data_5UP8 # _entry.id 5UP8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5UP8 pdb_00005up8 10.2210/pdb5up8/pdb WWPDB D_1000226229 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-06-21 2 'Structure model' 1 1 2017-07-05 3 'Structure model' 1 2 2024-03-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Database references' 6 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' diffrn_detector 3 2 'Structure model' software 4 3 'Structure model' chem_comp_atom 5 3 'Structure model' chem_comp_bond 6 3 'Structure model' database_2 7 3 'Structure model' pdbx_struct_conn_angle 8 3 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_diffrn_detector.detector' 5 2 'Structure model' '_software.version' 6 3 'Structure model' '_database_2.pdbx_DOI' 7 3 'Structure model' '_database_2.pdbx_database_accession' 8 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 9 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 10 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 12 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 13 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 14 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 15 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 16 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 17 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 18 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 19 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 20 3 'Structure model' '_pdbx_struct_conn_angle.value' 21 3 'Structure model' '_struct_conn.pdbx_dist_value' 22 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 23 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 24 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 25 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 26 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 27 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 28 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 29 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 30 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 31 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 32 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 33 3 'Structure model' '_struct_conn.ptnr2_symmetry' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5UP8 _pdbx_database_status.recvd_initial_deposition_date 2017-02-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB '5CMQ contains an identical protein complexed with zinc in a face-centered cubic lattice.' 5CMQ unspecified PDB '5CMR contains a similar protein complexed with zinc and p-bdh, forming a similar protein-MOF.' 5CMR unspecified PDB '5UP7 contains an identical protein complexed with nickel in a face-centered cubic lattice.' 5UP7 unspecified PDB '5UP9 contains a similar protein complexed with zinc and p-xdh, forming a different protein-MOF.' 5UP9 unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Bailey, J.B.' 1 ? 'Zhang, L.' 2 ? 'Chiong, J.C.' 3 ? 'Ahn, S.' 4 ? 'Tezcan, F.A.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Am. Chem. Soc.' _citation.journal_id_ASTM JACSAT _citation.journal_id_CSD ? _citation.journal_id_ISSN 1520-5126 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 139 _citation.language ? _citation.page_first 8160 _citation.page_last 8166 _citation.title 'Synthetic Modularity of Protein-Metal-Organic Frameworks.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/jacs.7b01202 _citation.pdbx_database_id_PubMed 28590729 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bailey, J.B.' 1 ? primary 'Zhang, L.' 2 ? primary 'Chiong, J.A.' 3 ? primary 'Ahn, S.' 4 ? primary 'Tezcan, F.A.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ferritin heavy chain' 21122.291 1 1.16.3.1 ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 3 ? ? ? ? 3 non-polymer syn 'SODIUM ION' 22.990 1 ? ? ? ? 4 non-polymer syn "N,N'-dihydroxybenzene-1,4-dicarboxamide" 196.160 1 ? ? ? ? 5 water nat water 18.015 12 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Ferritin H subunit,Cell proliferation-inducing gene 15 protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;TTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRI FLQDIQKPDEDDWESGLNAMEAALHLEKNVNQSLLELHKLAHDKNDPHLADFIETHYLNEQVKAIKELGDHVTNLRKMGA PESGLAEYLFDKHTLGDSDNES ; _entity_poly.pdbx_seq_one_letter_code_can ;TTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRI FLQDIQKPDEDDWESGLNAMEAALHLEKNVNQSLLELHKLAHDKNDPHLADFIETHYLNEQVKAIKELGDHVTNLRKMGA PESGLAEYLFDKHTLGDSDNES ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 'SODIUM ION' NA 4 "N,N'-dihydroxybenzene-1,4-dicarboxamide" BYD 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 THR n 1 3 ALA n 1 4 SER n 1 5 THR n 1 6 SER n 1 7 GLN n 1 8 VAL n 1 9 ARG n 1 10 GLN n 1 11 ASN n 1 12 TYR n 1 13 HIS n 1 14 GLN n 1 15 ASP n 1 16 SER n 1 17 GLU n 1 18 ALA n 1 19 ALA n 1 20 ILE n 1 21 ASN n 1 22 ARG n 1 23 GLN n 1 24 ILE n 1 25 ASN n 1 26 LEU n 1 27 GLU n 1 28 LEU n 1 29 TYR n 1 30 ALA n 1 31 SER n 1 32 TYR n 1 33 VAL n 1 34 TYR n 1 35 LEU n 1 36 SER n 1 37 MET n 1 38 SER n 1 39 TYR n 1 40 TYR n 1 41 PHE n 1 42 ASP n 1 43 ARG n 1 44 ASP n 1 45 ASP n 1 46 VAL n 1 47 ALA n 1 48 LEU n 1 49 LYS n 1 50 ASN n 1 51 PHE n 1 52 ALA n 1 53 LYS n 1 54 TYR n 1 55 PHE n 1 56 LEU n 1 57 HIS n 1 58 GLN n 1 59 SER n 1 60 HIS n 1 61 GLU n 1 62 GLU n 1 63 ARG n 1 64 GLU n 1 65 HIS n 1 66 ALA n 1 67 GLU n 1 68 LYS n 1 69 LEU n 1 70 MET n 1 71 LYS n 1 72 LEU n 1 73 GLN n 1 74 ASN n 1 75 GLN n 1 76 ARG n 1 77 GLY n 1 78 GLY n 1 79 ARG n 1 80 ILE n 1 81 PHE n 1 82 LEU n 1 83 GLN n 1 84 ASP n 1 85 ILE n 1 86 GLN n 1 87 LYS n 1 88 PRO n 1 89 ASP n 1 90 GLU n 1 91 ASP n 1 92 ASP n 1 93 TRP n 1 94 GLU n 1 95 SER n 1 96 GLY n 1 97 LEU n 1 98 ASN n 1 99 ALA n 1 100 MET n 1 101 GLU n 1 102 ALA n 1 103 ALA n 1 104 LEU n 1 105 HIS n 1 106 LEU n 1 107 GLU n 1 108 LYS n 1 109 ASN n 1 110 VAL n 1 111 ASN n 1 112 GLN n 1 113 SER n 1 114 LEU n 1 115 LEU n 1 116 GLU n 1 117 LEU n 1 118 HIS n 1 119 LYS n 1 120 LEU n 1 121 ALA n 1 122 HIS n 1 123 ASP n 1 124 LYS n 1 125 ASN n 1 126 ASP n 1 127 PRO n 1 128 HIS n 1 129 LEU n 1 130 ALA n 1 131 ASP n 1 132 PHE n 1 133 ILE n 1 134 GLU n 1 135 THR n 1 136 HIS n 1 137 TYR n 1 138 LEU n 1 139 ASN n 1 140 GLU n 1 141 GLN n 1 142 VAL n 1 143 LYS n 1 144 ALA n 1 145 ILE n 1 146 LYS n 1 147 GLU n 1 148 LEU n 1 149 GLY n 1 150 ASP n 1 151 HIS n 1 152 VAL n 1 153 THR n 1 154 ASN n 1 155 LEU n 1 156 ARG n 1 157 LYS n 1 158 MET n 1 159 GLY n 1 160 ALA n 1 161 PRO n 1 162 GLU n 1 163 SER n 1 164 GLY n 1 165 LEU n 1 166 ALA n 1 167 GLU n 1 168 TYR n 1 169 LEU n 1 170 PHE n 1 171 ASP n 1 172 LYS n 1 173 HIS n 1 174 THR n 1 175 LEU n 1 176 GLY n 1 177 ASP n 1 178 SER n 1 179 ASP n 1 180 ASN n 1 181 GLU n 1 182 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 182 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'FTH1, FTH, FTHL6, OK/SW-cl.84, PIG15' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BYD non-polymer . "N,N'-dihydroxybenzene-1,4-dicarboxamide" ? 'C8 H8 N2 O4' 196.160 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 1 ? ? ? A . n A 1 2 THR 2 2 ? ? ? A . n A 1 3 ALA 3 3 ? ? ? A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 TYR 12 12 12 TYR TYR A . n A 1 13 HIS 13 13 13 HIS HIS A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 MET 37 37 37 MET MET A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 PHE 41 41 41 PHE PHE A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 PHE 55 55 55 PHE PHE A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 HIS 57 57 57 HIS HIS A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 HIS 60 60 60 HIS HIS A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 HIS 65 65 65 HIS HIS A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 MET 70 70 70 MET MET A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 GLN 73 73 73 GLN GLN A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 GLN 75 75 75 GLN GLN A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 PHE 81 81 81 PHE PHE A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 GLN 83 83 83 GLN GLN A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 GLN 86 86 86 GLN GLN A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 TRP 93 93 93 TRP TRP A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 ASN 98 98 98 ASN ASN A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 MET 100 100 100 MET MET A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 HIS 105 105 105 HIS HIS A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 ASN 109 109 109 ASN ASN A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 GLN 112 112 112 GLN GLN A . n A 1 113 SER 113 113 113 SER SER A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 HIS 118 118 118 HIS HIS A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 HIS 122 122 122 HIS HIS A . n A 1 123 ASP 123 123 123 ASP ASP A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 ASN 125 125 125 ASN ASN A . n A 1 126 ASP 126 126 126 ASP ASP A . n A 1 127 PRO 127 127 127 PRO PRO A . n A 1 128 HIS 128 128 128 HIS HIS A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 ASP 131 131 131 ASP ASP A . n A 1 132 PHE 132 132 132 PHE PHE A . n A 1 133 ILE 133 133 133 ILE ILE A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 THR 135 135 135 THR THR A . n A 1 136 HIS 136 136 136 HIS HIS A . n A 1 137 TYR 137 137 137 TYR TYR A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 ASN 139 139 139 ASN ASN A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 GLN 141 141 141 GLN GLN A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 LYS 143 143 143 LYS LYS A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 ILE 145 145 145 ILE ILE A . n A 1 146 LYS 146 146 146 LYS LYS A . n A 1 147 GLU 147 147 147 GLU GLU A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 GLY 149 149 149 GLY GLY A . n A 1 150 ASP 150 150 150 ASP ASP A . n A 1 151 HIS 151 151 151 HIS HIS A . n A 1 152 VAL 152 152 152 VAL VAL A . n A 1 153 THR 153 153 153 THR THR A . n A 1 154 ASN 154 154 154 ASN ASN A . n A 1 155 LEU 155 155 155 LEU LEU A . n A 1 156 ARG 156 156 156 ARG ARG A . n A 1 157 LYS 157 157 157 LYS LYS A . n A 1 158 MET 158 158 158 MET MET A . n A 1 159 GLY 159 159 159 GLY GLY A . n A 1 160 ALA 160 160 160 ALA ALA A . n A 1 161 PRO 161 161 161 PRO PRO A . n A 1 162 GLU 162 162 162 GLU GLU A . n A 1 163 SER 163 163 163 SER SER A . n A 1 164 GLY 164 164 164 GLY GLY A . n A 1 165 LEU 165 165 165 LEU LEU A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 GLU 167 167 167 GLU GLU A . n A 1 168 TYR 168 168 168 TYR TYR A . n A 1 169 LEU 169 169 169 LEU LEU A . n A 1 170 PHE 170 170 170 PHE PHE A . n A 1 171 ASP 171 171 171 ASP ASP A . n A 1 172 LYS 172 172 172 LYS LYS A . n A 1 173 HIS 173 173 173 HIS HIS A . n A 1 174 THR 174 174 174 THR THR A . n A 1 175 LEU 175 175 175 LEU LEU A . n A 1 176 GLY 176 176 176 GLY GLY A . n A 1 177 ASP 177 177 177 ASP ASP A . n A 1 178 SER 178 178 178 SER SER A . n A 1 179 ASP 179 179 179 ASP ASP A . n A 1 180 ASN 180 180 ? ? ? A . n A 1 181 GLU 181 181 ? ? ? A . n A 1 182 SER 182 182 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 1 ZN ZN A . C 2 ZN 1 202 2 ZN ZN A . D 2 ZN 1 203 3 ZN ZN A . E 3 NA 1 204 1 NA NA A . F 4 BYD 1 205 1 BYD BYD A . G 5 HOH 1 301 3 HOH HOH A . G 5 HOH 2 302 9 HOH HOH A . G 5 HOH 3 303 4 HOH HOH A . G 5 HOH 4 304 1 HOH HOH A . G 5 HOH 5 305 2 HOH HOH A . G 5 HOH 6 306 10 HOH HOH A . G 5 HOH 7 307 11 HOH HOH A . G 5 HOH 8 308 12 HOH HOH A . G 5 HOH 9 309 5 HOH HOH A . G 5 HOH 10 310 8 HOH HOH A . G 5 HOH 11 311 6 HOH HOH A . G 5 HOH 12 312 7 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A SER 4 ? CB ? A SER 4 CB 2 1 Y 1 A SER 4 ? OG ? A SER 4 OG 3 1 Y 1 A GLN 14 ? CG ? A GLN 14 CG 4 1 Y 1 A GLN 14 ? CD ? A GLN 14 CD 5 1 Y 1 A GLN 14 ? OE1 ? A GLN 14 OE1 6 1 Y 1 A GLN 14 ? NE2 ? A GLN 14 NE2 7 1 Y 1 A LYS 49 ? CG ? A LYS 49 CG 8 1 Y 1 A LYS 49 ? CD ? A LYS 49 CD 9 1 Y 1 A LYS 49 ? CE ? A LYS 49 CE 10 1 Y 1 A LYS 49 ? NZ ? A LYS 49 NZ 11 1 Y 1 A LYS 53 ? CD ? A LYS 53 CD 12 1 Y 1 A LYS 53 ? CE ? A LYS 53 CE 13 1 Y 1 A LYS 53 ? NZ ? A LYS 53 NZ 14 1 Y 1 A GLU 64 ? CD ? A GLU 64 CD 15 1 Y 1 A GLU 64 ? OE1 ? A GLU 64 OE1 16 1 Y 1 A GLU 64 ? OE2 ? A GLU 64 OE2 17 1 Y 1 A LYS 87 ? CG ? A LYS 87 CG 18 1 Y 1 A LYS 87 ? CD ? A LYS 87 CD 19 1 Y 1 A LYS 87 ? CE ? A LYS 87 CE 20 1 Y 1 A LYS 87 ? NZ ? A LYS 87 NZ 21 1 Y 1 A LYS 108 ? CE ? A LYS 108 CE 22 1 Y 1 A LYS 108 ? NZ ? A LYS 108 NZ 23 1 Y 1 A LYS 119 ? CG ? A LYS 119 CG 24 1 Y 1 A LYS 119 ? CD ? A LYS 119 CD 25 1 Y 1 A LYS 119 ? CE ? A LYS 119 CE 26 1 Y 1 A LYS 119 ? NZ ? A LYS 119 NZ 27 1 Y 1 A LYS 124 ? CG ? A LYS 124 CG 28 1 Y 1 A LYS 124 ? CD ? A LYS 124 CD 29 1 Y 1 A LYS 124 ? CE ? A LYS 124 CE 30 1 Y 1 A LYS 124 ? NZ ? A LYS 124 NZ 31 1 Y 1 A GLU 140 ? CG ? A GLU 140 CG 32 1 Y 1 A GLU 140 ? CD ? A GLU 140 CD 33 1 Y 1 A GLU 140 ? OE1 ? A GLU 140 OE1 34 1 Y 1 A GLU 140 ? OE2 ? A GLU 140 OE2 35 1 Y 1 A GLU 162 ? CG ? A GLU 162 CG 36 1 Y 1 A GLU 162 ? CD ? A GLU 162 CD 37 1 Y 1 A GLU 162 ? OE1 ? A GLU 162 OE1 38 1 Y 1 A GLU 162 ? OE2 ? A GLU 162 OE2 39 1 Y 1 A LYS 172 ? CG ? A LYS 172 CG 40 1 Y 1 A LYS 172 ? CD ? A LYS 172 CD 41 1 Y 1 A LYS 172 ? CE ? A LYS 172 CE 42 1 Y 1 A LYS 172 ? NZ ? A LYS 172 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.10.1_2155 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? iMOSFLM ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.entry_id 5UP8 _cell.length_a 155.810 _cell.length_b 155.810 _cell.length_c 155.810 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 48 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5UP8 _symmetry.space_group_name_H-M 'I 4 3 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 211 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5UP8 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.73 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 67.03 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;Reservoir: 500 uL total volume: 50 mM CHES (pH 8.5), 150 mM NaCl, 0.14 mM ZnCl2 Sitting Drop: 8.6 uL reservoir, 1 uL of 12.5 uM ferritin, 2.4 uL of 5 mM p-H2bdh in 50 mM CHES (pH 9.5) with 150 mM NaCl ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-07-08 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9795 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRL BEAMLINE BL12-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9795 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL12-2 _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5UP8 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.63 _reflns.d_resolution_low 49.27 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9926 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.30 _reflns.pdbx_Rmerge_I_obs 0.189 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.63 _reflns_shell.d_res_low 2.75 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.3 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all 1189 _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.658 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 23 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.554 _reflns_shell.pdbx_R_split ? # _refine.B_iso_max 154.87 _refine.B_iso_mean 84.5949 _refine.B_iso_min 47.02 _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5UP8 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_R_factor_R_free 0.262 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.209 _refine.ls_R_factor_all ? _refine.ls_R_factor_gt ? _refine.ls_R_factor_obs 0.212 _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_abs_structure_details ? _refine.ls_d_res_high 2.631 _refine.ls_d_res_low 49.27 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_goodness_of_fit_ref ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_R_free 492 _refine.ls_number_reflns_R_work 9430 _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9922 _refine.ls_number_restraints ? _refine.ls_percent_reflns_R_free ? _refine.ls_percent_reflns_obs 100.0 _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.ls_structure_factor_coef ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_average_fsc_free ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_density_correlation ? _refine.pdbx_diffrn_id 1 _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd 1.35 _refine.pdbx_ls_sigma_I ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_phase_error 28.53 _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_real_space_R ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_starting_model ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1403 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 18 _refine_hist.number_atoms_solvent 12 _refine_hist.number_atoms_total 1433 _refine_hist.d_res_high 2.631 _refine_hist.d_res_low 49.27 # loop_ _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.percent_reflns_obs _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_R_work _refine_ls_shell.R_factor_R_free _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.pdbx_refine_id 2.6307 2.8954 4 100.0000 2300 . 0.2740 0.3410 . 120 0.0000 2420 . 'X-RAY DIFFRACTION' 2.8954 3.3143 4 100.0000 2309 . 0.2371 0.2992 . 119 0.0000 2428 . 'X-RAY DIFFRACTION' 3.3143 4.1753 4 100.0000 2359 . 0.1990 0.2348 . 111 0.0000 2470 . 'X-RAY DIFFRACTION' 4.1753 49.2801 4 100.0000 2462 . 0.1933 0.2520 . 142 0.0000 2604 . 'X-RAY DIFFRACTION' # _struct.entry_id 5UP8 _struct.title 'Crystal Structure of the Zn-bound Human Heavy-Chain variant 122H-delta C-star with para-benzenedihydroxamate' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5UP8 _struct_keywords.text 'oxidoreductase, self-assembly, protein-MOF, protein-metal-organic framework' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 4 ? G N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FRIH_HUMAN _struct_ref.pdbx_db_accession P02794 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;TTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRI FLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGA PESGLAEYLFDKHTLGDSDNES ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5UP8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 182 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02794 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 183 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 182 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5UP8 GLN A 86 ? UNP P02794 LYS 87 'engineered mutation' 86 1 1 5UP8 GLU A 90 ? UNP P02794 CYS 91 'engineered mutation' 90 2 1 5UP8 ALA A 102 ? UNP P02794 CYS 103 'engineered mutation' 102 3 1 5UP8 HIS A 122 ? UNP P02794 THR 123 'engineered mutation' 122 4 1 5UP8 ALA A 130 ? UNP P02794 CYS 131 'engineered mutation' 130 5 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details 24-meric _pdbx_struct_assembly.oligomeric_count 24 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 5 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 6 'crystal symmetry operation' 6_555 z,-x,-y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 7 'crystal symmetry operation' 7_555 -z,-x,y 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 8 'crystal symmetry operation' 8_555 -z,x,-y 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 9 'crystal symmetry operation' 9_555 y,z,x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 10 'crystal symmetry operation' 10_555 -y,z,-x 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 11 'crystal symmetry operation' 11_555 y,-z,-x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 12 'crystal symmetry operation' 12_555 -y,-z,x 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 13 'crystal symmetry operation' 13_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 14 'crystal symmetry operation' 14_555 -y,-x,-z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 15 'crystal symmetry operation' 15_555 y,-x,z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 16 'crystal symmetry operation' 16_555 -y,x,z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 17 'crystal symmetry operation' 17_555 x,z,-y 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 18 'crystal symmetry operation' 18_555 -x,z,y -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 19 'crystal symmetry operation' 19_555 -x,-z,-y -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 20 'crystal symmetry operation' 20_555 x,-z,y 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 21 'crystal symmetry operation' 21_555 z,y,-x 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 22 'crystal symmetry operation' 22_555 z,-y,x 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 23 'crystal symmetry operation' 23_555 -z,y,x 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 24 'crystal symmetry operation' 24_555 -z,-y,-x 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 13 ? ASP A 42 ? HIS A 13 ASP A 42 1 ? 30 HELX_P HELX_P2 AA2 LEU A 48 ? GLY A 77 ? LEU A 48 GLY A 77 1 ? 30 HELX_P HELX_P3 AA3 SER A 95 ? LYS A 124 ? SER A 95 LYS A 124 1 ? 30 HELX_P HELX_P4 AA4 ASP A 126 ? TYR A 137 ? ASP A 126 TYR A 137 1 ? 12 HELX_P HELX_P5 AA5 TYR A 137 ? GLY A 159 ? TYR A 137 GLY A 159 1 ? 23 HELX_P HELX_P6 AA6 SER A 163 ? THR A 174 ? SER A 163 THR A 174 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLU 27 OE2 ? ? ? 1_555 B ZN . ZN ? ? A GLU 27 A ZN 201 1_555 ? ? ? ? ? ? ? 2.128 ? ? metalc2 metalc ? ? A GLU 62 OE2 ? ? ? 1_555 B ZN . ZN ? ? A GLU 62 A ZN 201 1_555 ? ? ? ? ? ? ? 2.107 ? ? metalc3 metalc ? ? A GLU 62 OE1 ? ? ? 1_555 C ZN . ZN ? ? A GLU 62 A ZN 202 1_555 ? ? ? ? ? ? ? 1.808 ? ? metalc4 metalc ? ? A HIS 65 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 65 A ZN 201 1_555 ? ? ? ? ? ? ? 2.386 ? ? metalc5 metalc ? ? A GLU 107 OE1 ? ? ? 1_555 C ZN . ZN ? ? A GLU 107 A ZN 202 1_555 ? ? ? ? ? ? ? 2.490 ? ? metalc6 metalc ? ? A HIS 122 NE2 ? ? ? 1_555 D ZN . ZN ? ? A HIS 122 A ZN 203 1_555 ? ? ? ? ? ? ? 2.152 ? ? metalc7 metalc ? ? A HIS 122 NE2 ? ? ? 1_555 D ZN . ZN ? ? A HIS 122 A ZN 203 7_555 ? ? ? ? ? ? ? 2.152 ? ? metalc8 metalc ? ? A ASP 131 OD1 ? ? ? 1_555 E NA . NA ? ? A ASP 131 A NA 204 1_555 ? ? ? ? ? ? ? 2.445 ? ? metalc9 metalc ? ? A ASP 131 OD1 ? ? ? 1_555 E NA . NA ? ? A ASP 131 A NA 204 7_555 ? ? ? ? ? ? ? 2.445 ? ? metalc10 metalc ? ? A GLU 134 OE2 ? ? ? 1_555 E NA . NA ? ? A GLU 134 A NA 204 1_555 ? ? ? ? ? ? ? 2.329 ? ? metalc11 metalc ? ? A GLU 134 OE2 ? ? ? 1_555 E NA . NA ? ? A GLU 134 A NA 204 7_555 ? ? ? ? ? ? ? 2.329 ? ? metalc12 metalc ? ? B ZN . ZN ? ? ? 1_555 G HOH . O ? ? A ZN 201 A HOH 302 1_555 ? ? ? ? ? ? ? 2.099 ? ? metalc13 metalc ? ? D ZN . ZN ? ? ? 1_555 F BYD . OAJ ? ? A ZN 203 A BYD 205 1_555 ? ? ? ? ? ? ? 2.104 ? ? metalc14 metalc ? ? D ZN . ZN ? ? ? 1_555 F BYD . OAH ? ? A ZN 203 A BYD 205 1_555 ? ? ? ? ? ? ? 2.262 ? ? metalc15 metalc ? ? D ZN . ZN ? ? ? 1_555 F BYD . OAJ ? ? A ZN 203 A BYD 205 7_555 ? ? ? ? ? ? ? 2.104 ? ? metalc16 metalc ? ? D ZN . ZN ? ? ? 1_555 F BYD . OAN ? ? A ZN 203 A BYD 205 43_455 ? ? ? ? ? ? ? 2.129 ? ? metalc17 metalc ? ? D ZN . ZN ? ? ? 1_555 F BYD . OAH ? ? A ZN 203 A BYD 205 7_555 ? ? ? ? ? ? ? 2.262 ? ? metalc18 metalc ? ? D ZN . ZN ? ? ? 1_555 F BYD . OAM ? ? A ZN 203 A BYD 205 37_455 ? ? ? ? ? ? ? 2.279 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE2 ? A GLU 27 ? A GLU 27 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 OE2 ? A GLU 62 ? A GLU 62 ? 1_555 81.3 ? 2 OE2 ? A GLU 27 ? A GLU 27 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 65 ? A HIS 65 ? 1_555 90.2 ? 3 OE2 ? A GLU 62 ? A GLU 62 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 65 ? A HIS 65 ? 1_555 101.2 ? 4 OE2 ? A GLU 27 ? A GLU 27 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 O ? G HOH . ? A HOH 302 ? 1_555 93.0 ? 5 OE2 ? A GLU 62 ? A GLU 62 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 O ? G HOH . ? A HOH 302 ? 1_555 173.2 ? 6 ND1 ? A HIS 65 ? A HIS 65 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 O ? G HOH . ? A HOH 302 ? 1_555 74.9 ? 7 OE1 ? A GLU 62 ? A GLU 62 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 OE1 ? A GLU 107 ? A GLU 107 ? 1_555 95.4 ? 8 NE2 ? A HIS 122 ? A HIS 122 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 NE2 ? A HIS 122 ? A HIS 122 ? 1_555 0.0 ? 9 NE2 ? A HIS 122 ? A HIS 122 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OAJ ? F BYD . ? A BYD 205 ? 1_555 67.4 ? 10 NE2 ? A HIS 122 ? A HIS 122 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OAJ ? F BYD . ? A BYD 205 ? 1_555 67.4 ? 11 NE2 ? A HIS 122 ? A HIS 122 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OAH ? F BYD . ? A BYD 205 ? 1_555 101.0 ? 12 NE2 ? A HIS 122 ? A HIS 122 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OAH ? F BYD . ? A BYD 205 ? 1_555 101.0 ? 13 OAJ ? F BYD . ? A BYD 205 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OAH ? F BYD . ? A BYD 205 ? 1_555 79.1 ? 14 NE2 ? A HIS 122 ? A HIS 122 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OAJ ? F BYD . ? A BYD 205 ? 7_555 70.2 ? 15 NE2 ? A HIS 122 ? A HIS 122 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OAJ ? F BYD . ? A BYD 205 ? 7_555 70.2 ? 16 OAJ ? F BYD . ? A BYD 205 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OAJ ? F BYD . ? A BYD 205 ? 7_555 105.5 ? 17 OAH ? F BYD . ? A BYD 205 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OAJ ? F BYD . ? A BYD 205 ? 7_555 53.1 ? 18 NE2 ? A HIS 122 ? A HIS 122 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OAN ? F BYD . ? A BYD 205 ? 43_455 70.8 ? 19 NE2 ? A HIS 122 ? A HIS 122 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OAN ? F BYD . ? A BYD 205 ? 43_455 70.8 ? 20 OAJ ? F BYD . ? A BYD 205 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OAN ? F BYD . ? A BYD 205 ? 43_455 105.1 ? 21 OAH ? F BYD . ? A BYD 205 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OAN ? F BYD . ? A BYD 205 ? 43_455 52.0 ? 22 OAJ ? F BYD . ? A BYD 205 ? 7_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OAN ? F BYD . ? A BYD 205 ? 43_455 1.1 ? 23 NE2 ? A HIS 122 ? A HIS 122 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OAH ? F BYD . ? A BYD 205 ? 7_555 116.2 ? 24 NE2 ? A HIS 122 ? A HIS 122 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OAH ? F BYD . ? A BYD 205 ? 7_555 116.2 ? 25 OAJ ? F BYD . ? A BYD 205 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OAH ? F BYD . ? A BYD 205 ? 7_555 69.2 ? 26 OAH ? F BYD . ? A BYD 205 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OAH ? F BYD . ? A BYD 205 ? 7_555 26.1 ? 27 OAJ ? F BYD . ? A BYD 205 ? 7_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OAH ? F BYD . ? A BYD 205 ? 7_555 79.1 ? 28 OAN ? F BYD . ? A BYD 205 ? 43_455 ZN ? D ZN . ? A ZN 203 ? 1_555 OAH ? F BYD . ? A BYD 205 ? 7_555 78.1 ? 29 NE2 ? A HIS 122 ? A HIS 122 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OAM ? F BYD . ? A BYD 205 ? 37_455 90.0 ? 30 NE2 ? A HIS 122 ? A HIS 122 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OAM ? F BYD . ? A BYD 205 ? 37_455 90.0 ? 31 OAJ ? F BYD . ? A BYD 205 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OAM ? F BYD . ? A BYD 205 ? 37_455 55.1 ? 32 OAH ? F BYD . ? A BYD 205 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OAM ? F BYD . ? A BYD 205 ? 37_455 24.0 ? 33 OAJ ? F BYD . ? A BYD 205 ? 7_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OAM ? F BYD . ? A BYD 205 ? 37_455 67.0 ? 34 OAN ? F BYD . ? A BYD 205 ? 43_455 ZN ? D ZN . ? A ZN 203 ? 1_555 OAM ? F BYD . ? A BYD 205 ? 37_455 66.0 ? 35 OAH ? F BYD . ? A BYD 205 ? 7_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OAM ? F BYD . ? A BYD 205 ? 37_455 26.2 ? 36 OD1 ? A ASP 131 ? A ASP 131 ? 1_555 NA ? E NA . ? A NA 204 ? 1_555 OD1 ? A ASP 131 ? A ASP 131 ? 1_555 0.0 ? 37 OD1 ? A ASP 131 ? A ASP 131 ? 1_555 NA ? E NA . ? A NA 204 ? 1_555 OE2 ? A GLU 134 ? A GLU 134 ? 1_555 90.9 ? 38 OD1 ? A ASP 131 ? A ASP 131 ? 1_555 NA ? E NA . ? A NA 204 ? 1_555 OE2 ? A GLU 134 ? A GLU 134 ? 1_555 90.9 ? 39 OD1 ? A ASP 131 ? A ASP 131 ? 1_555 NA ? E NA . ? A NA 204 ? 1_555 OE2 ? A GLU 134 ? A GLU 134 ? 1_555 90.9 ? 40 OD1 ? A ASP 131 ? A ASP 131 ? 1_555 NA ? E NA . ? A NA 204 ? 1_555 OE2 ? A GLU 134 ? A GLU 134 ? 1_555 90.9 ? 41 OE2 ? A GLU 134 ? A GLU 134 ? 1_555 NA ? E NA . ? A NA 204 ? 1_555 OE2 ? A GLU 134 ? A GLU 134 ? 1_555 0.0 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ALA _struct_mon_prot_cis.label_seq_id 160 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ALA _struct_mon_prot_cis.auth_seq_id 160 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 161 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 161 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 1.11 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 6 'binding site for residue ZN A 201' AC2 Software A ZN 202 ? 4 'binding site for residue ZN A 202' AC3 Software A ZN 203 ? 9 'binding site for residue ZN A 203' AC4 Software A NA 204 ? 6 'binding site for residue NA A 204' AC5 Software A BYD 205 ? 12 'binding site for residue BYD A 205' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 GLU A 27 ? GLU A 27 . ? 1_555 ? 2 AC1 6 GLU A 62 ? GLU A 62 . ? 1_555 ? 3 AC1 6 HIS A 65 ? HIS A 65 . ? 1_555 ? 4 AC1 6 GLN A 141 ? GLN A 141 . ? 1_555 ? 5 AC1 6 ZN C . ? ZN A 202 . ? 1_555 ? 6 AC1 6 HOH G . ? HOH A 302 . ? 1_555 ? 7 AC2 4 GLU A 62 ? GLU A 62 . ? 1_555 ? 8 AC2 4 GLU A 107 ? GLU A 107 . ? 1_555 ? 9 AC2 4 GLN A 141 ? GLN A 141 . ? 1_555 ? 10 AC2 4 ZN B . ? ZN A 201 . ? 1_555 ? 11 AC3 9 HIS A 122 ? HIS A 122 . ? 7_555 ? 12 AC3 9 HIS A 122 ? HIS A 122 . ? 1_555 ? 13 AC3 9 HIS A 122 ? HIS A 122 . ? 10_555 ? 14 AC3 9 BYD F . ? BYD A 205 . ? 10_555 ? 15 AC3 9 BYD F . ? BYD A 205 . ? 1_555 ? 16 AC3 9 BYD F . ? BYD A 205 . ? 46_455 ? 17 AC3 9 BYD F . ? BYD A 205 . ? 43_455 ? 18 AC3 9 BYD F . ? BYD A 205 . ? 37_455 ? 19 AC3 9 BYD F . ? BYD A 205 . ? 7_555 ? 20 AC4 6 ASP A 131 ? ASP A 131 . ? 7_555 ? 21 AC4 6 ASP A 131 ? ASP A 131 . ? 1_555 ? 22 AC4 6 ASP A 131 ? ASP A 131 . ? 10_555 ? 23 AC4 6 GLU A 134 ? GLU A 134 . ? 10_555 ? 24 AC4 6 GLU A 134 ? GLU A 134 . ? 7_555 ? 25 AC4 6 GLU A 134 ? GLU A 134 . ? 1_555 ? 26 AC5 12 HIS A 122 ? HIS A 122 . ? 1_555 ? 27 AC5 12 HIS A 122 ? HIS A 122 . ? 37_455 ? 28 AC5 12 HIS A 122 ? HIS A 122 . ? 7_555 ? 29 AC5 12 HIS A 122 ? HIS A 122 . ? 43_455 ? 30 AC5 12 HIS A 122 ? HIS A 122 . ? 46_455 ? 31 AC5 12 HIS A 122 ? HIS A 122 . ? 10_555 ? 32 AC5 12 ZN D . ? ZN A 203 . ? 46_455 ? 33 AC5 12 ZN D . ? ZN A 203 . ? 43_455 ? 34 AC5 12 ZN D . ? ZN A 203 . ? 37_455 ? 35 AC5 12 ZN D . ? ZN A 203 . ? 10_555 ? 36 AC5 12 ZN D . ? ZN A 203 . ? 7_555 ? 37 AC5 12 ZN D . ? ZN A 203 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 10 ? ? -178.64 115.90 2 1 VAL A 46 ? ? -120.40 -59.77 3 1 SER A 178 ? ? 86.49 -163.24 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A ZN 203 ? D ZN . 2 1 A NA 204 ? E NA . 3 1 A HOH 303 ? G HOH . 4 1 A HOH 310 ? G HOH . # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined -35.5223 10.8198 38.0058 0.7807 1.2666 0.7511 0.1410 0.6091 -0.2018 0.6653 1.0590 1.2559 0.2756 0.5107 0.7921 -0.0071 0.1487 0.4370 -0.4962 0.1377 0.1724 0.2872 -0.3704 -0.3600 'X-RAY DIFFRACTION' 2 ? refined -46.8150 -9.2934 18.6206 0.5413 1.2765 1.0721 -0.1113 0.2688 0.1099 0.0806 3.1416 4.3688 -0.1157 0.5450 0.6433 0.2527 0.1760 -0.4441 -0.5701 -0.2493 0.8854 0.4983 0.0851 -0.6570 'X-RAY DIFFRACTION' 3 ? refined -32.4727 7.3181 29.2954 0.5505 1.0982 0.7249 0.0747 0.4499 -0.1558 1.1227 1.6044 1.4016 0.7001 1.0208 0.9779 -0.0775 0.4632 0.0798 -0.1255 0.1442 0.2253 0.3794 -0.2682 0.1194 'X-RAY DIFFRACTION' 4 ? refined -39.9122 14.0713 33.1800 0.7617 1.3529 1.0184 0.1834 0.6568 -0.2475 0.7584 0.2566 0.6179 0.1564 0.1858 0.0412 -0.0216 0.0171 0.1226 -0.4202 0.1546 0.4631 0.3704 -0.0885 -0.5559 'X-RAY DIFFRACTION' 5 ? refined -46.0485 8.1274 13.5681 0.2941 1.1134 1.0570 0.1782 0.2478 -0.0654 0.4464 2.0386 2.3946 -0.8167 -0.8193 1.6024 0.0398 -0.1286 -0.0249 -0.0619 0.0203 0.7958 0.1447 -0.0812 -0.8134 'X-RAY DIFFRACTION' 6 ? refined -36.5982 4.9274 11.2066 0.2533 0.6722 0.6486 0.0074 0.0950 0.0466 3.7968 8.7164 1.3687 0.4350 0.4956 -0.8195 -0.0755 -0.3853 0.4671 -0.1143 -1.0481 2.3317 0.3307 0.4879 -3.1235 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 4 through 41 ) ; 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 42 through 48 ) ; 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 49 through 76 ) ; 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 77 through 137 ) ; 'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 138 through 173 ) ; 'X-RAY DIFFRACTION' 6 6 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 174 through 179 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A THR 1 ? A THR 1 2 1 Y 1 A THR 2 ? A THR 2 3 1 Y 1 A ALA 3 ? A ALA 3 4 1 Y 1 A ASN 180 ? A ASN 180 5 1 Y 1 A GLU 181 ? A GLU 181 6 1 Y 1 A SER 182 ? A SER 182 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 BYD CAA C Y N 74 BYD CAB C Y N 75 BYD CAC C Y N 76 BYD CAD C Y N 77 BYD CAE C Y N 78 BYD CAF C Y N 79 BYD CAG C N N 80 BYD CAK C N N 81 BYD NAI N N N 82 BYD NAL N N N 83 BYD OAH O N N 84 BYD OAJ O N N 85 BYD OAM O N N 86 BYD OAN O N N 87 BYD HAA H N N 88 BYD HAB H N N 89 BYD HAD H N N 90 BYD HAE H N N 91 BYD HAI H N N 92 BYD HAL H N N 93 BYD HAJ H N N 94 BYD HAN H N N 95 CYS N N N N 96 CYS CA C N R 97 CYS C C N N 98 CYS O O N N 99 CYS CB C N N 100 CYS SG S N N 101 CYS OXT O N N 102 CYS H H N N 103 CYS H2 H N N 104 CYS HA H N N 105 CYS HB2 H N N 106 CYS HB3 H N N 107 CYS HG H N N 108 CYS HXT H N N 109 GLN N N N N 110 GLN CA C N S 111 GLN C C N N 112 GLN O O N N 113 GLN CB C N N 114 GLN CG C N N 115 GLN CD C N N 116 GLN OE1 O N N 117 GLN NE2 N N N 118 GLN OXT O N N 119 GLN H H N N 120 GLN H2 H N N 121 GLN HA H N N 122 GLN HB2 H N N 123 GLN HB3 H N N 124 GLN HG2 H N N 125 GLN HG3 H N N 126 GLN HE21 H N N 127 GLN HE22 H N N 128 GLN HXT H N N 129 GLU N N N N 130 GLU CA C N S 131 GLU C C N N 132 GLU O O N N 133 GLU CB C N N 134 GLU CG C N N 135 GLU CD C N N 136 GLU OE1 O N N 137 GLU OE2 O N N 138 GLU OXT O N N 139 GLU H H N N 140 GLU H2 H N N 141 GLU HA H N N 142 GLU HB2 H N N 143 GLU HB3 H N N 144 GLU HG2 H N N 145 GLU HG3 H N N 146 GLU HE2 H N N 147 GLU HXT H N N 148 GLY N N N N 149 GLY CA C N N 150 GLY C C N N 151 GLY O O N N 152 GLY OXT O N N 153 GLY H H N N 154 GLY H2 H N N 155 GLY HA2 H N N 156 GLY HA3 H N N 157 GLY HXT H N N 158 HIS N N N N 159 HIS CA C N S 160 HIS C C N N 161 HIS O O N N 162 HIS CB C N N 163 HIS CG C Y N 164 HIS ND1 N Y N 165 HIS CD2 C Y N 166 HIS CE1 C Y N 167 HIS NE2 N Y N 168 HIS OXT O N N 169 HIS H H N N 170 HIS H2 H N N 171 HIS HA H N N 172 HIS HB2 H N N 173 HIS HB3 H N N 174 HIS HD1 H N N 175 HIS HD2 H N N 176 HIS HE1 H N N 177 HIS HE2 H N N 178 HIS HXT H N N 179 HOH O O N N 180 HOH H1 H N N 181 HOH H2 H N N 182 ILE N N N N 183 ILE CA C N S 184 ILE C C N N 185 ILE O O N N 186 ILE CB C N S 187 ILE CG1 C N N 188 ILE CG2 C N N 189 ILE CD1 C N N 190 ILE OXT O N N 191 ILE H H N N 192 ILE H2 H N N 193 ILE HA H N N 194 ILE HB H N N 195 ILE HG12 H N N 196 ILE HG13 H N N 197 ILE HG21 H N N 198 ILE HG22 H N N 199 ILE HG23 H N N 200 ILE HD11 H N N 201 ILE HD12 H N N 202 ILE HD13 H N N 203 ILE HXT H N N 204 LEU N N N N 205 LEU CA C N S 206 LEU C C N N 207 LEU O O N N 208 LEU CB C N N 209 LEU CG C N N 210 LEU CD1 C N N 211 LEU CD2 C N N 212 LEU OXT O N N 213 LEU H H N N 214 LEU H2 H N N 215 LEU HA H N N 216 LEU HB2 H N N 217 LEU HB3 H N N 218 LEU HG H N N 219 LEU HD11 H N N 220 LEU HD12 H N N 221 LEU HD13 H N N 222 LEU HD21 H N N 223 LEU HD22 H N N 224 LEU HD23 H N N 225 LEU HXT H N N 226 LYS N N N N 227 LYS CA C N S 228 LYS C C N N 229 LYS O O N N 230 LYS CB C N N 231 LYS CG C N N 232 LYS CD C N N 233 LYS CE C N N 234 LYS NZ N N N 235 LYS OXT O N N 236 LYS H H N N 237 LYS H2 H N N 238 LYS HA H N N 239 LYS HB2 H N N 240 LYS HB3 H N N 241 LYS HG2 H N N 242 LYS HG3 H N N 243 LYS HD2 H N N 244 LYS HD3 H N N 245 LYS HE2 H N N 246 LYS HE3 H N N 247 LYS HZ1 H N N 248 LYS HZ2 H N N 249 LYS HZ3 H N N 250 LYS HXT H N N 251 MET N N N N 252 MET CA C N S 253 MET C C N N 254 MET O O N N 255 MET CB C N N 256 MET CG C N N 257 MET SD S N N 258 MET CE C N N 259 MET OXT O N N 260 MET H H N N 261 MET H2 H N N 262 MET HA H N N 263 MET HB2 H N N 264 MET HB3 H N N 265 MET HG2 H N N 266 MET HG3 H N N 267 MET HE1 H N N 268 MET HE2 H N N 269 MET HE3 H N N 270 MET HXT H N N 271 NA NA NA N N 272 PHE N N N N 273 PHE CA C N S 274 PHE C C N N 275 PHE O O N N 276 PHE CB C N N 277 PHE CG C Y N 278 PHE CD1 C Y N 279 PHE CD2 C Y N 280 PHE CE1 C Y N 281 PHE CE2 C Y N 282 PHE CZ C Y N 283 PHE OXT O N N 284 PHE H H N N 285 PHE H2 H N N 286 PHE HA H N N 287 PHE HB2 H N N 288 PHE HB3 H N N 289 PHE HD1 H N N 290 PHE HD2 H N N 291 PHE HE1 H N N 292 PHE HE2 H N N 293 PHE HZ H N N 294 PHE HXT H N N 295 PRO N N N N 296 PRO CA C N S 297 PRO C C N N 298 PRO O O N N 299 PRO CB C N N 300 PRO CG C N N 301 PRO CD C N N 302 PRO OXT O N N 303 PRO H H N N 304 PRO HA H N N 305 PRO HB2 H N N 306 PRO HB3 H N N 307 PRO HG2 H N N 308 PRO HG3 H N N 309 PRO HD2 H N N 310 PRO HD3 H N N 311 PRO HXT H N N 312 SER N N N N 313 SER CA C N S 314 SER C C N N 315 SER O O N N 316 SER CB C N N 317 SER OG O N N 318 SER OXT O N N 319 SER H H N N 320 SER H2 H N N 321 SER HA H N N 322 SER HB2 H N N 323 SER HB3 H N N 324 SER HG H N N 325 SER HXT H N N 326 THR N N N N 327 THR CA C N S 328 THR C C N N 329 THR O O N N 330 THR CB C N R 331 THR OG1 O N N 332 THR CG2 C N N 333 THR OXT O N N 334 THR H H N N 335 THR H2 H N N 336 THR HA H N N 337 THR HB H N N 338 THR HG1 H N N 339 THR HG21 H N N 340 THR HG22 H N N 341 THR HG23 H N N 342 THR HXT H N N 343 TRP N N N N 344 TRP CA C N S 345 TRP C C N N 346 TRP O O N N 347 TRP CB C N N 348 TRP CG C Y N 349 TRP CD1 C Y N 350 TRP CD2 C Y N 351 TRP NE1 N Y N 352 TRP CE2 C Y N 353 TRP CE3 C Y N 354 TRP CZ2 C Y N 355 TRP CZ3 C Y N 356 TRP CH2 C Y N 357 TRP OXT O N N 358 TRP H H N N 359 TRP H2 H N N 360 TRP HA H N N 361 TRP HB2 H N N 362 TRP HB3 H N N 363 TRP HD1 H N N 364 TRP HE1 H N N 365 TRP HE3 H N N 366 TRP HZ2 H N N 367 TRP HZ3 H N N 368 TRP HH2 H N N 369 TRP HXT H N N 370 TYR N N N N 371 TYR CA C N S 372 TYR C C N N 373 TYR O O N N 374 TYR CB C N N 375 TYR CG C Y N 376 TYR CD1 C Y N 377 TYR CD2 C Y N 378 TYR CE1 C Y N 379 TYR CE2 C Y N 380 TYR CZ C Y N 381 TYR OH O N N 382 TYR OXT O N N 383 TYR H H N N 384 TYR H2 H N N 385 TYR HA H N N 386 TYR HB2 H N N 387 TYR HB3 H N N 388 TYR HD1 H N N 389 TYR HD2 H N N 390 TYR HE1 H N N 391 TYR HE2 H N N 392 TYR HH H N N 393 TYR HXT H N N 394 VAL N N N N 395 VAL CA C N S 396 VAL C C N N 397 VAL O O N N 398 VAL CB C N N 399 VAL CG1 C N N 400 VAL CG2 C N N 401 VAL OXT O N N 402 VAL H H N N 403 VAL H2 H N N 404 VAL HA H N N 405 VAL HB H N N 406 VAL HG11 H N N 407 VAL HG12 H N N 408 VAL HG13 H N N 409 VAL HG21 H N N 410 VAL HG22 H N N 411 VAL HG23 H N N 412 VAL HXT H N N 413 ZN ZN ZN N N 414 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 BYD OAN NAL sing N N 70 BYD NAL CAK sing N N 71 BYD OAM CAK doub N N 72 BYD CAK CAC sing N N 73 BYD CAD CAC doub Y N 74 BYD CAD CAE sing Y N 75 BYD CAC CAB sing Y N 76 BYD CAE CAF doub Y N 77 BYD CAB CAA doub Y N 78 BYD CAF CAA sing Y N 79 BYD CAF CAG sing N N 80 BYD OAH CAG doub N N 81 BYD CAG NAI sing N N 82 BYD NAI OAJ sing N N 83 BYD CAA HAA sing N N 84 BYD CAB HAB sing N N 85 BYD CAD HAD sing N N 86 BYD CAE HAE sing N N 87 BYD NAI HAI sing N N 88 BYD NAL HAL sing N N 89 BYD OAJ HAJ sing N N 90 BYD OAN HAN sing N N 91 CYS N CA sing N N 92 CYS N H sing N N 93 CYS N H2 sing N N 94 CYS CA C sing N N 95 CYS CA CB sing N N 96 CYS CA HA sing N N 97 CYS C O doub N N 98 CYS C OXT sing N N 99 CYS CB SG sing N N 100 CYS CB HB2 sing N N 101 CYS CB HB3 sing N N 102 CYS SG HG sing N N 103 CYS OXT HXT sing N N 104 GLN N CA sing N N 105 GLN N H sing N N 106 GLN N H2 sing N N 107 GLN CA C sing N N 108 GLN CA CB sing N N 109 GLN CA HA sing N N 110 GLN C O doub N N 111 GLN C OXT sing N N 112 GLN CB CG sing N N 113 GLN CB HB2 sing N N 114 GLN CB HB3 sing N N 115 GLN CG CD sing N N 116 GLN CG HG2 sing N N 117 GLN CG HG3 sing N N 118 GLN CD OE1 doub N N 119 GLN CD NE2 sing N N 120 GLN NE2 HE21 sing N N 121 GLN NE2 HE22 sing N N 122 GLN OXT HXT sing N N 123 GLU N CA sing N N 124 GLU N H sing N N 125 GLU N H2 sing N N 126 GLU CA C sing N N 127 GLU CA CB sing N N 128 GLU CA HA sing N N 129 GLU C O doub N N 130 GLU C OXT sing N N 131 GLU CB CG sing N N 132 GLU CB HB2 sing N N 133 GLU CB HB3 sing N N 134 GLU CG CD sing N N 135 GLU CG HG2 sing N N 136 GLU CG HG3 sing N N 137 GLU CD OE1 doub N N 138 GLU CD OE2 sing N N 139 GLU OE2 HE2 sing N N 140 GLU OXT HXT sing N N 141 GLY N CA sing N N 142 GLY N H sing N N 143 GLY N H2 sing N N 144 GLY CA C sing N N 145 GLY CA HA2 sing N N 146 GLY CA HA3 sing N N 147 GLY C O doub N N 148 GLY C OXT sing N N 149 GLY OXT HXT sing N N 150 HIS N CA sing N N 151 HIS N H sing N N 152 HIS N H2 sing N N 153 HIS CA C sing N N 154 HIS CA CB sing N N 155 HIS CA HA sing N N 156 HIS C O doub N N 157 HIS C OXT sing N N 158 HIS CB CG sing N N 159 HIS CB HB2 sing N N 160 HIS CB HB3 sing N N 161 HIS CG ND1 sing Y N 162 HIS CG CD2 doub Y N 163 HIS ND1 CE1 doub Y N 164 HIS ND1 HD1 sing N N 165 HIS CD2 NE2 sing Y N 166 HIS CD2 HD2 sing N N 167 HIS CE1 NE2 sing Y N 168 HIS CE1 HE1 sing N N 169 HIS NE2 HE2 sing N N 170 HIS OXT HXT sing N N 171 HOH O H1 sing N N 172 HOH O H2 sing N N 173 ILE N CA sing N N 174 ILE N H sing N N 175 ILE N H2 sing N N 176 ILE CA C sing N N 177 ILE CA CB sing N N 178 ILE CA HA sing N N 179 ILE C O doub N N 180 ILE C OXT sing N N 181 ILE CB CG1 sing N N 182 ILE CB CG2 sing N N 183 ILE CB HB sing N N 184 ILE CG1 CD1 sing N N 185 ILE CG1 HG12 sing N N 186 ILE CG1 HG13 sing N N 187 ILE CG2 HG21 sing N N 188 ILE CG2 HG22 sing N N 189 ILE CG2 HG23 sing N N 190 ILE CD1 HD11 sing N N 191 ILE CD1 HD12 sing N N 192 ILE CD1 HD13 sing N N 193 ILE OXT HXT sing N N 194 LEU N CA sing N N 195 LEU N H sing N N 196 LEU N H2 sing N N 197 LEU CA C sing N N 198 LEU CA CB sing N N 199 LEU CA HA sing N N 200 LEU C O doub N N 201 LEU C OXT sing N N 202 LEU CB CG sing N N 203 LEU CB HB2 sing N N 204 LEU CB HB3 sing N N 205 LEU CG CD1 sing N N 206 LEU CG CD2 sing N N 207 LEU CG HG sing N N 208 LEU CD1 HD11 sing N N 209 LEU CD1 HD12 sing N N 210 LEU CD1 HD13 sing N N 211 LEU CD2 HD21 sing N N 212 LEU CD2 HD22 sing N N 213 LEU CD2 HD23 sing N N 214 LEU OXT HXT sing N N 215 LYS N CA sing N N 216 LYS N H sing N N 217 LYS N H2 sing N N 218 LYS CA C sing N N 219 LYS CA CB sing N N 220 LYS CA HA sing N N 221 LYS C O doub N N 222 LYS C OXT sing N N 223 LYS CB CG sing N N 224 LYS CB HB2 sing N N 225 LYS CB HB3 sing N N 226 LYS CG CD sing N N 227 LYS CG HG2 sing N N 228 LYS CG HG3 sing N N 229 LYS CD CE sing N N 230 LYS CD HD2 sing N N 231 LYS CD HD3 sing N N 232 LYS CE NZ sing N N 233 LYS CE HE2 sing N N 234 LYS CE HE3 sing N N 235 LYS NZ HZ1 sing N N 236 LYS NZ HZ2 sing N N 237 LYS NZ HZ3 sing N N 238 LYS OXT HXT sing N N 239 MET N CA sing N N 240 MET N H sing N N 241 MET N H2 sing N N 242 MET CA C sing N N 243 MET CA CB sing N N 244 MET CA HA sing N N 245 MET C O doub N N 246 MET C OXT sing N N 247 MET CB CG sing N N 248 MET CB HB2 sing N N 249 MET CB HB3 sing N N 250 MET CG SD sing N N 251 MET CG HG2 sing N N 252 MET CG HG3 sing N N 253 MET SD CE sing N N 254 MET CE HE1 sing N N 255 MET CE HE2 sing N N 256 MET CE HE3 sing N N 257 MET OXT HXT sing N N 258 PHE N CA sing N N 259 PHE N H sing N N 260 PHE N H2 sing N N 261 PHE CA C sing N N 262 PHE CA CB sing N N 263 PHE CA HA sing N N 264 PHE C O doub N N 265 PHE C OXT sing N N 266 PHE CB CG sing N N 267 PHE CB HB2 sing N N 268 PHE CB HB3 sing N N 269 PHE CG CD1 doub Y N 270 PHE CG CD2 sing Y N 271 PHE CD1 CE1 sing Y N 272 PHE CD1 HD1 sing N N 273 PHE CD2 CE2 doub Y N 274 PHE CD2 HD2 sing N N 275 PHE CE1 CZ doub Y N 276 PHE CE1 HE1 sing N N 277 PHE CE2 CZ sing Y N 278 PHE CE2 HE2 sing N N 279 PHE CZ HZ sing N N 280 PHE OXT HXT sing N N 281 PRO N CA sing N N 282 PRO N CD sing N N 283 PRO N H sing N N 284 PRO CA C sing N N 285 PRO CA CB sing N N 286 PRO CA HA sing N N 287 PRO C O doub N N 288 PRO C OXT sing N N 289 PRO CB CG sing N N 290 PRO CB HB2 sing N N 291 PRO CB HB3 sing N N 292 PRO CG CD sing N N 293 PRO CG HG2 sing N N 294 PRO CG HG3 sing N N 295 PRO CD HD2 sing N N 296 PRO CD HD3 sing N N 297 PRO OXT HXT sing N N 298 SER N CA sing N N 299 SER N H sing N N 300 SER N H2 sing N N 301 SER CA C sing N N 302 SER CA CB sing N N 303 SER CA HA sing N N 304 SER C O doub N N 305 SER C OXT sing N N 306 SER CB OG sing N N 307 SER CB HB2 sing N N 308 SER CB HB3 sing N N 309 SER OG HG sing N N 310 SER OXT HXT sing N N 311 THR N CA sing N N 312 THR N H sing N N 313 THR N H2 sing N N 314 THR CA C sing N N 315 THR CA CB sing N N 316 THR CA HA sing N N 317 THR C O doub N N 318 THR C OXT sing N N 319 THR CB OG1 sing N N 320 THR CB CG2 sing N N 321 THR CB HB sing N N 322 THR OG1 HG1 sing N N 323 THR CG2 HG21 sing N N 324 THR CG2 HG22 sing N N 325 THR CG2 HG23 sing N N 326 THR OXT HXT sing N N 327 TRP N CA sing N N 328 TRP N H sing N N 329 TRP N H2 sing N N 330 TRP CA C sing N N 331 TRP CA CB sing N N 332 TRP CA HA sing N N 333 TRP C O doub N N 334 TRP C OXT sing N N 335 TRP CB CG sing N N 336 TRP CB HB2 sing N N 337 TRP CB HB3 sing N N 338 TRP CG CD1 doub Y N 339 TRP CG CD2 sing Y N 340 TRP CD1 NE1 sing Y N 341 TRP CD1 HD1 sing N N 342 TRP CD2 CE2 doub Y N 343 TRP CD2 CE3 sing Y N 344 TRP NE1 CE2 sing Y N 345 TRP NE1 HE1 sing N N 346 TRP CE2 CZ2 sing Y N 347 TRP CE3 CZ3 doub Y N 348 TRP CE3 HE3 sing N N 349 TRP CZ2 CH2 doub Y N 350 TRP CZ2 HZ2 sing N N 351 TRP CZ3 CH2 sing Y N 352 TRP CZ3 HZ3 sing N N 353 TRP CH2 HH2 sing N N 354 TRP OXT HXT sing N N 355 TYR N CA sing N N 356 TYR N H sing N N 357 TYR N H2 sing N N 358 TYR CA C sing N N 359 TYR CA CB sing N N 360 TYR CA HA sing N N 361 TYR C O doub N N 362 TYR C OXT sing N N 363 TYR CB CG sing N N 364 TYR CB HB2 sing N N 365 TYR CB HB3 sing N N 366 TYR CG CD1 doub Y N 367 TYR CG CD2 sing Y N 368 TYR CD1 CE1 sing Y N 369 TYR CD1 HD1 sing N N 370 TYR CD2 CE2 doub Y N 371 TYR CD2 HD2 sing N N 372 TYR CE1 CZ doub Y N 373 TYR CE1 HE1 sing N N 374 TYR CE2 CZ sing Y N 375 TYR CE2 HE2 sing N N 376 TYR CZ OH sing N N 377 TYR OH HH sing N N 378 TYR OXT HXT sing N N 379 VAL N CA sing N N 380 VAL N H sing N N 381 VAL N H2 sing N N 382 VAL CA C sing N N 383 VAL CA CB sing N N 384 VAL CA HA sing N N 385 VAL C O doub N N 386 VAL C OXT sing N N 387 VAL CB CG1 sing N N 388 VAL CB CG2 sing N N 389 VAL CB HB sing N N 390 VAL CG1 HG11 sing N N 391 VAL CG1 HG12 sing N N 392 VAL CG1 HG13 sing N N 393 VAL CG2 HG21 sing N N 394 VAL CG2 HG22 sing N N 395 VAL CG2 HG23 sing N N 396 VAL OXT HXT sing N N 397 # _atom_sites.entry_id 5UP8 _atom_sites.fract_transf_matrix[1][1] 0.006418 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.006418 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006418 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N NA O S ZN # loop_