N N 126 LYS O O N N 127 LYS CB C N N 128 LYS CG C N N 129 LYS CD C N N 130 LYS CE C N N 131 LYS NZ N N N 132 LYS OXT O N N 133 LYS H H N N 134 LYS H2 H N N 135 LYS HA H N N 136 LYS HB2 H N N 137 LYS HB3 H N N 138 LYS HG2 H N N 139 LYS HG3 H N N 140 LYS HD2 H N N 141 LYS HD3 H N N 142 LYS HE2 H N N 143 LYS HE3 H N N 144 LYS HZ1 H N N 145 LYS HZ2 H N N 146 LYS HZ3 H N N 147 LYS HXT H N N 148 MET N N N N 149 MET CA C N S 150 MET C C N N 151 MET O O N N 152 MET CB C N N 153 MET CG C N N 154 MET SD S N N 155 MET CE C N N 156 MET OXT O N N 157 MET H H N N 158 MET H2 H N N 159 MET HA H N N 160 MET HB2 H N N 161 MET HB3 H N N 162 MET HG2 H N N 163 MET HG3 H N N 164 MET HE1 H N N 165 MET HE2 H N N 166 MET HE3 H N N 167 MET HXT H N N 168 PHE N N N N 169 PHE CA C N S 170 PHE C C N N 171 PHE O O N N 172 PHE CB C N N 173 PHE CG C Y N 174 PHE CD1 C Y N 175 PHE CD2 C Y N 176 PHE CE1 C Y N 177 PHE CE2 C Y N 178 PHE CZ C Y N 179 PHE OXT O N N 180 PHE H H N N 181 PHE H2 H N N 182 PHE HA H N N 183 PHE HB2 H N N 184 PHE HB3 H N N 185 PHE HD1 H N N 186 PHE HD2 H N N 187 PHE HE1 H N N 188 PHE HE2 H N N 189 PHE HZ H N N 190 PHE HXT H N N 191 PRO N N N N 192 PRO CA C N S 193 PRO C C N N 194 PRO O O N N 195 PRO CB C N N 196 PRO CG C N N 197 PRO CD C N N 198 PRO OXT O N N 199 PRO H H N N 200 PRO HA H N N 201 PRO HB2 H N N 202 PRO HB3 H N N 203 PRO HG2 H N N 204 PRO HG3 H N N 205 PRO HD2 H N N 206 PRO HD3 H N N 207 PRO HXT H N N 208 SER N N N N 209 SER CA C N S 210 SER C C N N 211 SER O O N N 212 SER CB C N N 213 SER OG O N N 214 SER OXT O N N 215 SER H H N N 216 SER H2 H N N 217 SER HA H N N 218 SER HB2 H N N 219 SER HB3 H N N 220 SER HG H N N 221 SER HXT H N N 222 THR N N N N 223 THR CA C N S 224 THR C C N N 225 THR O O N N 226 THR CB C N R 227 THR OG1 O N N 228 THR CG2 C N N 229 THR OXT O N N 230 THR H H N N 231 THR H2 H N N 232 THR HA H N N 233 THR HB H N N 234 THR HG1 H N N 235 THR HG21 H N N 236 THR HG22 H N N 237 THR HG23 H N N 238 THR HXT H N N 239 TRP N N N N 240 TRP CA C N S 241 TRP C C N N 242 TRP O O N N 243 TRP CB C N N 244 TRP CG C Y N 245 TRP CD1 C Y N 246 TRP CD2 C Y N 247 TRP NE1 N Y N 248 TRP CE2 C Y N 249 TRP CE3 C Y N 250 TRP CZ2 C Y N 251 TRP CZ3 C Y N 252 TRP CH2 C Y N 253 TRP OXT O N N 254 TRP H H N N 255 TRP H2 H N N 256 TRP HA H N N 257 TRP HB2 H N N 258 TRP HB3 H N N 259 TRP HD1 H N N 260 TRP HE1 H N N 261 TRP HE3 H N N 262 TRP HZ2 H N N 263 TRP HZ3 H N N 264 TRP HH2 H N N 265 TRP HXT H N N 266 VAL N N N N 267 VAL CA C N S 268 VAL C C N N 269 VAL O O N N 270 VAL CB C N N 271 VAL CG1 C N N 272 VAL CG2 C N N 273 VAL OXT O N N 274 VAL H H N N 275 VAL H2 H N N 276 VAL HA H N N 277 VAL HB H N N 278 VAL HG11 H N N 279 VAL HG12 H N N 280 VAL HG13 H N N 281 VAL HG21 H N N 282 VAL HG22 H N N 283 VAL HG23 H N N 284 VAL HXT H N N 285 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 GLN N CA sing N N 29 GLN N H sing N N 30 GLN N H2 sing N N 31 GLN CA C sing N N 32 GLN CA CB sing N N 33 GLN CA HA sing N N 34 GLN C O doub N N 35 GLN C OXT sing N N 36 GLN CB CG sing N N 37 GLN CB HB2 sing N N 38 GLN CB HB3 sing N N 39 GLN CG CD sing N N 40 GLN CG HG2 sing N N 41 GLN CG HG3 sing N N 42 GLN CD OE1 doub N N 43 GLN CD NE2 sing N N 44 GLN NE2 HE21 sing N N 45 GLN NE2 HE22 sing N N 46 GLN OXT HXT sing N N 47 GLU N CA sing N N 48 GLU N H sing N N 49 GLU N H2 sing N N 50 GLU CA C sing N N 51 GLU CA CB sing N N 52 GLU CA HA sing N N 53 GLU C O doub N N 54 GLU C OXT sing N N 55 GLU CB CG sing N N 56 GLU CB HB2 sing N N 57 GLU CB HB3 sing N N 58 GLU CG CD sing N N 59 GLU CG HG2 sing N N 60 GLU CG HG3 sing N N 61 GLU CD OE1 doub N N 62 GLU CD OE2 sing N N 63 GLU OE2 HE2 sing N N 64 GLU OXT HXT sing N N 65 GLY N CA sing N N 66 GLY N H sing N N 67 GLY N H2 sing N N 68 GLY CA C sing N N 69 GLY CA HA2 sing N N 70 GLY CA HA3 sing N N 71 GLY C O doub N N 72 GLY C OXT sing N N 73 GLY OXT HXT sing N N 74 ILE N CA sing N N 75 ILE N H sing N N 76 ILE N H2 sing N N 77 ILE CA C sing N N 78 ILE CA CB sing N N 79 ILE CA HA sing N N 80 ILE C O doub N N 81 ILE C OXT sing N N 82 ILE CB CG1 sing N N 83 ILE CB CG2 sing N N 84 ILE CB HB sing N N 85 ILE CG1 CD1 sing N N 86 ILE CG1 HG12 sing N N 87 ILE CG1 HG13 sing N N 88 ILE CG2 HG21 sing N N 89 ILE CG2 HG22 sing N N 90 ILE CG2 HG23 sing N N 91 ILE CD1 HD11 sing N N 92 ILE CD1 HD12 sing N N 93 ILE CD1 HD13 sing N N 94 ILE OXT HXT sing N N 95 LEU N CA sing N N 96 LEU N H sing N N 97 LEU N H2 sing N N 98 LEU CA C sing N N 99 LEU CA CB sing N N 100 LEU CA HA sing N N 101 LEU C O doub N N 102 LEU C OXT sing N N 103 LEU CB CG sing N N 104 LEU CB HB2 sing N N 105 LEU CB HB3 sing N N 106 LEU CG CD1 sing N N 107 LEU CG CD2 sing N N 108 LEU CG HG sing N N 109 LEU CD1 HD11 sing N N 110 LEU CD1 HD12 sing N N 111 LEU CD1 HD13 sing N N 112 LEU CD2 HD21 sing N N 113 LEU CD2 HD22 sing N N 114 LEU CD2 HD23 sing N N 115 LEU OXT HXT sing N N 116 LYS N CA sing N N 117 LYS N H sing N N 118 LYS N H2 sing N N 119 LYS CA C sing N N 120 LYS CA CB sing N N 121 LYS CA HA sing N N 122 LYS C O doub N N 123 LYS C OXT sing N N 124 LYS CB CG sing N N 125 LYS CB HB2 sing N N 126 LYS CB HB3 sing N N 127 LYS CG CD sing N N 128 LYS CG HG2 sing N N 129 LYS CG HG3 sing N N 130 LYS CD CE sing N N 131 LYS CD HD2 sing N N 132 LYS CD HD3 sing N N 133 LYS CE NZ sing N N 134 LYS CE HE2 sing N N 135 LYS CE HE3 sing N N 136 LYS NZ HZ1 sing N N 137 LYS NZ HZ2 sing N N 138 LYS NZ HZ3 sing N N 139 LYS OXT HXT sing N N 140 MET N CA sing N N 141 MET N H sing N N 142 MET N H2 sing N N 143 MET CA C sing N N 144 MET CA CB sing N N 145 MET CA HA sing N N 146 MET C O doub N N 147 MET C OXT sing N N 148 MET CB CG sing N N 149 MET CB HB2 sing N N 150 MET CB HB3 sing N N 151 MET CG SD sing N N 152 MET CG HG2 sing N N 153 MET CG HG3 sing N N 154 MET SD CE sing N N 155 MET CE HE1 sing N N 156 MET CE HE2 sing N N 157 MET CE HE3 sing N N 158 MET OXT HXT sing N N 159 PHE N CA sing N N 160 PHE N H sing N N 161 PHE N H2 sing N N 162 PHE CA C sing N N 163 PHE CA CB sing N N 164 PHE CA HA sing N N 165 PHE C O doub N N 166 PHE C OXT sing N N 167 PHE CB CG sing N N 168 PHE CB HB2 sing N N 169 PHE CB HB3 sing N N 170 PHE CG CD1 doub Y N 171 PHE CG CD2 sing Y N 172 PHE CD1 CE1 sing Y N 173 PHE CD1 HD1 sing N N 174 PHE CD2 CE2 doub Y N 175 PHE CD2 HD2 sing N N 176 PHE CE1 CZ doub Y N 177 PHE CE1 HE1 sing N N 178 PHE CE2 CZ sing Y N 179 PHE CE2 HE2 sing N N 180 PHE CZ HZ sing N N 181 PHE OXT HXT sing N N 182 PRO N CA sing N N 183 PRO N CD sing N N 184 PRO N H sing N N 185 PRO CA C sing N N 186 PRO CA CB sing N N 187 PRO CA HA sing N N 188 PRO C O doub N N 189 PRO C OXT sing N N 190 PRO CB CG sing N N 191 PRO CB HB2 sing N N 192 PRO CB HB3 sing N N 193 PRO CG CD sing N N 194 PRO CG HG2 sing N N 195 PRO CG HG3 sing N N 196 PRO CD HD2 sing N N 197 PRO CD HD3 sing N N 198 PRO OXT HXT sing N N 199 SER N CA sing N N 200 SER N H sing N N 201 SER N H2 sing N N 202 SER CA C sing N N 203 SER CA CB sing N N 204 SER CA HA sing N N 205 SER C O doub N N 206 SER C OXT sing N N 207 SER CB OG sing N N 208 SER CB HB2 sing N N 209 SER CB HB3 sing N N 210 SER OG HG sing N N 211 SER OXT HXT sing N N 212 THR N CA sing N N 213 THR N H sing N N 214 THR N H2 sing N N 215 THR CA C sing N N 216 THR CA CB sing N N 217 THR CA HA sing N N 218 THR C O doub N N 219 THR C OXT sing N N 220 THR CB OG1 sing N N 221 THR CB CG2 sing N N 222 THR CB HB sing N N 223 THR OG1 HG1 sing N N 224 THR CG2 HG21 sing N N 225 THR CG2 HG22 sing N N 226 THR CG2 HG23 sing N N 227 THR OXT HXT sing N N 228 TRP N CA sing N N 229 TRP N H sing N N 230 TRP N H2 sing N N 231 TRP CA C sing N N 232 TRP CA CB sing N N 233 TRP CA HA sing N N 234 TRP C O doub N N 235 TRP C OXT sing N N 236 TRP CB CG sing N N 237 TRP CB HB2 sing N N 238 TRP CB HB3 sing N N 239 TRP CG CD1 doub Y N 240 TRP CG CD2 sing Y N 241 TRP CD1 NE1 sing Y N 242 TRP CD1 HD1 sing N N 243 TRP CD2 CE2 doub Y N 244 TRP CD2 CE3 sing Y N 245 TRP NE1 CE2 sing Y N 246 TRP NE1 HE1 sing N N 247 TRP CE2 CZ2 sing Y N 248 TRP CE3 CZ3 doub Y N 249 TRP CE3 HE3 sing N N 250 TRP CZ2 CH2 doub Y N 251 TRP CZ2 HZ2 sing N N 252 TRP CZ3 CH2 sing Y N 253 TRP CZ3 HZ3 sing N N 254 TRP CH2 HH2 sing N N 255 TRP OXT HXT sing N N 256 VAL N CA sing N N 257 VAL N H sing N N 258 VAL N H2 sing N N 259 VAL CA C sing N N 260 VAL CA CB sing N N 261 VAL CA HA sing N N 262 VAL C O doub N N 263 VAL C OXT sing N N 264 VAL CB CG1 sing N N 265 VAL CB CG2 sing N N 266 VAL CB HB sing N N 267 VAL CG1 HG11 sing N N 268 VAL CG1 HG12 sing N N 269 VAL CG1 HG13 sing N N 270 VAL CG2 HG21 sing N N 271 VAL CG2 HG22 sing N N 272 VAL CG2 HG23 sing N N 273 VAL OXT HXT sing N N 274 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model VNMRS _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 5UJR _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_