data_5ULU # _entry.id 5ULU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5ULU pdb_00005ulu 10.2210/pdb5ulu/pdb WWPDB D_1000226088 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.details . _pdbx_database_related.db_id 5ULY _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5ULU _pdbx_database_status.recvd_initial_deposition_date 2017-01-25 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Jaiganesh, A.' 1 ? 'Sotomayor, M.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Structure _citation.journal_id_ASTM STRUE6 _citation.journal_id_CSD 2005 _citation.journal_id_ISSN 1878-4186 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 26 _citation.language ? _citation.page_first 1210 _citation.page_last ? _citation.title 'Zooming in on Cadherin-23: Structural Diversity and Potential Mechanisms of Inherited Deafness.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.str.2018.06.003 _citation.pdbx_database_id_PubMed 30033219 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Jaiganesh, A.' 1 ? primary 'De-la-Torre, P.' 2 ? primary 'Patel, A.A.' 3 ? primary 'Termine, D.J.' 4 ? primary 'Velez-Cortes, F.' 5 ? primary 'Chen, C.' 6 ? primary 'Sotomayor, M.' 7 ? # _cell.entry_id 5ULU _cell.length_a 84.238 _cell.length_b 65.386 _cell.length_c 114.651 _cell.angle_alpha 90.00 _cell.angle_beta 98.62 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5ULU _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Cadherin-23 37558.805 1 ? 'S2087P, D2148N' 'residues 1955-2289' ? 2 non-polymer syn 'CALCIUM ION' 40.078 6 ? ? ? ? 3 water nat water 18.015 7 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name Otocadherin # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MNHPLFTEGTYQAEVMENSPAGTPLTVLNGPILALDADEDVYAVVTYQLLGTHSDLFVIDNSTGVVTVRSGIIIDREAFS PPFLELLLLAEDIGQLNGTAHLFITILDDNDNWPTFSPPTYTVHLLENCPPGFPVLQVTATDEDSGLNGELVYRIEAGAQ DRFLIHPVTGVIRVGNATIDREEQESYRLTVVATNRGTVPLSGTAIVTILIDDINDSRPEFLNPIQTVSVLESAEPGTII ANVTAIDLDLNPKLEYHIISIVAKDDTDRLVPDQEDAFAVNINTGSVMVKSPLNRELVATYEVTLSVIDNASDLPEHSVS VPNAKLTVNILDVNDNLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MNHPLFTEGTYQAEVMENSPAGTPLTVLNGPILALDADEDVYAVVTYQLLGTHSDLFVIDNSTGVVTVRSGIIIDREAFS PPFLELLLLAEDIGQLNGTAHLFITILDDNDNWPTFSPPTYTVHLLENCPPGFPVLQVTATDEDSGLNGELVYRIEAGAQ DRFLIHPVTGVIRVGNATIDREEQESYRLTVVATNRGTVPLSGTAIVTILIDDINDSRPEFLNPIQTVSVLESAEPGTII ANVTAIDLDLNPKLEYHIISIVAKDDTDRLVPDQEDAFAVNINTGSVMVKSPLNRELVATYEVTLSVIDNASDLPEHSVS VPNAKLTVNILDVNDNLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 HIS n 1 4 PRO n 1 5 LEU n 1 6 PHE n 1 7 THR n 1 8 GLU n 1 9 GLY n 1 10 THR n 1 11 TYR n 1 12 GLN n 1 13 ALA n 1 14 GLU n 1 15 VAL n 1 16 MET n 1 17 GLU n 1 18 ASN n 1 19 SER n 1 20 PRO n 1 21 ALA n 1 22 GLY n 1 23 THR n 1 24 PRO n 1 25 LEU n 1 26 THR n 1 27 VAL n 1 28 LEU n 1 29 ASN n 1 30 GLY n 1 31 PRO n 1 32 ILE n 1 33 LEU n 1 34 ALA n 1 35 LEU n 1 36 ASP n 1 37 ALA n 1 38 ASP n 1 39 GLU n 1 40 ASP n 1 41 VAL n 1 42 TYR n 1 43 ALA n 1 44 VAL n 1 45 VAL n 1 46 THR n 1 47 TYR n 1 48 GLN n 1 49 LEU n 1 50 LEU n 1 51 GLY n 1 52 THR n 1 53 HIS n 1 54 SER n 1 55 ASP n 1 56 LEU n 1 57 PHE n 1 58 VAL n 1 59 ILE n 1 60 ASP n 1 61 ASN n 1 62 SER n 1 63 THR n 1 64 GLY n 1 65 VAL n 1 66 VAL n 1 67 THR n 1 68 VAL n 1 69 ARG n 1 70 SER n 1 71 GLY n 1 72 ILE n 1 73 ILE n 1 74 ILE n 1 75 ASP n 1 76 ARG n 1 77 GLU n 1 78 ALA n 1 79 PHE n 1 80 SER n 1 81 PRO n 1 82 PRO n 1 83 PHE n 1 84 LEU n 1 85 GLU n 1 86 LEU n 1 87 LEU n 1 88 LEU n 1 89 LEU n 1 90 ALA n 1 91 GLU n 1 92 ASP n 1 93 ILE n 1 94 GLY n 1 95 GLN n 1 96 LEU n 1 97 ASN n 1 98 GLY n 1 99 THR n 1 100 ALA n 1 101 HIS n 1 102 LEU n 1 103 PHE n 1 104 ILE n 1 105 THR n 1 106 ILE n 1 107 LEU n 1 108 ASP n 1 109 ASP n 1 110 ASN n 1 111 ASP n 1 112 ASN n 1 113 TRP n 1 114 PRO n 1 115 THR n 1 116 PHE n 1 117 SER n 1 118 PRO n 1 119 PRO n 1 120 THR n 1 121 TYR n 1 122 THR n 1 123 VAL n 1 124 HIS n 1 125 LEU n 1 126 LEU n 1 127 GLU n 1 128 ASN n 1 129 CYS n 1 130 PRO n 1 131 PRO n 1 132 GLY n 1 133 PHE n 1 134 PRO n 1 135 VAL n 1 136 LEU n 1 137 GLN n 1 138 VAL n 1 139 THR n 1 140 ALA n 1 141 THR n 1 142 ASP n 1 143 GLU n 1 144 ASP n 1 145 SER n 1 146 GLY n 1 147 LEU n 1 148 ASN n 1 149 GLY n 1 150 GLU n 1 151 LEU n 1 152 VAL n 1 153 TYR n 1 154 ARG n 1 155 ILE n 1 156 GLU n 1 157 ALA n 1 158 GLY n 1 159 ALA n 1 160 GLN n 1 161 ASP n 1 162 ARG n 1 163 PHE n 1 164 LEU n 1 165 ILE n 1 166 HIS n 1 167 PRO n 1 168 VAL n 1 169 THR n 1 170 GLY n 1 171 VAL n 1 172 ILE n 1 173 ARG n 1 174 VAL n 1 175 GLY n 1 176 ASN n 1 177 ALA n 1 178 THR n 1 179 ILE n 1 180 ASP n 1 181 ARG n 1 182 GLU n 1 183 GLU n 1 184 GLN n 1 185 GLU n 1 186 SER n 1 187 TYR n 1 188 ARG n 1 189 LEU n 1 190 THR n 1 191 VAL n 1 192 VAL n 1 193 ALA n 1 194 THR n 1 195 ASN n 1 196 ARG n 1 197 GLY n 1 198 THR n 1 199 VAL n 1 200 PRO n 1 201 LEU n 1 202 SER n 1 203 GLY n 1 204 THR n 1 205 ALA n 1 206 ILE n 1 207 VAL n 1 208 THR n 1 209 ILE n 1 210 LEU n 1 211 ILE n 1 212 ASP n 1 213 ASP n 1 214 ILE n 1 215 ASN n 1 216 ASP n 1 217 SER n 1 218 ARG n 1 219 PRO n 1 220 GLU n 1 221 PHE n 1 222 LEU n 1 223 ASN n 1 224 PRO n 1 225 ILE n 1 226 GLN n 1 227 THR n 1 228 VAL n 1 229 SER n 1 230 VAL n 1 231 LEU n 1 232 GLU n 1 233 SER n 1 234 ALA n 1 235 GLU n 1 236 PRO n 1 237 GLY n 1 238 THR n 1 239 ILE n 1 240 ILE n 1 241 ALA n 1 242 ASN n 1 243 VAL n 1 244 THR n 1 245 ALA n 1 246 ILE n 1 247 ASP n 1 248 LEU n 1 249 ASP n 1 250 LEU n 1 251 ASN n 1 252 PRO n 1 253 LYS n 1 254 LEU n 1 255 GLU n 1 256 TYR n 1 257 HIS n 1 258 ILE n 1 259 ILE n 1 260 SER n 1 261 ILE n 1 262 VAL n 1 263 ALA n 1 264 LYS n 1 265 ASP n 1 266 ASP n 1 267 THR n 1 268 ASP n 1 269 ARG n 1 270 LEU n 1 271 VAL n 1 272 PRO n 1 273 ASP n 1 274 GLN n 1 275 GLU n 1 276 ASP n 1 277 ALA n 1 278 PHE n 1 279 ALA n 1 280 VAL n 1 281 ASN n 1 282 ILE n 1 283 ASN n 1 284 THR n 1 285 GLY n 1 286 SER n 1 287 VAL n 1 288 MET n 1 289 VAL n 1 290 LYS n 1 291 SER n 1 292 PRO n 1 293 LEU n 1 294 ASN n 1 295 ARG n 1 296 GLU n 1 297 LEU n 1 298 VAL n 1 299 ALA n 1 300 THR n 1 301 TYR n 1 302 GLU n 1 303 VAL n 1 304 THR n 1 305 LEU n 1 306 SER n 1 307 VAL n 1 308 ILE n 1 309 ASP n 1 310 ASN n 1 311 ALA n 1 312 SER n 1 313 ASP n 1 314 LEU n 1 315 PRO n 1 316 GLU n 1 317 HIS n 1 318 SER n 1 319 VAL n 1 320 SER n 1 321 VAL n 1 322 PRO n 1 323 ASN n 1 324 ALA n 1 325 LYS n 1 326 LEU n 1 327 THR n 1 328 VAL n 1 329 ASN n 1 330 ILE n 1 331 LEU n 1 332 ASP n 1 333 VAL n 1 334 ASN n 1 335 ASP n 1 336 ASN n 1 337 LEU n 1 338 GLU n 1 339 HIS n 1 340 HIS n 1 341 HIS n 1 342 HIS n 1 343 HIS n 1 344 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 344 _entity_src_gen.gene_src_common_name Mouse _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Cdh23 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21-RIPL _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pet-21a+ _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CAD23_MOUSE _struct_ref.pdbx_db_accession Q99PF4 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;NHPLFTEGTYQAEVMENSPAGTPLTVLNGPILALDADEDVYAVVTYQLLGTHSDLFVIDNSTGVVTVRSGIIIDREAFSP PFLELLLLAEDIGQLNGTAHLFITILDDNDNWPTFSPPTYTVHLLENCPPGFSVLQVTATDEDSGLNGELVYRIEAGAQD RFLIHPVTGVIRVGNATIDREEQESYRLTVVATDRGTVPLSGTAIVTILIDDINDSRPEFLNPIQTVSVLESAEPGTIIA NVTAIDLDLNPKLEYHIISIVAKDDTDRLVPDQEDAFAVNINTGSVMVKSPLNRELVATYEVTLSVIDNASDLPEHSVSV PNAKLTVNILDVNDN ; _struct_ref.pdbx_align_begin 1955 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5ULU _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 336 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q99PF4 _struct_ref_seq.db_align_beg 1955 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 2289 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1932 _struct_ref_seq.pdbx_auth_seq_align_end 2266 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5ULU MET A 1 ? UNP Q99PF4 ? ? 'initiating methionine' 1931 1 1 5ULU PRO A 134 ? UNP Q99PF4 SER 2087 'engineered mutation' 2064 2 1 5ULU ASN A 195 ? UNP Q99PF4 ASP 2148 'engineered mutation' 2125 3 1 5ULU LEU A 337 ? UNP Q99PF4 ? ? 'expression tag' 2267 4 1 5ULU GLU A 338 ? UNP Q99PF4 ? ? 'expression tag' 2268 5 1 5ULU HIS A 339 ? UNP Q99PF4 ? ? 'expression tag' 2269 6 1 5ULU HIS A 340 ? UNP Q99PF4 ? ? 'expression tag' 2270 7 1 5ULU HIS A 341 ? UNP Q99PF4 ? ? 'expression tag' 2271 8 1 5ULU HIS A 342 ? UNP Q99PF4 ? ? 'expression tag' 2272 9 1 5ULU HIS A 343 ? UNP Q99PF4 ? ? 'expression tag' 2273 10 1 5ULU HIS A 344 ? UNP Q99PF4 ? ? 'expression tag' 2274 11 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5ULU _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 4.16 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 70.43 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.1 M Tris pH 8.5 0.05M MgCl2 25% MPD ; _exptl_crystal_grow.pdbx_pH_range 7.5-8.5 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-07-10 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9791 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-C' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9791 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-C _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 73 _reflns.entry_id 5ULU _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.85 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14561 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 95.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.1 _reflns.pdbx_Rmerge_I_obs 0.068 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 15.74 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all .081 _reflns.pdbx_Rpim_I_all .044 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.85 _reflns_shell.d_res_low 2.9 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.375 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 556 _reflns_shell.percent_possible_all 77.3 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs .181 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 2.3 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared 1.089 _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all .224 _reflns_shell.pdbx_Rpim_I_all .13 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half .97 _reflns_shell.pdbx_R_split ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 5ULU _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 13292 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 30.337 _refine.ls_d_res_high 2.85 _refine.ls_percent_reflns_obs 95.22 _refine.ls_R_factor_obs 0.19771 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.19549 _refine.ls_R_factor_R_free 0.24429 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.6 _refine.ls_number_reflns_R_free 645 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.958 _refine.correlation_coeff_Fo_to_Fc_free 0.934 _refine.B_iso_mean 103.515 _refine.aniso_B[1][1] 5.47 _refine.aniso_B[2][2] 8.66 _refine.aniso_B[3][3] -13.39 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] -0.42 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model 5I8D _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.484 _refine.pdbx_overall_ESU_R_Free 0.309 _refine.overall_SU_ML 0.302 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 37.953 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 2443 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 6 _refine_hist.number_atoms_solvent 7 _refine_hist.number_atoms_total 2456 _refine_hist.d_res_high 2.85 _refine_hist.d_res_low 30.337 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.011 0.019 ? 2488 'X-RAY DIFFRACTION' ? r_bond_other_d 0.002 0.020 ? 2311 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.456 1.972 ? 3412 'X-RAY DIFFRACTION' ? r_angle_other_deg 0.926 3.000 ? 5371 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 7.865 5.000 ? 318 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 39.778 25.741 ? 108 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 16.264 15.000 ? 389 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 14.654 15.000 ? 11 'X-RAY DIFFRACTION' ? r_chiral_restr 0.081 0.200 ? 427 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.006 0.021 ? 2750 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.002 0.020 ? 437 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 2.619 7.132 ? 1278 'X-RAY DIFFRACTION' ? r_mcbond_other 2.620 7.131 ? 1277 'X-RAY DIFFRACTION' ? r_mcangle_it 4.130 10.701 ? 1594 'X-RAY DIFFRACTION' ? r_mcangle_other 4.128 10.702 ? 1595 'X-RAY DIFFRACTION' ? r_scbond_it 2.390 7.333 ? 1210 'X-RAY DIFFRACTION' ? r_scbond_other 2.387 7.330 ? 1208 'X-RAY DIFFRACTION' ? r_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_other 3.981 10.917 ? 1818 'X-RAY DIFFRACTION' ? r_long_range_B_refined 6.047 85.024 ? 2553 'X-RAY DIFFRACTION' ? r_long_range_B_other 6.046 85.042 ? 2553 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.848 _refine_ls_shell.d_res_low 2.922 _refine_ls_shell.number_reflns_R_work 770 _refine_ls_shell.R_factor_R_work 0.372 _refine_ls_shell.percent_reflns_obs 74.31 _refine_ls_shell.R_factor_R_free 0.359 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 34 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.number_reflns_obs ? # _struct.entry_id 5ULU _struct.title 'Crystal Structure of Mouse Cadherin-23 EC19-21 (S2087P) with non-syndromic deafness (DFNB12) associated mutation D2148N' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5ULU _struct_keywords.text 'hearing, mechanotransduction, adhesion, calcium-binding protein, CELL ADHESION' _struct_keywords.pdbx_keywords 'CELL ADHESION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 2 ? G N N 2 ? H N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 51 ? ASP A 55 ? GLY A 1981 ASP A 1985 5 ? 5 HELX_P HELX_P2 AA2 ASP A 75 ? PHE A 79 ? ASP A 2005 PHE A 2009 5 ? 5 HELX_P HELX_P3 AA3 SER A 145 ? GLU A 150 ? SER A 2075 GLU A 2080 5 ? 6 HELX_P HELX_P4 AA4 LEU A 314 ? SER A 318 ? LEU A 2244 SER A 2248 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLU 17 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 1947 A CA 2301 1_555 ? ? ? ? ? ? ? 2.459 ? ? metalc2 metalc ? ? A GLU 17 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 1947 A CA 2302 1_555 ? ? ? ? ? ? ? 2.115 ? ? metalc3 metalc ? ? A ASP 75 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 2005 A CA 2301 1_555 ? ? ? ? ? ? ? 2.626 ? ? metalc4 metalc ? ? A GLU 77 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 2007 A CA 2301 1_555 ? ? ? ? ? ? ? 2.286 ? ? metalc5 metalc ? ? A GLU 77 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 2007 A CA 2302 1_555 ? ? ? ? ? ? ? 2.613 ? ? metalc6 metalc ? ? A GLU 77 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 2007 A CA 2302 1_555 ? ? ? ? ? ? ? 2.424 ? ? metalc7 metalc ? ? A ASP 108 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 2038 A CA 2302 1_555 ? ? ? ? ? ? ? 2.317 ? ? metalc8 metalc ? ? A ASP 109 O ? ? ? 1_555 C CA . CA ? ? A ASP 2039 A CA 2302 1_555 ? ? ? ? ? ? ? 2.304 ? ? metalc9 metalc ? ? A ASN 110 OD1 ? ? ? 1_555 D CA . CA ? ? A ASN 2040 A CA 2303 1_555 ? ? ? ? ? ? ? 2.143 ? ? metalc10 metalc ? ? A ASP 111 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 2041 A CA 2301 1_555 ? ? ? ? ? ? ? 2.945 ? ? metalc11 metalc ? ? A ASP 111 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 2041 A CA 2301 1_555 ? ? ? ? ? ? ? 2.665 ? ? metalc12 metalc ? ? A ASP 111 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 2041 A CA 2302 1_555 ? ? ? ? ? ? ? 2.594 ? ? metalc13 metalc ? ? A ASN 112 O ? ? ? 1_555 D CA . CA ? ? A ASN 2042 A CA 2303 1_555 ? ? ? ? ? ? ? 2.213 ? ? metalc14 metalc ? ? A GLU 127 OE2 ? ? ? 1_555 E CA . CA ? ? A GLU 2057 A CA 2304 1_555 ? ? ? ? ? ? ? 2.522 ? ? metalc15 metalc ? ? A GLU 127 OE1 ? ? ? 1_555 F CA . CA ? ? A GLU 2057 A CA 2305 1_555 ? ? ? ? ? ? ? 2.248 ? ? metalc16 metalc ? ? A ASP 142 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 2072 A CA 2303 1_555 ? ? ? ? ? ? ? 2.427 ? ? metalc17 metalc ? ? A ASP 142 OD2 ? ? ? 1_555 D CA . CA ? ? A ASP 2072 A CA 2303 1_555 ? ? ? ? ? ? ? 2.442 ? ? metalc18 metalc ? ? A ASP 144 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 2074 A CA 2302 1_555 ? ? ? ? ? ? ? 2.330 ? ? metalc19 metalc ? ? A ASP 144 OD2 ? ? ? 1_555 D CA . CA ? ? A ASP 2074 A CA 2303 1_555 ? ? ? ? ? ? ? 2.238 ? ? metalc20 metalc ? ? A ASN 148 O ? ? ? 1_555 D CA . CA ? ? A ASN 2078 A CA 2303 1_555 ? ? ? ? ? ? ? 2.516 ? ? metalc21 metalc ? ? A ASP 180 OD1 ? ? ? 1_555 E CA . CA ? ? A ASP 2110 A CA 2304 1_555 ? ? ? ? ? ? ? 1.977 ? ? metalc22 metalc ? ? A GLU 182 OE2 ? ? ? 1_555 E CA . CA ? ? A GLU 2112 A CA 2304 1_555 ? ? ? ? ? ? ? 2.373 ? ? metalc23 metalc ? ? A GLU 182 OE1 ? ? ? 1_555 F CA . CA ? ? A GLU 2112 A CA 2305 1_555 ? ? ? ? ? ? ? 2.040 ? ? metalc24 metalc ? ? A GLU 182 OE2 ? ? ? 1_555 F CA . CA ? ? A GLU 2112 A CA 2305 1_555 ? ? ? ? ? ? ? 2.733 ? ? metalc25 metalc ? ? A ASN 195 OD1 ? ? ? 1_555 D CA . CA ? ? A ASN 2125 A CA 2303 1_555 ? ? ? ? ? ? ? 2.532 ? ? metalc26 metalc ? ? A ASP 213 OD1 ? ? ? 1_555 F CA . CA ? ? A ASP 2143 A CA 2305 1_555 ? ? ? ? ? ? ? 2.402 ? ? metalc27 metalc ? ? A ILE 214 O ? ? ? 1_555 F CA . CA ? ? A ILE 2144 A CA 2305 1_555 ? ? ? ? ? ? ? 2.139 ? ? metalc28 metalc ? ? A ASN 215 OD1 ? ? ? 1_555 G CA . CA ? ? A ASN 2145 A CA 2306 1_555 ? ? ? ? ? ? ? 2.174 ? ? metalc29 metalc ? ? A ASP 216 OD1 ? ? ? 1_555 E CA . CA ? ? A ASP 2146 A CA 2304 1_555 ? ? ? ? ? ? ? 2.519 ? ? metalc30 metalc ? ? A ASP 216 OD2 ? ? ? 1_555 E CA . CA ? ? A ASP 2146 A CA 2304 1_555 ? ? ? ? ? ? ? 2.241 ? ? metalc31 metalc ? ? A ASP 216 OD1 ? ? ? 1_555 F CA . CA ? ? A ASP 2146 A CA 2305 1_555 ? ? ? ? ? ? ? 2.612 ? ? metalc32 metalc ? ? A SER 217 O ? ? ? 1_555 G CA . CA ? ? A SER 2147 A CA 2306 1_555 ? ? ? ? ? ? ? 2.424 ? ? metalc33 metalc ? ? A ASP 247 OD1 ? ? ? 1_555 G CA . CA ? ? A ASP 2177 A CA 2306 1_555 ? ? ? ? ? ? ? 2.810 ? ? metalc34 metalc ? ? A ASP 247 OD2 ? ? ? 1_555 G CA . CA ? ? A ASP 2177 A CA 2306 1_555 ? ? ? ? ? ? ? 2.200 ? ? metalc35 metalc ? ? A ASP 249 OD1 ? ? ? 1_555 F CA . CA ? ? A ASP 2179 A CA 2305 1_555 ? ? ? ? ? ? ? 2.292 ? ? metalc36 metalc ? ? A ASP 249 OD2 ? ? ? 1_555 G CA . CA ? ? A ASP 2179 A CA 2306 1_555 ? ? ? ? ? ? ? 2.569 ? ? metalc37 metalc ? ? A ASP 309 OD2 ? ? ? 1_555 G CA . CA ? ? A ASP 2239 A CA 2306 1_555 ? ? ? ? ? ? ? 2.185 ? ? metalc38 metalc ? ? B CA . CA ? ? ? 1_555 H HOH . O ? ? A CA 2301 A HOH 2403 1_555 ? ? ? ? ? ? ? 2.102 ? ? metalc39 metalc ? ? B CA . CA ? ? ? 1_555 H HOH . O ? ? A CA 2301 A HOH 2404 1_555 ? ? ? ? ? ? ? 2.429 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLY 30 A . ? GLY 1960 A PRO 31 A ? PRO 1961 A 1 0.32 2 SER 80 A . ? SER 2010 A PRO 81 A ? PRO 2011 A 1 7.05 3 SER 117 A . ? SER 2047 A PRO 118 A ? PRO 2048 A 1 1.36 4 VAL 321 A . ? VAL 2251 A PRO 322 A ? PRO 2252 A 1 5.19 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 4 ? AA4 ? 3 ? AA5 ? 2 ? AA6 ? 4 ? AA7 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA5 1 2 ? anti-parallel AA6 1 2 ? parallel AA6 2 3 ? anti-parallel AA6 3 4 ? anti-parallel AA7 1 2 ? anti-parallel AA7 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 26 ? VAL A 27 ? THR A 1956 VAL A 1957 AA1 2 THR A 10 ? MET A 16 ? THR A 1940 MET A 1946 AA1 3 ASN A 97 ? LEU A 107 ? ASN A 2027 LEU A 2037 AA1 4 PHE A 83 ? GLU A 91 ? PHE A 2013 GLU A 2021 AA1 5 GLN A 48 ? LEU A 50 ? GLN A 1978 LEU A 1980 AA2 1 PHE A 57 ? ILE A 59 ? PHE A 1987 ILE A 1989 AA2 2 VAL A 66 ? VAL A 68 ? VAL A 1996 VAL A 1998 AA3 1 THR A 120 ? LEU A 126 ? THR A 2050 LEU A 2056 AA3 2 SER A 202 ? ASP A 212 ? SER A 2132 ASP A 2142 AA3 3 SER A 186 ? THR A 194 ? SER A 2116 THR A 2124 AA3 4 VAL A 152 ? ALA A 157 ? VAL A 2082 ALA A 2087 AA4 1 PRO A 134 ? GLN A 137 ? PRO A 2064 GLN A 2067 AA4 2 VAL A 171 ? VAL A 174 ? VAL A 2101 VAL A 2104 AA4 3 PHE A 163 ? ILE A 165 ? PHE A 2093 ILE A 2095 AA5 1 GLU A 220 ? PHE A 221 ? GLU A 2150 PHE A 2151 AA5 2 ALA A 245 ? ILE A 246 ? ALA A 2175 ILE A 2176 AA6 1 ILE A 225 ? LEU A 231 ? ILE A 2155 LEU A 2161 AA6 2 ALA A 324 ? LEU A 331 ? ALA A 2254 LEU A 2261 AA6 3 THR A 300 ? ASP A 309 ? THR A 2230 ASP A 2239 AA6 4 LEU A 254 ? LYS A 264 ? LEU A 2184 LYS A 2194 AA7 1 ILE A 239 ? ASN A 242 ? ILE A 2169 ASN A 2172 AA7 2 SER A 286 ? VAL A 289 ? SER A 2216 VAL A 2219 AA7 3 PHE A 278 ? VAL A 280 ? PHE A 2208 VAL A 2210 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O THR A 26 ? O THR A 1956 N GLU A 14 ? N GLU A 1944 AA1 2 3 N TYR A 11 ? N TYR A 1941 O HIS A 101 ? O HIS A 2031 AA1 3 4 O ALA A 100 ? O ALA A 2030 N LEU A 88 ? N LEU A 2018 AA1 4 5 O LEU A 87 ? O LEU A 2017 N LEU A 50 ? N LEU A 1980 AA2 1 2 N VAL A 58 ? N VAL A 1988 O THR A 67 ? O THR A 1997 AA3 1 2 N TYR A 121 ? N TYR A 2051 O ILE A 206 ? O ILE A 2136 AA3 2 3 O VAL A 207 ? O VAL A 2137 N LEU A 189 ? N LEU A 2119 AA3 3 4 O THR A 190 ? O THR A 2120 N ALA A 157 ? N ALA A 2087 AA4 1 2 N LEU A 136 ? N LEU A 2066 O ILE A 172 ? O ILE A 2102 AA4 2 3 O ARG A 173 ? O ARG A 2103 N LEU A 164 ? N LEU A 2094 AA5 1 2 N GLU A 220 ? N GLU A 2150 O ILE A 246 ? O ILE A 2176 AA6 1 2 N VAL A 230 ? N VAL A 2160 O ASN A 329 ? O ASN A 2259 AA6 2 3 O ALA A 324 ? O ALA A 2254 N LEU A 305 ? N LEU A 2235 AA6 3 4 O THR A 304 ? O THR A 2234 N ILE A 259 ? N ILE A 2189 AA7 1 2 N ALA A 241 ? N ALA A 2171 O VAL A 287 ? O VAL A 2217 AA7 2 3 O MET A 288 ? O MET A 2218 N ALA A 279 ? N ALA A 2209 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 2301 ? 6 'binding site for residue CA A 2301' AC2 Software A CA 2302 ? 6 'binding site for residue CA A 2302' AC3 Software A CA 2303 ? 6 'binding site for residue CA A 2303' AC4 Software A CA 2304 ? 4 'binding site for residue CA A 2304' AC5 Software A CA 2305 ? 6 'binding site for residue CA A 2305' AC6 Software A CA 2306 ? 5 'binding site for residue CA A 2306' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 GLU A 17 ? GLU A 1947 . ? 1_555 ? 2 AC1 6 ASP A 75 ? ASP A 2005 . ? 1_555 ? 3 AC1 6 GLU A 77 ? GLU A 2007 . ? 1_555 ? 4 AC1 6 ASP A 111 ? ASP A 2041 . ? 1_555 ? 5 AC1 6 HOH H . ? HOH A 2403 . ? 1_555 ? 6 AC1 6 HOH H . ? HOH A 2404 . ? 1_555 ? 7 AC2 6 GLU A 17 ? GLU A 1947 . ? 1_555 ? 8 AC2 6 GLU A 77 ? GLU A 2007 . ? 1_555 ? 9 AC2 6 ASP A 108 ? ASP A 2038 . ? 1_555 ? 10 AC2 6 ASP A 109 ? ASP A 2039 . ? 1_555 ? 11 AC2 6 ASP A 111 ? ASP A 2041 . ? 1_555 ? 12 AC2 6 ASP A 144 ? ASP A 2074 . ? 1_555 ? 13 AC3 6 ASN A 110 ? ASN A 2040 . ? 1_555 ? 14 AC3 6 ASN A 112 ? ASN A 2042 . ? 1_555 ? 15 AC3 6 ASP A 142 ? ASP A 2072 . ? 1_555 ? 16 AC3 6 ASP A 144 ? ASP A 2074 . ? 1_555 ? 17 AC3 6 ASN A 148 ? ASN A 2078 . ? 1_555 ? 18 AC3 6 ASN A 195 ? ASN A 2125 . ? 1_555 ? 19 AC4 4 GLU A 127 ? GLU A 2057 . ? 1_555 ? 20 AC4 4 ASP A 180 ? ASP A 2110 . ? 1_555 ? 21 AC4 4 GLU A 182 ? GLU A 2112 . ? 1_555 ? 22 AC4 4 ASP A 216 ? ASP A 2146 . ? 1_555 ? 23 AC5 6 GLU A 127 ? GLU A 2057 . ? 1_555 ? 24 AC5 6 GLU A 182 ? GLU A 2112 . ? 1_555 ? 25 AC5 6 ASP A 213 ? ASP A 2143 . ? 1_555 ? 26 AC5 6 ILE A 214 ? ILE A 2144 . ? 1_555 ? 27 AC5 6 ASP A 216 ? ASP A 2146 . ? 1_555 ? 28 AC5 6 ASP A 249 ? ASP A 2179 . ? 1_555 ? 29 AC6 5 ASN A 215 ? ASN A 2145 . ? 1_555 ? 30 AC6 5 SER A 217 ? SER A 2147 . ? 1_555 ? 31 AC6 5 ASP A 247 ? ASP A 2177 . ? 1_555 ? 32 AC6 5 ASP A 249 ? ASP A 2179 . ? 1_555 ? 33 AC6 5 ASP A 309 ? ASP A 2239 . ? 1_555 ? # _atom_sites.entry_id 5ULU _atom_sites.fract_transf_matrix[1][1] 0.011871 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.001800 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015294 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008822 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1931 ? ? ? A . n A 1 2 ASN 2 1932 ? ? ? A . n A 1 3 HIS 3 1933 ? ? ? A . n A 1 4 PRO 4 1934 1934 PRO PRO A . n A 1 5 LEU 5 1935 1935 LEU LEU A . n A 1 6 PHE 6 1936 1936 PHE PHE A . n A 1 7 THR 7 1937 1937 THR THR A . n A 1 8 GLU 8 1938 1938 GLU GLU A . n A 1 9 GLY 9 1939 1939 GLY GLY A . n A 1 10 THR 10 1940 1940 THR THR A . n A 1 11 TYR 11 1941 1941 TYR TYR A . n A 1 12 GLN 12 1942 1942 GLN GLN A . n A 1 13 ALA 13 1943 1943 ALA ALA A . n A 1 14 GLU 14 1944 1944 GLU GLU A . n A 1 15 VAL 15 1945 1945 VAL VAL A . n A 1 16 MET 16 1946 1946 MET MET A . n A 1 17 GLU 17 1947 1947 GLU GLU A . n A 1 18 ASN 18 1948 1948 ASN ASN A . n A 1 19 SER 19 1949 1949 SER SER A . n A 1 20 PRO 20 1950 1950 PRO PRO A . n A 1 21 ALA 21 1951 1951 ALA ALA A . n A 1 22 GLY 22 1952 1952 GLY GLY A . n A 1 23 THR 23 1953 1953 THR THR A . n A 1 24 PRO 24 1954 1954 PRO PRO A . n A 1 25 LEU 25 1955 1955 LEU LEU A . n A 1 26 THR 26 1956 1956 THR THR A . n A 1 27 VAL 27 1957 1957 VAL VAL A . n A 1 28 LEU 28 1958 1958 LEU LEU A . n A 1 29 ASN 29 1959 1959 ASN ASN A . n A 1 30 GLY 30 1960 1960 GLY GLY A . n A 1 31 PRO 31 1961 1961 PRO PRO A . n A 1 32 ILE 32 1962 1962 ILE ILE A . n A 1 33 LEU 33 1963 1963 LEU LEU A . n A 1 34 ALA 34 1964 1964 ALA ALA A . n A 1 35 LEU 35 1965 1965 LEU LEU A . n A 1 36 ASP 36 1966 ? ? ? A . n A 1 37 ALA 37 1967 ? ? ? A . n A 1 38 ASP 38 1968 ? ? ? A . n A 1 39 GLU 39 1969 ? ? ? A . n A 1 40 ASP 40 1970 ? ? ? A . n A 1 41 VAL 41 1971 ? ? ? A . n A 1 42 TYR 42 1972 ? ? ? A . n A 1 43 ALA 43 1973 ? ? ? A . n A 1 44 VAL 44 1974 ? ? ? A . n A 1 45 VAL 45 1975 1975 VAL VAL A . n A 1 46 THR 46 1976 1976 THR THR A . n A 1 47 TYR 47 1977 1977 TYR TYR A . n A 1 48 GLN 48 1978 1978 GLN GLN A . n A 1 49 LEU 49 1979 1979 LEU LEU A . n A 1 50 LEU 50 1980 1980 LEU LEU A . n A 1 51 GLY 51 1981 1981 GLY GLY A . n A 1 52 THR 52 1982 1982 THR THR A . n A 1 53 HIS 53 1983 1983 HIS HIS A . n A 1 54 SER 54 1984 1984 SER SER A . n A 1 55 ASP 55 1985 1985 ASP ASP A . n A 1 56 LEU 56 1986 1986 LEU LEU A . n A 1 57 PHE 57 1987 1987 PHE PHE A . n A 1 58 VAL 58 1988 1988 VAL VAL A . n A 1 59 ILE 59 1989 1989 ILE ILE A . n A 1 60 ASP 60 1990 1990 ASP ASP A . n A 1 61 ASN 61 1991 1991 ASN ASN A . n A 1 62 SER 62 1992 1992 SER SER A . n A 1 63 THR 63 1993 1993 THR THR A . n A 1 64 GLY 64 1994 1994 GLY GLY A . n A 1 65 VAL 65 1995 1995 VAL VAL A . n A 1 66 VAL 66 1996 1996 VAL VAL A . n A 1 67 THR 67 1997 1997 THR THR A . n A 1 68 VAL 68 1998 1998 VAL VAL A . n A 1 69 ARG 69 1999 1999 ARG ARG A . n A 1 70 SER 70 2000 2000 SER SER A . n A 1 71 GLY 71 2001 2001 GLY GLY A . n A 1 72 ILE 72 2002 2002 ILE ILE A . n A 1 73 ILE 73 2003 2003 ILE ILE A . n A 1 74 ILE 74 2004 2004 ILE ILE A . n A 1 75 ASP 75 2005 2005 ASP ASP A . n A 1 76 ARG 76 2006 2006 ARG ARG A . n A 1 77 GLU 77 2007 2007 GLU GLU A . n A 1 78 ALA 78 2008 2008 ALA ALA A . n A 1 79 PHE 79 2009 2009 PHE PHE A . n A 1 80 SER 80 2010 2010 SER SER A . n A 1 81 PRO 81 2011 2011 PRO PRO A . n A 1 82 PRO 82 2012 2012 PRO PRO A . n A 1 83 PHE 83 2013 2013 PHE PHE A . n A 1 84 LEU 84 2014 2014 LEU LEU A . n A 1 85 GLU 85 2015 2015 GLU GLU A . n A 1 86 LEU 86 2016 2016 LEU LEU A . n A 1 87 LEU 87 2017 2017 LEU LEU A . n A 1 88 LEU 88 2018 2018 LEU LEU A . n A 1 89 LEU 89 2019 2019 LEU LEU A . n A 1 90 ALA 90 2020 2020 ALA ALA A . n A 1 91 GLU 91 2021 2021 GLU GLU A . n A 1 92 ASP 92 2022 2022 ASP ASP A . n A 1 93 ILE 93 2023 2023 ILE ILE A . n A 1 94 GLY 94 2024 2024 GLY GLY A . n A 1 95 GLN 95 2025 2025 GLN GLN A . n A 1 96 LEU 96 2026 2026 LEU LEU A . n A 1 97 ASN 97 2027 2027 ASN ASN A . n A 1 98 GLY 98 2028 2028 GLY GLY A . n A 1 99 THR 99 2029 2029 THR THR A . n A 1 100 ALA 100 2030 2030 ALA ALA A . n A 1 101 HIS 101 2031 2031 HIS HIS A . n A 1 102 LEU 102 2032 2032 LEU LEU A . n A 1 103 PHE 103 2033 2033 PHE PHE A . n A 1 104 ILE 104 2034 2034 ILE ILE A . n A 1 105 THR 105 2035 2035 THR THR A . n A 1 106 ILE 106 2036 2036 ILE ILE A . n A 1 107 LEU 107 2037 2037 LEU LEU A . n A 1 108 ASP 108 2038 2038 ASP ASP A . n A 1 109 ASP 109 2039 2039 ASP ASP A . n A 1 110 ASN 110 2040 2040 ASN ASN A . n A 1 111 ASP 111 2041 2041 ASP ASP A . n A 1 112 ASN 112 2042 2042 ASN ASN A . n A 1 113 TRP 113 2043 2043 TRP TRP A . n A 1 114 PRO 114 2044 2044 PRO PRO A . n A 1 115 THR 115 2045 2045 THR THR A . n A 1 116 PHE 116 2046 2046 PHE PHE A . n A 1 117 SER 117 2047 2047 SER SER A . n A 1 118 PRO 118 2048 2048 PRO PRO A . n A 1 119 PRO 119 2049 2049 PRO PRO A . n A 1 120 THR 120 2050 2050 THR THR A . n A 1 121 TYR 121 2051 2051 TYR TYR A . n A 1 122 THR 122 2052 2052 THR THR A . n A 1 123 VAL 123 2053 2053 VAL VAL A . n A 1 124 HIS 124 2054 2054 HIS HIS A . n A 1 125 LEU 125 2055 2055 LEU LEU A . n A 1 126 LEU 126 2056 2056 LEU LEU A . n A 1 127 GLU 127 2057 2057 GLU GLU A . n A 1 128 ASN 128 2058 2058 ASN ASN A . n A 1 129 CYS 129 2059 2059 CYS CYS A . n A 1 130 PRO 130 2060 2060 PRO PRO A . n A 1 131 PRO 131 2061 2061 PRO PRO A . n A 1 132 GLY 132 2062 2062 GLY GLY A . n A 1 133 PHE 133 2063 2063 PHE PHE A . n A 1 134 PRO 134 2064 2064 PRO PRO A . n A 1 135 VAL 135 2065 2065 VAL VAL A . n A 1 136 LEU 136 2066 2066 LEU LEU A . n A 1 137 GLN 137 2067 2067 GLN GLN A . n A 1 138 VAL 138 2068 2068 VAL VAL A . n A 1 139 THR 139 2069 2069 THR THR A . n A 1 140 ALA 140 2070 2070 ALA ALA A . n A 1 141 THR 141 2071 2071 THR THR A . n A 1 142 ASP 142 2072 2072 ASP ASP A . n A 1 143 GLU 143 2073 2073 GLU GLU A . n A 1 144 ASP 144 2074 2074 ASP ASP A . n A 1 145 SER 145 2075 2075 SER SER A . n A 1 146 GLY 146 2076 2076 GLY GLY A . n A 1 147 LEU 147 2077 2077 LEU LEU A . n A 1 148 ASN 148 2078 2078 ASN ASN A . n A 1 149 GLY 149 2079 2079 GLY GLY A . n A 1 150 GLU 150 2080 2080 GLU GLU A . n A 1 151 LEU 151 2081 2081 LEU LEU A . n A 1 152 VAL 152 2082 2082 VAL VAL A . n A 1 153 TYR 153 2083 2083 TYR TYR A . n A 1 154 ARG 154 2084 2084 ARG ARG A . n A 1 155 ILE 155 2085 2085 ILE ILE A . n A 1 156 GLU 156 2086 2086 GLU GLU A . n A 1 157 ALA 157 2087 2087 ALA ALA A . n A 1 158 GLY 158 2088 2088 GLY GLY A . n A 1 159 ALA 159 2089 2089 ALA ALA A . n A 1 160 GLN 160 2090 2090 GLN GLN A . n A 1 161 ASP 161 2091 2091 ASP ASP A . n A 1 162 ARG 162 2092 2092 ARG ARG A . n A 1 163 PHE 163 2093 2093 PHE PHE A . n A 1 164 LEU 164 2094 2094 LEU LEU A . n A 1 165 ILE 165 2095 2095 ILE ILE A . n A 1 166 HIS 166 2096 2096 HIS HIS A . n A 1 167 PRO 167 2097 2097 PRO PRO A . n A 1 168 VAL 168 2098 2098 VAL VAL A . n A 1 169 THR 169 2099 2099 THR THR A . n A 1 170 GLY 170 2100 2100 GLY GLY A . n A 1 171 VAL 171 2101 2101 VAL VAL A . n A 1 172 ILE 172 2102 2102 ILE ILE A . n A 1 173 ARG 173 2103 2103 ARG ARG A . n A 1 174 VAL 174 2104 2104 VAL VAL A . n A 1 175 GLY 175 2105 2105 GLY GLY A . n A 1 176 ASN 176 2106 2106 ASN ASN A . n A 1 177 ALA 177 2107 2107 ALA ALA A . n A 1 178 THR 178 2108 2108 THR THR A . n A 1 179 ILE 179 2109 2109 ILE ILE A . n A 1 180 ASP 180 2110 2110 ASP ASP A . n A 1 181 ARG 181 2111 2111 ARG ARG A . n A 1 182 GLU 182 2112 2112 GLU GLU A . n A 1 183 GLU 183 2113 2113 GLU GLU A . n A 1 184 GLN 184 2114 2114 GLN GLN A . n A 1 185 GLU 185 2115 2115 GLU GLU A . n A 1 186 SER 186 2116 2116 SER SER A . n A 1 187 TYR 187 2117 2117 TYR TYR A . n A 1 188 ARG 188 2118 2118 ARG ARG A . n A 1 189 LEU 189 2119 2119 LEU LEU A . n A 1 190 THR 190 2120 2120 THR THR A . n A 1 191 VAL 191 2121 2121 VAL VAL A . n A 1 192 VAL 192 2122 2122 VAL VAL A . n A 1 193 ALA 193 2123 2123 ALA ALA A . n A 1 194 THR 194 2124 2124 THR THR A . n A 1 195 ASN 195 2125 2125 ASN ASN A . n A 1 196 ARG 196 2126 2126 ARG ARG A . n A 1 197 GLY 197 2127 2127 GLY GLY A . n A 1 198 THR 198 2128 2128 THR THR A . n A 1 199 VAL 199 2129 2129 VAL VAL A . n A 1 200 PRO 200 2130 2130 PRO PRO A . n A 1 201 LEU 201 2131 2131 LEU LEU A . n A 1 202 SER 202 2132 2132 SER SER A . n A 1 203 GLY 203 2133 2133 GLY GLY A . n A 1 204 THR 204 2134 2134 THR THR A . n A 1 205 ALA 205 2135 2135 ALA ALA A . n A 1 206 ILE 206 2136 2136 ILE ILE A . n A 1 207 VAL 207 2137 2137 VAL VAL A . n A 1 208 THR 208 2138 2138 THR THR A . n A 1 209 ILE 209 2139 2139 ILE ILE A . n A 1 210 LEU 210 2140 2140 LEU LEU A . n A 1 211 ILE 211 2141 2141 ILE ILE A . n A 1 212 ASP 212 2142 2142 ASP ASP A . n A 1 213 ASP 213 2143 2143 ASP ASP A . n A 1 214 ILE 214 2144 2144 ILE ILE A . n A 1 215 ASN 215 2145 2145 ASN ASN A . n A 1 216 ASP 216 2146 2146 ASP ASP A . n A 1 217 SER 217 2147 2147 SER SER A . n A 1 218 ARG 218 2148 2148 ARG ARG A . n A 1 219 PRO 219 2149 2149 PRO PRO A . n A 1 220 GLU 220 2150 2150 GLU GLU A . n A 1 221 PHE 221 2151 2151 PHE PHE A . n A 1 222 LEU 222 2152 2152 LEU LEU A . n A 1 223 ASN 223 2153 2153 ASN ASN A . n A 1 224 PRO 224 2154 2154 PRO PRO A . n A 1 225 ILE 225 2155 2155 ILE ILE A . n A 1 226 GLN 226 2156 2156 GLN GLN A . n A 1 227 THR 227 2157 2157 THR THR A . n A 1 228 VAL 228 2158 2158 VAL VAL A . n A 1 229 SER 229 2159 2159 SER SER A . n A 1 230 VAL 230 2160 2160 VAL VAL A . n A 1 231 LEU 231 2161 2161 LEU LEU A . n A 1 232 GLU 232 2162 2162 GLU GLU A . n A 1 233 SER 233 2163 2163 SER SER A . n A 1 234 ALA 234 2164 2164 ALA ALA A . n A 1 235 GLU 235 2165 2165 GLU GLU A . n A 1 236 PRO 236 2166 2166 PRO PRO A . n A 1 237 GLY 237 2167 2167 GLY GLY A . n A 1 238 THR 238 2168 2168 THR THR A . n A 1 239 ILE 239 2169 2169 ILE ILE A . n A 1 240 ILE 240 2170 2170 ILE ILE A . n A 1 241 ALA 241 2171 2171 ALA ALA A . n A 1 242 ASN 242 2172 2172 ASN ASN A . n A 1 243 VAL 243 2173 2173 VAL VAL A . n A 1 244 THR 244 2174 2174 THR THR A . n A 1 245 ALA 245 2175 2175 ALA ALA A . n A 1 246 ILE 246 2176 2176 ILE ILE A . n A 1 247 ASP 247 2177 2177 ASP ASP A . n A 1 248 LEU 248 2178 2178 LEU LEU A . n A 1 249 ASP 249 2179 2179 ASP ASP A . n A 1 250 LEU 250 2180 2180 LEU LEU A . n A 1 251 ASN 251 2181 2181 ASN ASN A . n A 1 252 PRO 252 2182 2182 PRO PRO A . n A 1 253 LYS 253 2183 2183 LYS LYS A . n A 1 254 LEU 254 2184 2184 LEU LEU A . n A 1 255 GLU 255 2185 2185 GLU GLU A . n A 1 256 TYR 256 2186 2186 TYR TYR A . n A 1 257 HIS 257 2187 2187 HIS HIS A . n A 1 258 ILE 258 2188 2188 ILE ILE A . n A 1 259 ILE 259 2189 2189 ILE ILE A . n A 1 260 SER 260 2190 2190 SER SER A . n A 1 261 ILE 261 2191 2191 ILE ILE A . n A 1 262 VAL 262 2192 2192 VAL VAL A . n A 1 263 ALA 263 2193 2193 ALA ALA A . n A 1 264 LYS 264 2194 2194 LYS LYS A . n A 1 265 ASP 265 2195 2195 ASP ASP A . n A 1 266 ASP 266 2196 2196 ASP ASP A . n A 1 267 THR 267 2197 2197 THR THR A . n A 1 268 ASP 268 2198 2198 ASP ASP A . n A 1 269 ARG 269 2199 2199 ARG ARG A . n A 1 270 LEU 270 2200 2200 LEU LEU A . n A 1 271 VAL 271 2201 2201 VAL VAL A . n A 1 272 PRO 272 2202 2202 PRO PRO A . n A 1 273 ASP 273 2203 2203 ASP ASP A . n A 1 274 GLN 274 2204 2204 GLN GLN A . n A 1 275 GLU 275 2205 2205 GLU GLU A . n A 1 276 ASP 276 2206 2206 ASP ASP A . n A 1 277 ALA 277 2207 2207 ALA ALA A . n A 1 278 PHE 278 2208 2208 PHE PHE A . n A 1 279 ALA 279 2209 2209 ALA ALA A . n A 1 280 VAL 280 2210 2210 VAL VAL A . n A 1 281 ASN 281 2211 2211 ASN ASN A . n A 1 282 ILE 282 2212 2212 ILE ILE A . n A 1 283 ASN 283 2213 2213 ASN ASN A . n A 1 284 THR 284 2214 2214 THR THR A . n A 1 285 GLY 285 2215 2215 GLY GLY A . n A 1 286 SER 286 2216 2216 SER SER A . n A 1 287 VAL 287 2217 2217 VAL VAL A . n A 1 288 MET 288 2218 2218 MET MET A . n A 1 289 VAL 289 2219 2219 VAL VAL A . n A 1 290 LYS 290 2220 2220 LYS LYS A . n A 1 291 SER 291 2221 2221 SER SER A . n A 1 292 PRO 292 2222 2222 PRO PRO A . n A 1 293 LEU 293 2223 2223 LEU LEU A . n A 1 294 ASN 294 2224 2224 ASN ASN A . n A 1 295 ARG 295 2225 2225 ARG ARG A . n A 1 296 GLU 296 2226 2226 GLU GLU A . n A 1 297 LEU 297 2227 2227 LEU LEU A . n A 1 298 VAL 298 2228 2228 VAL VAL A . n A 1 299 ALA 299 2229 2229 ALA ALA A . n A 1 300 THR 300 2230 2230 THR THR A . n A 1 301 TYR 301 2231 2231 TYR TYR A . n A 1 302 GLU 302 2232 2232 GLU GLU A . n A 1 303 VAL 303 2233 2233 VAL VAL A . n A 1 304 THR 304 2234 2234 THR THR A . n A 1 305 LEU 305 2235 2235 LEU LEU A . n A 1 306 SER 306 2236 2236 SER SER A . n A 1 307 VAL 307 2237 2237 VAL VAL A . n A 1 308 ILE 308 2238 2238 ILE ILE A . n A 1 309 ASP 309 2239 2239 ASP ASP A . n A 1 310 ASN 310 2240 2240 ASN ASN A . n A 1 311 ALA 311 2241 2241 ALA ALA A . n A 1 312 SER 312 2242 2242 SER SER A . n A 1 313 ASP 313 2243 2243 ASP ASP A . n A 1 314 LEU 314 2244 2244 LEU LEU A . n A 1 315 PRO 315 2245 2245 PRO PRO A . n A 1 316 GLU 316 2246 2246 GLU GLU A . n A 1 317 HIS 317 2247 2247 HIS HIS A . n A 1 318 SER 318 2248 2248 SER SER A . n A 1 319 VAL 319 2249 2249 VAL VAL A . n A 1 320 SER 320 2250 2250 SER SER A . n A 1 321 VAL 321 2251 2251 VAL VAL A . n A 1 322 PRO 322 2252 2252 PRO PRO A . n A 1 323 ASN 323 2253 2253 ASN ASN A . n A 1 324 ALA 324 2254 2254 ALA ALA A . n A 1 325 LYS 325 2255 2255 LYS LYS A . n A 1 326 LEU 326 2256 2256 LEU LEU A . n A 1 327 THR 327 2257 2257 THR THR A . n A 1 328 VAL 328 2258 2258 VAL VAL A . n A 1 329 ASN 329 2259 2259 ASN ASN A . n A 1 330 ILE 330 2260 2260 ILE ILE A . n A 1 331 LEU 331 2261 2261 LEU LEU A . n A 1 332 ASP 332 2262 2262 ASP ASP A . n A 1 333 VAL 333 2263 ? ? ? A . n A 1 334 ASN 334 2264 ? ? ? A . n A 1 335 ASP 335 2265 ? ? ? A . n A 1 336 ASN 336 2266 ? ? ? A . n A 1 337 LEU 337 2267 ? ? ? A . n A 1 338 GLU 338 2268 ? ? ? A . n A 1 339 HIS 339 2269 ? ? ? A . n A 1 340 HIS 340 2270 ? ? ? A . n A 1 341 HIS 341 2271 ? ? ? A . n A 1 342 HIS 342 2272 ? ? ? A . n A 1 343 HIS 343 2273 ? ? ? A . n A 1 344 HIS 344 2274 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 2301 2263 CA CA A . C 2 CA 1 2302 2264 CA CA A . D 2 CA 1 2303 2265 CA CA A . E 2 CA 1 2304 2266 CA CA A . F 2 CA 1 2305 2267 CA CA A . G 2 CA 1 2306 2268 CA CA A . H 3 HOH 1 2401 2271 HOH HOH A . H 3 HOH 2 2402 2274 HOH HOH A . H 3 HOH 3 2403 2272 HOH HOH A . H 3 HOH 4 2404 2273 HOH HOH A . H 3 HOH 5 2405 2270 HOH HOH A . H 3 HOH 6 2406 2275 HOH HOH A . H 3 HOH 7 2407 2269 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 210 ? 1 MORE -29 ? 1 'SSA (A^2)' 17370 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE2 ? A GLU 17 ? A GLU 1947 ? 1_555 CA ? B CA . ? A CA 2301 ? 1_555 OD1 ? A ASP 75 ? A ASP 2005 ? 1_555 85.7 ? 2 OE2 ? A GLU 17 ? A GLU 1947 ? 1_555 CA ? B CA . ? A CA 2301 ? 1_555 OE2 ? A GLU 77 ? A GLU 2007 ? 1_555 78.6 ? 3 OD1 ? A ASP 75 ? A ASP 2005 ? 1_555 CA ? B CA . ? A CA 2301 ? 1_555 OE2 ? A GLU 77 ? A GLU 2007 ? 1_555 82.7 ? 4 OE2 ? A GLU 17 ? A GLU 1947 ? 1_555 CA ? B CA . ? A CA 2301 ? 1_555 OD1 ? A ASP 111 ? A ASP 2041 ? 1_555 92.9 ? 5 OD1 ? A ASP 75 ? A ASP 2005 ? 1_555 CA ? B CA . ? A CA 2301 ? 1_555 OD1 ? A ASP 111 ? A ASP 2041 ? 1_555 154.9 ? 6 OE2 ? A GLU 77 ? A GLU 2007 ? 1_555 CA ? B CA . ? A CA 2301 ? 1_555 OD1 ? A ASP 111 ? A ASP 2041 ? 1_555 72.5 ? 7 OE2 ? A GLU 17 ? A GLU 1947 ? 1_555 CA ? B CA . ? A CA 2301 ? 1_555 OD2 ? A ASP 111 ? A ASP 2041 ? 1_555 74.1 ? 8 OD1 ? A ASP 75 ? A ASP 2005 ? 1_555 CA ? B CA . ? A CA 2301 ? 1_555 OD2 ? A ASP 111 ? A ASP 2041 ? 1_555 153.6 ? 9 OE2 ? A GLU 77 ? A GLU 2007 ? 1_555 CA ? B CA . ? A CA 2301 ? 1_555 OD2 ? A ASP 111 ? A ASP 2041 ? 1_555 109.0 ? 10 OD1 ? A ASP 111 ? A ASP 2041 ? 1_555 CA ? B CA . ? A CA 2301 ? 1_555 OD2 ? A ASP 111 ? A ASP 2041 ? 1_555 45.7 ? 11 OE2 ? A GLU 17 ? A GLU 1947 ? 1_555 CA ? B CA . ? A CA 2301 ? 1_555 O ? H HOH . ? A HOH 2403 ? 1_555 68.5 ? 12 OD1 ? A ASP 75 ? A ASP 2005 ? 1_555 CA ? B CA . ? A CA 2301 ? 1_555 O ? H HOH . ? A HOH 2403 ? 1_555 81.3 ? 13 OE2 ? A GLU 77 ? A GLU 2007 ? 1_555 CA ? B CA . ? A CA 2301 ? 1_555 O ? H HOH . ? A HOH 2403 ? 1_555 144.3 ? 14 OD1 ? A ASP 111 ? A ASP 2041 ? 1_555 CA ? B CA . ? A CA 2301 ? 1_555 O ? H HOH . ? A HOH 2403 ? 1_555 121.4 ? 15 OD2 ? A ASP 111 ? A ASP 2041 ? 1_555 CA ? B CA . ? A CA 2301 ? 1_555 O ? H HOH . ? A HOH 2403 ? 1_555 75.7 ? 16 OE2 ? A GLU 17 ? A GLU 1947 ? 1_555 CA ? B CA . ? A CA 2301 ? 1_555 O ? H HOH . ? A HOH 2404 ? 1_555 158.8 ? 17 OD1 ? A ASP 75 ? A ASP 2005 ? 1_555 CA ? B CA . ? A CA 2301 ? 1_555 O ? H HOH . ? A HOH 2404 ? 1_555 115.5 ? 18 OE2 ? A GLU 77 ? A GLU 2007 ? 1_555 CA ? B CA . ? A CA 2301 ? 1_555 O ? H HOH . ? A HOH 2404 ? 1_555 103.3 ? 19 OD1 ? A ASP 111 ? A ASP 2041 ? 1_555 CA ? B CA . ? A CA 2301 ? 1_555 O ? H HOH . ? A HOH 2404 ? 1_555 68.2 ? 20 OD2 ? A ASP 111 ? A ASP 2041 ? 1_555 CA ? B CA . ? A CA 2301 ? 1_555 O ? H HOH . ? A HOH 2404 ? 1_555 85.5 ? 21 O ? H HOH . ? A HOH 2403 ? 1_555 CA ? B CA . ? A CA 2301 ? 1_555 O ? H HOH . ? A HOH 2404 ? 1_555 112.4 ? 22 OE1 ? A GLU 17 ? A GLU 1947 ? 1_555 CA ? C CA . ? A CA 2302 ? 1_555 OE1 ? A GLU 77 ? A GLU 2007 ? 1_555 104.5 ? 23 OE1 ? A GLU 17 ? A GLU 1947 ? 1_555 CA ? C CA . ? A CA 2302 ? 1_555 OE2 ? A GLU 77 ? A GLU 2007 ? 1_555 80.5 ? 24 OE1 ? A GLU 77 ? A GLU 2007 ? 1_555 CA ? C CA . ? A CA 2302 ? 1_555 OE2 ? A GLU 77 ? A GLU 2007 ? 1_555 51.6 ? 25 OE1 ? A GLU 17 ? A GLU 1947 ? 1_555 CA ? C CA . ? A CA 2302 ? 1_555 OD1 ? A ASP 108 ? A ASP 2038 ? 1_555 88.2 ? 26 OE1 ? A GLU 77 ? A GLU 2007 ? 1_555 CA ? C CA . ? A CA 2302 ? 1_555 OD1 ? A ASP 108 ? A ASP 2038 ? 1_555 78.7 ? 27 OE2 ? A GLU 77 ? A GLU 2007 ? 1_555 CA ? C CA . ? A CA 2302 ? 1_555 OD1 ? A ASP 108 ? A ASP 2038 ? 1_555 123.1 ? 28 OE1 ? A GLU 17 ? A GLU 1947 ? 1_555 CA ? C CA . ? A CA 2302 ? 1_555 O ? A ASP 109 ? A ASP 2039 ? 1_555 93.8 ? 29 OE1 ? A GLU 77 ? A GLU 2007 ? 1_555 CA ? C CA . ? A CA 2302 ? 1_555 O ? A ASP 109 ? A ASP 2039 ? 1_555 147.9 ? 30 OE2 ? A GLU 77 ? A GLU 2007 ? 1_555 CA ? C CA . ? A CA 2302 ? 1_555 O ? A ASP 109 ? A ASP 2039 ? 1_555 159.8 ? 31 OD1 ? A ASP 108 ? A ASP 2038 ? 1_555 CA ? C CA . ? A CA 2302 ? 1_555 O ? A ASP 109 ? A ASP 2039 ? 1_555 75.7 ? 32 OE1 ? A GLU 17 ? A GLU 1947 ? 1_555 CA ? C CA . ? A CA 2302 ? 1_555 OD1 ? A ASP 111 ? A ASP 2041 ? 1_555 94.4 ? 33 OE1 ? A GLU 77 ? A GLU 2007 ? 1_555 CA ? C CA . ? A CA 2302 ? 1_555 OD1 ? A ASP 111 ? A ASP 2041 ? 1_555 120.0 ? 34 OE2 ? A GLU 77 ? A GLU 2007 ? 1_555 CA ? C CA . ? A CA 2302 ? 1_555 OD1 ? A ASP 111 ? A ASP 2041 ? 1_555 77.4 ? 35 OD1 ? A ASP 108 ? A ASP 2038 ? 1_555 CA ? C CA . ? A CA 2302 ? 1_555 OD1 ? A ASP 111 ? A ASP 2041 ? 1_555 159.5 ? 36 O ? A ASP 109 ? A ASP 2039 ? 1_555 CA ? C CA . ? A CA 2302 ? 1_555 OD1 ? A ASP 111 ? A ASP 2041 ? 1_555 83.8 ? 37 OE1 ? A GLU 17 ? A GLU 1947 ? 1_555 CA ? C CA . ? A CA 2302 ? 1_555 OD1 ? A ASP 144 ? A ASP 2074 ? 1_555 169.8 ? 38 OE1 ? A GLU 77 ? A GLU 2007 ? 1_555 CA ? C CA . ? A CA 2302 ? 1_555 OD1 ? A ASP 144 ? A ASP 2074 ? 1_555 85.5 ? 39 OE2 ? A GLU 77 ? A GLU 2007 ? 1_555 CA ? C CA . ? A CA 2302 ? 1_555 OD1 ? A ASP 144 ? A ASP 2074 ? 1_555 104.7 ? 40 OD1 ? A ASP 108 ? A ASP 2038 ? 1_555 CA ? C CA . ? A CA 2302 ? 1_555 OD1 ? A ASP 144 ? A ASP 2074 ? 1_555 95.9 ? 41 O ? A ASP 109 ? A ASP 2039 ? 1_555 CA ? C CA . ? A CA 2302 ? 1_555 OD1 ? A ASP 144 ? A ASP 2074 ? 1_555 78.3 ? 42 OD1 ? A ASP 111 ? A ASP 2041 ? 1_555 CA ? C CA . ? A CA 2302 ? 1_555 OD1 ? A ASP 144 ? A ASP 2074 ? 1_555 78.5 ? 43 OD1 ? A ASN 110 ? A ASN 2040 ? 1_555 CA ? D CA . ? A CA 2303 ? 1_555 O ? A ASN 112 ? A ASN 2042 ? 1_555 105.9 ? 44 OD1 ? A ASN 110 ? A ASN 2040 ? 1_555 CA ? D CA . ? A CA 2303 ? 1_555 OD1 ? A ASP 142 ? A ASP 2072 ? 1_555 146.9 ? 45 O ? A ASN 112 ? A ASN 2042 ? 1_555 CA ? D CA . ? A CA 2303 ? 1_555 OD1 ? A ASP 142 ? A ASP 2072 ? 1_555 96.4 ? 46 OD1 ? A ASN 110 ? A ASN 2040 ? 1_555 CA ? D CA . ? A CA 2303 ? 1_555 OD2 ? A ASP 142 ? A ASP 2072 ? 1_555 149.4 ? 47 O ? A ASN 112 ? A ASN 2042 ? 1_555 CA ? D CA . ? A CA 2303 ? 1_555 OD2 ? A ASP 142 ? A ASP 2072 ? 1_555 88.5 ? 48 OD1 ? A ASP 142 ? A ASP 2072 ? 1_555 CA ? D CA . ? A CA 2303 ? 1_555 OD2 ? A ASP 142 ? A ASP 2072 ? 1_555 52.5 ? 49 OD1 ? A ASN 110 ? A ASN 2040 ? 1_555 CA ? D CA . ? A CA 2303 ? 1_555 OD2 ? A ASP 144 ? A ASP 2074 ? 1_555 79.2 ? 50 O ? A ASN 112 ? A ASN 2042 ? 1_555 CA ? D CA . ? A CA 2303 ? 1_555 OD2 ? A ASP 144 ? A ASP 2074 ? 1_555 90.9 ? 51 OD1 ? A ASP 142 ? A ASP 2072 ? 1_555 CA ? D CA . ? A CA 2303 ? 1_555 OD2 ? A ASP 144 ? A ASP 2074 ? 1_555 76.4 ? 52 OD2 ? A ASP 142 ? A ASP 2072 ? 1_555 CA ? D CA . ? A CA 2303 ? 1_555 OD2 ? A ASP 144 ? A ASP 2074 ? 1_555 128.4 ? 53 OD1 ? A ASN 110 ? A ASN 2040 ? 1_555 CA ? D CA . ? A CA 2303 ? 1_555 O ? A ASN 148 ? A ASN 2078 ? 1_555 82.5 ? 54 O ? A ASN 112 ? A ASN 2042 ? 1_555 CA ? D CA . ? A CA 2303 ? 1_555 O ? A ASN 148 ? A ASN 2078 ? 1_555 170.0 ? 55 OD1 ? A ASP 142 ? A ASP 2072 ? 1_555 CA ? D CA . ? A CA 2303 ? 1_555 O ? A ASN 148 ? A ASN 2078 ? 1_555 78.4 ? 56 OD2 ? A ASP 142 ? A ASP 2072 ? 1_555 CA ? D CA . ? A CA 2303 ? 1_555 O ? A ASN 148 ? A ASN 2078 ? 1_555 81.5 ? 57 OD2 ? A ASP 144 ? A ASP 2074 ? 1_555 CA ? D CA . ? A CA 2303 ? 1_555 O ? A ASN 148 ? A ASN 2078 ? 1_555 96.2 ? 58 OD1 ? A ASN 110 ? A ASN 2040 ? 1_555 CA ? D CA . ? A CA 2303 ? 1_555 OD1 ? A ASN 195 ? A ASN 2125 ? 1_555 79.9 ? 59 O ? A ASN 112 ? A ASN 2042 ? 1_555 CA ? D CA . ? A CA 2303 ? 1_555 OD1 ? A ASN 195 ? A ASN 2125 ? 1_555 101.2 ? 60 OD1 ? A ASP 142 ? A ASP 2072 ? 1_555 CA ? D CA . ? A CA 2303 ? 1_555 OD1 ? A ASN 195 ? A ASN 2125 ? 1_555 119.7 ? 61 OD2 ? A ASP 142 ? A ASP 2072 ? 1_555 CA ? D CA . ? A CA 2303 ? 1_555 OD1 ? A ASN 195 ? A ASN 2125 ? 1_555 70.7 ? 62 OD2 ? A ASP 144 ? A ASP 2074 ? 1_555 CA ? D CA . ? A CA 2303 ? 1_555 OD1 ? A ASN 195 ? A ASN 2125 ? 1_555 158.1 ? 63 O ? A ASN 148 ? A ASN 2078 ? 1_555 CA ? D CA . ? A CA 2303 ? 1_555 OD1 ? A ASN 195 ? A ASN 2125 ? 1_555 74.5 ? 64 OE2 ? A GLU 127 ? A GLU 2057 ? 1_555 CA ? E CA . ? A CA 2304 ? 1_555 OD1 ? A ASP 180 ? A ASP 2110 ? 1_555 79.4 ? 65 OE2 ? A GLU 127 ? A GLU 2057 ? 1_555 CA ? E CA . ? A CA 2304 ? 1_555 OE2 ? A GLU 182 ? A GLU 2112 ? 1_555 79.6 ? 66 OD1 ? A ASP 180 ? A ASP 2110 ? 1_555 CA ? E CA . ? A CA 2304 ? 1_555 OE2 ? A GLU 182 ? A GLU 2112 ? 1_555 80.6 ? 67 OE2 ? A GLU 127 ? A GLU 2057 ? 1_555 CA ? E CA . ? A CA 2304 ? 1_555 OD1 ? A ASP 216 ? A ASP 2146 ? 1_555 92.8 ? 68 OD1 ? A ASP 180 ? A ASP 2110 ? 1_555 CA ? E CA . ? A CA 2304 ? 1_555 OD1 ? A ASP 216 ? A ASP 2146 ? 1_555 157.0 ? 69 OE2 ? A GLU 182 ? A GLU 2112 ? 1_555 CA ? E CA . ? A CA 2304 ? 1_555 OD1 ? A ASP 216 ? A ASP 2146 ? 1_555 76.7 ? 70 OE2 ? A GLU 127 ? A GLU 2057 ? 1_555 CA ? E CA . ? A CA 2304 ? 1_555 OD2 ? A ASP 216 ? A ASP 2146 ? 1_555 73.6 ? 71 OD1 ? A ASP 180 ? A ASP 2110 ? 1_555 CA ? E CA . ? A CA 2304 ? 1_555 OD2 ? A ASP 216 ? A ASP 2146 ? 1_555 140.6 ? 72 OE2 ? A GLU 182 ? A GLU 2112 ? 1_555 CA ? E CA . ? A CA 2304 ? 1_555 OD2 ? A ASP 216 ? A ASP 2146 ? 1_555 120.9 ? 73 OD1 ? A ASP 216 ? A ASP 2146 ? 1_555 CA ? E CA . ? A CA 2304 ? 1_555 OD2 ? A ASP 216 ? A ASP 2146 ? 1_555 53.7 ? 74 OE1 ? A GLU 127 ? A GLU 2057 ? 1_555 CA ? F CA . ? A CA 2305 ? 1_555 OE1 ? A GLU 182 ? A GLU 2112 ? 1_555 118.1 ? 75 OE1 ? A GLU 127 ? A GLU 2057 ? 1_555 CA ? F CA . ? A CA 2305 ? 1_555 OE2 ? A GLU 182 ? A GLU 2112 ? 1_555 85.4 ? 76 OE1 ? A GLU 182 ? A GLU 2112 ? 1_555 CA ? F CA . ? A CA 2305 ? 1_555 OE2 ? A GLU 182 ? A GLU 2112 ? 1_555 51.1 ? 77 OE1 ? A GLU 127 ? A GLU 2057 ? 1_555 CA ? F CA . ? A CA 2305 ? 1_555 OD1 ? A ASP 213 ? A ASP 2143 ? 1_555 86.6 ? 78 OE1 ? A GLU 182 ? A GLU 2112 ? 1_555 CA ? F CA . ? A CA 2305 ? 1_555 OD1 ? A ASP 213 ? A ASP 2143 ? 1_555 84.4 ? 79 OE2 ? A GLU 182 ? A GLU 2112 ? 1_555 CA ? F CA . ? A CA 2305 ? 1_555 OD1 ? A ASP 213 ? A ASP 2143 ? 1_555 122.2 ? 80 OE1 ? A GLU 127 ? A GLU 2057 ? 1_555 CA ? F CA . ? A CA 2305 ? 1_555 O ? A ILE 214 ? A ILE 2144 ? 1_555 78.2 ? 81 OE1 ? A GLU 182 ? A GLU 2112 ? 1_555 CA ? F CA . ? A CA 2305 ? 1_555 O ? A ILE 214 ? A ILE 2144 ? 1_555 159.0 ? 82 OE2 ? A GLU 182 ? A GLU 2112 ? 1_555 CA ? F CA . ? A CA 2305 ? 1_555 O ? A ILE 214 ? A ILE 2144 ? 1_555 148.8 ? 83 OD1 ? A ASP 213 ? A ASP 2143 ? 1_555 CA ? F CA . ? A CA 2305 ? 1_555 O ? A ILE 214 ? A ILE 2144 ? 1_555 83.5 ? 84 OE1 ? A GLU 127 ? A GLU 2057 ? 1_555 CA ? F CA . ? A CA 2305 ? 1_555 OD1 ? A ASP 216 ? A ASP 2146 ? 1_555 86.8 ? 85 OE1 ? A GLU 182 ? A GLU 2112 ? 1_555 CA ? F CA . ? A CA 2305 ? 1_555 OD1 ? A ASP 216 ? A ASP 2146 ? 1_555 109.4 ? 86 OE2 ? A GLU 182 ? A GLU 2112 ? 1_555 CA ? F CA . ? A CA 2305 ? 1_555 OD1 ? A ASP 216 ? A ASP 2146 ? 1_555 69.2 ? 87 OD1 ? A ASP 213 ? A ASP 2143 ? 1_555 CA ? F CA . ? A CA 2305 ? 1_555 OD1 ? A ASP 216 ? A ASP 2146 ? 1_555 166.3 ? 88 O ? A ILE 214 ? A ILE 2144 ? 1_555 CA ? F CA . ? A CA 2305 ? 1_555 OD1 ? A ASP 216 ? A ASP 2146 ? 1_555 83.3 ? 89 OE1 ? A GLU 127 ? A GLU 2057 ? 1_555 CA ? F CA . ? A CA 2305 ? 1_555 OD1 ? A ASP 249 ? A ASP 2179 ? 1_555 162.0 ? 90 OE1 ? A GLU 182 ? A GLU 2112 ? 1_555 CA ? F CA . ? A CA 2305 ? 1_555 OD1 ? A ASP 249 ? A ASP 2179 ? 1_555 77.2 ? 91 OE2 ? A GLU 182 ? A GLU 2112 ? 1_555 CA ? F CA . ? A CA 2305 ? 1_555 OD1 ? A ASP 249 ? A ASP 2179 ? 1_555 99.0 ? 92 OD1 ? A ASP 213 ? A ASP 2143 ? 1_555 CA ? F CA . ? A CA 2305 ? 1_555 OD1 ? A ASP 249 ? A ASP 2179 ? 1_555 105.2 ? 93 O ? A ILE 214 ? A ILE 2144 ? 1_555 CA ? F CA . ? A CA 2305 ? 1_555 OD1 ? A ASP 249 ? A ASP 2179 ? 1_555 89.6 ? 94 OD1 ? A ASP 216 ? A ASP 2146 ? 1_555 CA ? F CA . ? A CA 2305 ? 1_555 OD1 ? A ASP 249 ? A ASP 2179 ? 1_555 78.7 ? 95 OD1 ? A ASN 215 ? A ASN 2145 ? 1_555 CA ? G CA . ? A CA 2306 ? 1_555 O ? A SER 217 ? A SER 2147 ? 1_555 125.7 ? 96 OD1 ? A ASN 215 ? A ASN 2145 ? 1_555 CA ? G CA . ? A CA 2306 ? 1_555 OD1 ? A ASP 247 ? A ASP 2177 ? 1_555 143.1 ? 97 O ? A SER 217 ? A SER 2147 ? 1_555 CA ? G CA . ? A CA 2306 ? 1_555 OD1 ? A ASP 247 ? A ASP 2177 ? 1_555 66.5 ? 98 OD1 ? A ASN 215 ? A ASN 2145 ? 1_555 CA ? G CA . ? A CA 2306 ? 1_555 OD2 ? A ASP 247 ? A ASP 2177 ? 1_555 106.7 ? 99 O ? A SER 217 ? A SER 2147 ? 1_555 CA ? G CA . ? A CA 2306 ? 1_555 OD2 ? A ASP 247 ? A ASP 2177 ? 1_555 115.5 ? 100 OD1 ? A ASP 247 ? A ASP 2177 ? 1_555 CA ? G CA . ? A CA 2306 ? 1_555 OD2 ? A ASP 247 ? A ASP 2177 ? 1_555 49.1 ? 101 OD1 ? A ASN 215 ? A ASN 2145 ? 1_555 CA ? G CA . ? A CA 2306 ? 1_555 OD2 ? A ASP 249 ? A ASP 2179 ? 1_555 65.3 ? 102 O ? A SER 217 ? A SER 2147 ? 1_555 CA ? G CA . ? A CA 2306 ? 1_555 OD2 ? A ASP 249 ? A ASP 2179 ? 1_555 89.8 ? 103 OD1 ? A ASP 247 ? A ASP 2177 ? 1_555 CA ? G CA . ? A CA 2306 ? 1_555 OD2 ? A ASP 249 ? A ASP 2179 ? 1_555 81.3 ? 104 OD2 ? A ASP 247 ? A ASP 2177 ? 1_555 CA ? G CA . ? A CA 2306 ? 1_555 OD2 ? A ASP 249 ? A ASP 2179 ? 1_555 79.5 ? 105 OD1 ? A ASN 215 ? A ASN 2145 ? 1_555 CA ? G CA . ? A CA 2306 ? 1_555 OD2 ? A ASP 309 ? A ASP 2239 ? 1_555 78.4 ? 106 O ? A SER 217 ? A SER 2147 ? 1_555 CA ? G CA . ? A CA 2306 ? 1_555 OD2 ? A ASP 309 ? A ASP 2239 ? 1_555 143.8 ? 107 OD1 ? A ASP 247 ? A ASP 2177 ? 1_555 CA ? G CA . ? A CA 2306 ? 1_555 OD2 ? A ASP 309 ? A ASP 2239 ? 1_555 112.4 ? 108 OD2 ? A ASP 247 ? A ASP 2177 ? 1_555 CA ? G CA . ? A CA 2306 ? 1_555 OD2 ? A ASP 309 ? A ASP 2239 ? 1_555 74.5 ? 109 OD2 ? A ASP 249 ? A ASP 2179 ? 1_555 CA ? G CA . ? A CA 2306 ? 1_555 OD2 ? A ASP 309 ? A ASP 2239 ? 1_555 126.3 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-01-31 2 'Structure model' 1 1 2018-08-01 3 'Structure model' 1 2 2018-09-05 4 'Structure model' 1 3 2018-09-19 5 'Structure model' 1 4 2019-12-18 6 'Structure model' 1 5 2023-10-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Source and taxonomy' 6 4 'Structure model' 'Data collection' 7 4 'Structure model' 'Database references' 8 5 'Structure model' 'Author supporting evidence' 9 6 'Structure model' 'Data collection' 10 6 'Structure model' 'Database references' 11 6 'Structure model' 'Derived calculations' 12 6 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' entity_src_gen 4 3 'Structure model' pdbx_related_exp_data_set 5 4 'Structure model' citation 6 5 'Structure model' pdbx_audit_support 7 6 'Structure model' chem_comp_atom 8 6 'Structure model' chem_comp_bond 9 6 'Structure model' database_2 10 6 'Structure model' pdbx_initial_refinement_model 11 6 'Structure model' pdbx_struct_conn_angle 12 6 'Structure model' refine_hist 13 6 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 3 'Structure model' '_entity_src_gen.pdbx_host_org_scientific_name' 11 4 'Structure model' '_citation.journal_volume' 12 4 'Structure model' '_citation.page_first' 13 5 'Structure model' '_pdbx_audit_support.funding_organization' 14 6 'Structure model' '_database_2.pdbx_DOI' 15 6 'Structure model' '_database_2.pdbx_database_accession' 16 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 17 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 18 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 19 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 20 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 21 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 22 6 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 23 6 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 24 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 25 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 26 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 27 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 28 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 29 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 30 6 'Structure model' '_pdbx_struct_conn_angle.value' 31 6 'Structure model' '_refine_hist.d_res_low' 32 6 'Structure model' '_struct_conn.pdbx_dist_value' 33 6 'Structure model' '_struct_conn.ptnr1_label_atom_id' 34 6 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 35 6 'Structure model' '_struct_conn.ptnr2_label_asym_id' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined -4.9040 21.8820 -34.9360 0.2831 0.2976 0.3073 0.2161 0.0468 0.0497 2.5260 2.7530 11.7241 0.7163 2.1087 -1.2774 0.1526 -0.0408 -0.1118 0.5191 0.1770 -0.1739 -0.4907 -0.3753 0.1246 'X-RAY DIFFRACTION' 2 ? refined -11.8780 6.3410 8.0410 0.1630 0.2989 0.2276 -0.1426 -0.1132 -0.0383 2.6598 1.1126 12.3919 0.5085 -4.1867 -2.4208 0.0440 -0.1216 0.0776 0.3932 -0.2050 0.0557 0.0061 0.5461 -1.1264 'X-RAY DIFFRACTION' 3 ? refined -18.7440 -6.1560 55.5420 0.5065 0.1869 0.2610 -0.1874 0.0446 -0.0534 3.3225 0.9594 10.1980 -0.5802 0.4687 -2.2218 -0.3734 0.1390 0.2344 -0.3465 -0.2693 -0.0106 0.1046 1.2833 -0.9180 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 1934 A 2040 ? ? ? ? ? ? 'X-RAY DIFFRACTION' 2 1 A 2301 A 2302 ? ? ? ? ? ? 'X-RAY DIFFRACTION' 3 2 A 2041 A 2145 ? ? ? ? ? ? 'X-RAY DIFFRACTION' 4 2 A 2303 A 2305 ? ? ? ? ? ? 'X-RAY DIFFRACTION' 5 3 A 2146 A 2262 ? ? ? ? ? ? 'X-RAY DIFFRACTION' 6 3 A 2306 A 2306 ? ? ? ? ? ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0158 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 1948 ? ? 74.58 -5.34 2 1 HIS A 1983 ? ? -91.66 43.41 3 1 PRO A 2012 ? ? -84.12 42.91 4 1 GLN A 2025 ? ? 91.33 -9.80 5 1 ASP A 2091 ? ? 58.84 15.45 6 1 ASN A 2106 ? ? -99.19 58.04 7 1 ILE A 2189 ? ? -135.14 -30.50 8 1 THR A 2197 ? ? -119.03 58.23 9 1 ASP A 2198 ? ? 70.65 -12.22 10 1 ASP A 2203 ? ? 68.79 77.20 11 1 GLN A 2204 ? ? -141.84 32.67 12 1 LYS A 2220 ? ? -121.49 -56.07 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 SER _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 2190 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 ILE _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 2191 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 144.48 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1931 ? A MET 1 2 1 Y 1 A ASN 1932 ? A ASN 2 3 1 Y 1 A HIS 1933 ? A HIS 3 4 1 Y 1 A ASP 1966 ? A ASP 36 5 1 Y 1 A ALA 1967 ? A ALA 37 6 1 Y 1 A ASP 1968 ? A ASP 38 7 1 Y 1 A GLU 1969 ? A GLU 39 8 1 Y 1 A ASP 1970 ? A ASP 40 9 1 Y 1 A VAL 1971 ? A VAL 41 10 1 Y 1 A TYR 1972 ? A TYR 42 11 1 Y 1 A ALA 1973 ? A ALA 43 12 1 Y 1 A VAL 1974 ? A VAL 44 13 1 Y 1 A VAL 2263 ? A VAL 333 14 1 Y 1 A ASN 2264 ? A ASN 334 15 1 Y 1 A ASP 2265 ? A ASP 335 16 1 Y 1 A ASN 2266 ? A ASN 336 17 1 Y 1 A LEU 2267 ? A LEU 337 18 1 Y 1 A GLU 2268 ? A GLU 338 19 1 Y 1 A HIS 2269 ? A HIS 339 20 1 Y 1 A HIS 2270 ? A HIS 340 21 1 Y 1 A HIS 2271 ? A HIS 341 22 1 Y 1 A HIS 2272 ? A HIS 342 23 1 Y 1 A HIS 2273 ? A HIS 343 24 1 Y 1 A HIS 2274 ? A HIS 344 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 THR N N N N 305 THR CA C N S 306 THR C C N N 307 THR O O N N 308 THR CB C N R 309 THR OG1 O N N 310 THR CG2 C N N 311 THR OXT O N N 312 THR H H N N 313 THR H2 H N N 314 THR HA H N N 315 THR HB H N N 316 THR HG1 H N N 317 THR HG21 H N N 318 THR HG22 H N N 319 THR HG23 H N N 320 THR HXT H N N 321 TRP N N N N 322 TRP CA C N S 323 TRP C C N N 324 TRP O O N N 325 TRP CB C N N 326 TRP CG C Y N 327 TRP CD1 C Y N 328 TRP CD2 C Y N 329 TRP NE1 N Y N 330 TRP CE2 C Y N 331 TRP CE3 C Y N 332 TRP CZ2 C Y N 333 TRP CZ3 C Y N 334 TRP CH2 C Y N 335 TRP OXT O N N 336 TRP H H N N 337 TRP H2 H N N 338 TRP HA H N N 339 TRP HB2 H N N 340 TRP HB3 H N N 341 TRP HD1 H N N 342 TRP HE1 H N N 343 TRP HE3 H N N 344 TRP HZ2 H N N 345 TRP HZ3 H N N 346 TRP HH2 H N N 347 TRP HXT H N N 348 TYR N N N N 349 TYR CA C N S 350 TYR C C N N 351 TYR O O N N 352 TYR CB C N N 353 TYR CG C Y N 354 TYR CD1 C Y N 355 TYR CD2 C Y N 356 TYR CE1 C Y N 357 TYR CE2 C Y N 358 TYR CZ C Y N 359 TYR OH O N N 360 TYR OXT O N N 361 TYR H H N N 362 TYR H2 H N N 363 TYR HA H N N 364 TYR HB2 H N N 365 TYR HB3 H N N 366 TYR HD1 H N N 367 TYR HD2 H N N 368 TYR HE1 H N N 369 TYR HE2 H N N 370 TYR HH H N N 371 TYR HXT H N N 372 VAL N N N N 373 VAL CA C N S 374 VAL C C N N 375 VAL O O N N 376 VAL CB C N N 377 VAL CG1 C N N 378 VAL CG2 C N N 379 VAL OXT O N N 380 VAL H H N N 381 VAL H2 H N N 382 VAL HA H N N 383 VAL HB H N N 384 VAL HG11 H N N 385 VAL HG12 H N N 386 VAL HG13 H N N 387 VAL HG21 H N N 388 VAL HG22 H N N 389 VAL HG23 H N N 390 VAL HXT H N N 391 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute on Deafness and Other Communication Disorders (NIH/NIDCD)' 'United States' DC012534 1 'National Institutes of Health/National Institute on Deafness and Other Communication Disorders (NIH/NIDCD)' 'United States' DC015271 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5I8D _pdbx_initial_refinement_model.details ? #