data_5UP5 # _entry.id 5UP5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5UP5 pdb_00005up5 10.2210/pdb5up5/pdb WWPDB D_1000226232 ? ? BMRB 30242 ? 10.13018/BMR30242 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-07-26 2 'Structure model' 1 1 2020-01-08 3 'Structure model' 1 2 2023-06-14 4 'Structure model' 1 3 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 2 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_audit_support 2 2 'Structure model' pdbx_nmr_software 3 2 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_database_status 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond 8 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_audit_support.funding_organization' 2 2 'Structure model' '_pdbx_nmr_software.name' 3 2 'Structure model' '_pdbx_nmr_spectrometer.model' 4 3 'Structure model' '_database_2.pdbx_DOI' 5 3 'Structure model' '_database_2.pdbx_database_accession' 6 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 7 4 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5UP5 _pdbx_database_status.recvd_initial_deposition_date 2017-02-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type BMRB 'Solution structure of the de novo mini protein EHEE_rd1_0284' 30242 unspecified PDB . 5UOI unspecified PDB . 5UP1 unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Houliston, S.' 1 ? 'Rocklin, G.J.' 2 ? 'Lemak, A.' 3 ? 'Carter, L.' 4 ? 'Chidyausiku, T.M.' 5 ? 'Baker, D.' 6 ? 'Arrowsmith, C.H.' 7 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Science _citation.journal_id_ASTM SCIEAS _citation.journal_id_CSD 0038 _citation.journal_id_ISSN 1095-9203 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 357 _citation.language ? _citation.page_first 168 _citation.page_last 175 _citation.title 'Global analysis of protein folding using massively parallel design, synthesis, and testing.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1126/science.aan0693 _citation.pdbx_database_id_PubMed 28706065 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Rocklin, G.J.' 1 ? primary 'Chidyausiku, T.M.' 2 ? primary 'Goreshnik, I.' 3 ? primary 'Ford, A.' 4 ? primary 'Houliston, S.' 5 ? primary 'Lemak, A.' 6 ? primary 'Carter, L.' 7 ? primary 'Ravichandran, R.' 8 ? primary 'Mulligan, V.K.' 9 ? primary 'Chevalier, A.' 10 ? primary 'Arrowsmith, C.H.' 11 ? primary 'Baker, D.' 12 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description EHEE_rd1_0284 _entity.formula_weight 4973.368 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code TQTQEFDNEEEARKAEKELRKENRRVTVTQENGRWRVTWD _entity_poly.pdbx_seq_one_letter_code_can TQTQEFDNEEEARKAEKELRKENRRVTVTQENGRWRVTWD _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 GLN n 1 3 THR n 1 4 GLN n 1 5 GLU n 1 6 PHE n 1 7 ASP n 1 8 ASN n 1 9 GLU n 1 10 GLU n 1 11 GLU n 1 12 ALA n 1 13 ARG n 1 14 LYS n 1 15 ALA n 1 16 GLU n 1 17 LYS n 1 18 GLU n 1 19 LEU n 1 20 ARG n 1 21 LYS n 1 22 GLU n 1 23 ASN n 1 24 ARG n 1 25 ARG n 1 26 VAL n 1 27 THR n 1 28 VAL n 1 29 THR n 1 30 GLN n 1 31 GLU n 1 32 ASN n 1 33 GLY n 1 34 ARG n 1 35 TRP n 1 36 ARG n 1 37 VAL n 1 38 THR n 1 39 TRP n 1 40 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 40 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 1 1 THR THR A . n A 1 2 GLN 2 2 2 GLN GLN A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 GLN 4 4 4 GLN GLN A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 TRP 35 35 35 TRP TRP A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 TRP 39 39 39 TRP TRP A . n A 1 40 ASP 40 40 40 ASP ASP A . n # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASP 40 ? O ? A ASP 40 O 2 2 Y 1 A ASP 40 ? O ? A ASP 40 O 3 3 Y 1 A ASP 40 ? O ? A ASP 40 O 4 4 Y 1 A ASP 40 ? O ? A ASP 40 O 5 5 Y 1 A ASP 40 ? O ? A ASP 40 O 6 6 Y 1 A ASP 40 ? O ? A ASP 40 O 7 7 Y 1 A ASP 40 ? O ? A ASP 40 O 8 8 Y 1 A ASP 40 ? O ? A ASP 40 O 9 9 Y 1 A ASP 40 ? O ? A ASP 40 O 10 10 Y 1 A ASP 40 ? O ? A ASP 40 O 11 11 Y 1 A ASP 40 ? O ? A ASP 40 O 12 12 Y 1 A ASP 40 ? O ? A ASP 40 O 13 13 Y 1 A ASP 40 ? O ? A ASP 40 O 14 14 Y 1 A ASP 40 ? O ? A ASP 40 O 15 15 Y 1 A ASP 40 ? O ? A ASP 40 O 16 16 Y 1 A ASP 40 ? O ? A ASP 40 O 17 17 Y 1 A ASP 40 ? O ? A ASP 40 O 18 18 Y 1 A ASP 40 ? O ? A ASP 40 O 19 19 Y 1 A ASP 40 ? O ? A ASP 40 O 20 20 Y 1 A ASP 40 ? O ? A ASP 40 O # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5UP5 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 5UP5 _struct.title 'Solution structure of the de novo mini protein EHEE_rd1_0284' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5UP5 _struct_keywords.text 'de novo design, mini protein, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 5UP5 _struct_ref.pdbx_db_accession 5UP5 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5UP5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 40 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 5UP5 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 40 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 40 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 3620 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id GLU _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 10 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ARG _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 20 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLU _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 10 _struct_conf.end_auth_comp_id ARG _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 20 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLN A 2 ? GLU A 5 ? GLN A 2 GLU A 5 AA1 2 ARG A 36 ? TRP A 39 ? ARG A 36 TRP A 39 AA1 3 VAL A 26 ? THR A 29 ? VAL A 26 THR A 29 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLN A 4 ? N GLN A 4 O VAL A 37 ? O VAL A 37 AA1 2 3 O THR A 38 ? O THR A 38 N THR A 27 ? N THR A 27 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 10 ? ? 80.02 15.10 2 1 GLU A 22 ? ? -141.50 -63.56 3 1 GLN A 30 ? ? -101.09 65.46 4 1 ARG A 34 ? ? 62.16 97.90 5 1 TRP A 35 ? ? -67.87 80.94 6 2 ASN A 8 ? ? -75.51 20.91 7 2 ASN A 23 ? ? -161.30 113.49 8 2 ASN A 32 ? ? -58.90 94.69 9 3 GLU A 10 ? ? 73.08 35.60 10 3 GLN A 30 ? ? -54.11 104.09 11 4 ASN A 8 ? ? -86.27 37.80 12 4 GLU A 22 ? ? -86.56 -87.84 13 4 GLU A 31 ? ? -147.69 -70.52 14 4 ASN A 32 ? ? -173.82 116.19 15 5 GLU A 9 ? ? -96.60 37.37 16 6 ASP A 7 ? ? -115.10 78.66 17 6 ASN A 8 ? ? 69.48 -15.15 18 6 GLU A 9 ? ? -89.70 32.58 19 6 ASN A 23 ? ? 70.16 31.90 20 6 ARG A 25 ? ? -117.97 54.10 21 6 GLN A 30 ? ? -68.13 88.98 22 7 ASP A 7 ? ? -118.60 -164.34 23 7 ASN A 23 ? ? 61.66 77.09 24 7 GLN A 30 ? ? 64.56 84.24 25 7 TRP A 35 ? ? -54.66 84.00 26 8 GLU A 22 ? ? -129.91 -85.32 27 9 ASP A 7 ? ? -103.88 -164.70 28 9 GLU A 22 ? ? -90.30 -69.89 29 10 ASP A 7 ? ? -100.94 -169.12 30 10 ARG A 34 ? ? 51.37 84.86 31 11 GLU A 9 ? ? -73.90 24.72 32 11 GLU A 10 ? ? 70.16 30.39 33 12 ASN A 23 ? ? -104.66 -155.06 34 12 ASN A 32 ? ? 54.37 19.21 35 12 VAL A 37 ? ? -68.80 94.22 36 13 ASN A 8 ? ? 77.20 -16.82 37 14 GLU A 10 ? ? 69.22 70.94 38 14 ASN A 32 ? ? -62.19 96.70 39 15 ASP A 7 ? ? -167.59 -143.72 40 15 GLU A 22 ? ? 75.79 -49.24 41 15 GLU A 31 ? ? 59.97 14.75 42 16 THR A 3 ? ? -69.22 93.84 43 16 ASP A 7 ? ? -140.76 -7.47 44 16 GLU A 10 ? ? 64.76 70.63 45 16 GLU A 22 ? ? -107.32 -78.67 46 16 ARG A 24 ? ? -97.18 56.16 47 16 GLN A 30 ? ? -91.92 31.48 48 17 GLU A 9 ? ? -96.86 37.68 49 17 GLU A 22 ? ? -133.81 -36.74 50 17 GLU A 31 ? ? -168.14 113.29 51 18 TRP A 35 ? ? -66.12 97.32 52 19 GLN A 2 ? ? -89.28 38.58 53 19 ASN A 8 ? ? 74.76 -37.38 54 19 GLU A 22 ? ? -93.43 -69.27 55 19 ASN A 23 ? ? -102.50 -168.59 56 19 GLN A 30 ? ? -65.36 82.90 57 20 GLU A 9 ? ? -81.01 38.61 58 20 GLU A 22 ? ? 74.22 -27.51 59 20 GLN A 30 ? ? -79.94 49.21 # _pdbx_nmr_ensemble.entry_id 5UP5 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 5UP5 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '400 uM [U-13C; U-15N] protein, 150 mM unlabelled sodium chloride, 50 mM unlabelled sodium phosphate, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' _pdbx_nmr_sample_details.label '13C/15N sample' _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details 'pH 7.4, 150 mM NaCl, 50 mM NaPi' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 protein 400 ? uM '[U-13C; U-15N]' 1 'sodium chloride' 150 ? mM unlabelled 1 'sodium phosphate' 50 ? mM unlabelled # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.ionic_strength 150 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '3D 1H-15N NOESY' 1 isotropic 2 1 1 '3D 1H-13C NOESY' 1 isotropic 3 1 1 '3D HNCO' 2 isotropic 4 1 1 '3D HNCA' 2 isotropic 5 1 1 '3D CBCA(CO)NH' 2 isotropic 8 1 1 '3D HBHA(CO)NH' 2 isotropic 7 1 1 '2D 1H-15N HSQC' 1 isotropic 6 1 1 '2D 1H-13C HSQC' 1 isotropic # _pdbx_nmr_refine.entry_id 5UP5 _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CNS ? 'Brunger A. T. et.al.' 2 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 3 'chemical shift assignment' ABACUS ? 'Lemak and Arrowsmith' 4 'peak picking' Sparky ? Goddard # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 LEU N N N N 123 LEU CA C N S 124 LEU C C N N 125 LEU O O N N 126 LEU CB C N N 127 LEU CG C N N 128 LEU CD1 C N N 129 LEU CD2 C N N 130 LEU OXT O N N 131 LEU H H N N 132 LEU H2 H N N 133 LEU HA H N N 134 LEU HB2 H N N 135 LEU HB3 H N N 136 LEU HG H N N 137 LEU HD11 H N N 138 LEU HD12 H N N 139 LEU HD13 H N N 140 LEU HD21 H N N 141 LEU HD22 H N N 142 LEU HD23 H N N 143 LEU HXT H N N 144 LYS N N N N 145 LYS CA C N S 146 LYS C C N N 147 LYS O O N N 148 LYS CB C N N 149 LYS CG C N N 150 LYS CD C N N 151 LYS CE C N N 152 LYS NZ N N N 153 LYS OXT O N N 154 LYS H H N N 155 LYS H2 H N N 156 LYS HA H N N 157 LYS HB2 H N N 158 LYS HB3 H N N 159 LYS HG2 H N N 160 LYS HG3 H N N 161 LYS HD2 H N N 162 LYS HD3 H N N 163 LYS HE2 H N N 164 LYS HE3 H N N 165 LYS HZ1 H N N 166 LYS HZ2 H N N 167 LYS HZ3 H N N 168 LYS HXT H N N 169 PHE N N N N 170 PHE CA C N S 171 PHE C C N N 172 PHE O O N N 173 PHE CB C N N 174 PHE CG C Y N 175 PHE CD1 C Y N 176 PHE CD2 C Y N 177 PHE CE1 C Y N 178 PHE CE2 C Y N 179 PHE CZ C Y N 180 PHE OXT O N N 181 PHE H H N N 182 PHE H2 H N N 183 PHE HA H N N 184 PHE HB2 H N N 185 PHE HB3 H N N 186 PHE HD1 H N N 187 PHE HD2 H N N 188 PHE HE1 H N N 189 PHE HE2 H N N 190 PHE HZ H N N 191 PHE HXT H N N 192 THR N N N N 193 THR CA C N S 194 THR C C N N 195 THR O O N N 196 THR CB C N R 197 THR OG1 O N N 198 THR CG2 C N N 199 THR OXT O N N 200 THR H H N N 201 THR H2 H N N 202 THR HA H N N 203 THR HB H N N 204 THR HG1 H N N 205 THR HG21 H N N 206 THR HG22 H N N 207 THR HG23 H N N 208 THR HXT H N N 209 TRP N N N N 210 TRP CA C N S 211 TRP C C N N 212 TRP O O N N 213 TRP CB C N N 214 TRP CG C Y N 215 TRP CD1 C Y N 216 TRP CD2 C Y N 217 TRP NE1 N Y N 218 TRP CE2 C Y N 219 TRP CE3 C Y N 220 TRP CZ2 C Y N 221 TRP CZ3 C Y N 222 TRP CH2 C Y N 223 TRP OXT O N N 224 TRP H H N N 225 TRP H2 H N N 226 TRP HA H N N 227 TRP HB2 H N N 228 TRP HB3 H N N 229 TRP HD1 H N N 230 TRP HE1 H N N 231 TRP HE3 H N N 232 TRP HZ2 H N N 233 TRP HZ3 H N N 234 TRP HH2 H N N 235 TRP HXT H N N 236 VAL N N N N 237 VAL CA C N S 238 VAL C C N N 239 VAL O O N N 240 VAL CB C N N 241 VAL CG1 C N N 242 VAL CG2 C N N 243 VAL OXT O N N 244 VAL H H N N 245 VAL H2 H N N 246 VAL HA H N N 247 VAL HB H N N 248 VAL HG11 H N N 249 VAL HG12 H N N 250 VAL HG13 H N N 251 VAL HG21 H N N 252 VAL HG22 H N N 253 VAL HG23 H N N 254 VAL HXT H N N 255 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 LEU N CA sing N N 116 LEU N H sing N N 117 LEU N H2 sing N N 118 LEU CA C sing N N 119 LEU CA CB sing N N 120 LEU CA HA sing N N 121 LEU C O doub N N 122 LEU C OXT sing N N 123 LEU CB CG sing N N 124 LEU CB HB2 sing N N 125 LEU CB HB3 sing N N 126 LEU CG CD1 sing N N 127 LEU CG CD2 sing N N 128 LEU CG HG sing N N 129 LEU CD1 HD11 sing N N 130 LEU CD1 HD12 sing N N 131 LEU CD1 HD13 sing N N 132 LEU CD2 HD21 sing N N 133 LEU CD2 HD22 sing N N 134 LEU CD2 HD23 sing N N 135 LEU OXT HXT sing N N 136 LYS N CA sing N N 137 LYS N H sing N N 138 LYS N H2 sing N N 139 LYS CA C sing N N 140 LYS CA CB sing N N 141 LYS CA HA sing N N 142 LYS C O doub N N 143 LYS C OXT sing N N 144 LYS CB CG sing N N 145 LYS CB HB2 sing N N 146 LYS CB HB3 sing N N 147 LYS CG CD sing N N 148 LYS CG HG2 sing N N 149 LYS CG HG3 sing N N 150 LYS CD CE sing N N 151 LYS CD HD2 sing N N 152 LYS CD HD3 sing N N 153 LYS CE NZ sing N N 154 LYS CE HE2 sing N N 155 LYS CE HE3 sing N N 156 LYS NZ HZ1 sing N N 157 LYS NZ HZ2 sing N N 158 LYS NZ HZ3 sing N N 159 LYS OXT HXT sing N N 160 PHE N CA sing N N 161 PHE N H sing N N 162 PHE N H2 sing N N 163 PHE CA C sing N N 164 PHE CA CB sing N N 165 PHE CA HA sing N N 166 PHE C O doub N N 167 PHE C OXT sing N N 168 PHE CB CG sing N N 169 PHE CB HB2 sing N N 170 PHE CB HB3 sing N N 171 PHE CG CD1 doub Y N 172 PHE CG CD2 sing Y N 173 PHE CD1 CE1 sing Y N 174 PHE CD1 HD1 sing N N 175 PHE CD2 CE2 doub Y N 176 PHE CD2 HD2 sing N N 177 PHE CE1 CZ doub Y N 178 PHE CE1 HE1 sing N N 179 PHE CE2 CZ sing Y N 180 PHE CE2 HE2 sing N N 181 PHE CZ HZ sing N N 182 PHE OXT HXT sing N N 183 THR N CA sing N N 184 THR N H sing N N 185 THR N H2 sing N N 186 THR CA C sing N N 187 THR CA CB sing N N 188 THR CA HA sing N N 189 THR C O doub N N 190 THR C OXT sing N N 191 THR CB OG1 sing N N 192 THR CB CG2 sing N N 193 THR CB HB sing N N 194 THR OG1 HG1 sing N N 195 THR CG2 HG21 sing N N 196 THR CG2 HG22 sing N N 197 THR CG2 HG23 sing N N 198 THR OXT HXT sing N N 199 TRP N CA sing N N 200 TRP N H sing N N 201 TRP N H2 sing N N 202 TRP CA C sing N N 203 TRP CA CB sing N N 204 TRP CA HA sing N N 205 TRP C O doub N N 206 TRP C OXT sing N N 207 TRP CB CG sing N N 208 TRP CB HB2 sing N N 209 TRP CB HB3 sing N N 210 TRP CG CD1 doub Y N 211 TRP CG CD2 sing Y N 212 TRP CD1 NE1 sing Y N 213 TRP CD1 HD1 sing N N 214 TRP CD2 CE2 doub Y N 215 TRP CD2 CE3 sing Y N 216 TRP NE1 CE2 sing Y N 217 TRP NE1 HE1 sing N N 218 TRP CE2 CZ2 sing Y N 219 TRP CE3 CZ3 doub Y N 220 TRP CE3 HE3 sing N N 221 TRP CZ2 CH2 doub Y N 222 TRP CZ2 HZ2 sing N N 223 TRP CZ3 CH2 sing Y N 224 TRP CZ3 HZ3 sing N N 225 TRP CH2 HH2 sing N N 226 TRP OXT HXT sing N N 227 VAL N CA sing N N 228 VAL N H sing N N 229 VAL N H2 sing N N 230 VAL CA C sing N N 231 VAL CA CB sing N N 232 VAL CA HA sing N N 233 VAL C O doub N N 234 VAL C OXT sing N N 235 VAL CB CG1 sing N N 236 VAL CB CG2 sing N N 237 VAL CB HB sing N N 238 VAL CG1 HG11 sing N N 239 VAL CG1 HG12 sing N N 240 VAL CG1 HG13 sing N N 241 VAL CG2 HG21 sing N N 242 VAL CG2 HG22 sing N N 243 VAL CG2 HG23 sing N N 244 VAL OXT HXT sing N N 245 # _pdbx_audit_support.funding_organization 'Natural Sciences and Engineering Research Council (NSERC, Canada)' _pdbx_audit_support.country Canada _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE II' ? Bruker 800 ? 2 'AVANCE III' ? Bruker 600 ? # _atom_sites.entry_id 5UP5 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_