data_5VB0 # _entry.id 5VB0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5VB0 pdb_00005vb0 10.2210/pdb5vb0/pdb WWPDB D_1000227136 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5VB0 _pdbx_database_status.recvd_initial_deposition_date 2017-03-28 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Klontz, E.' 1 ? 'Guenther, S.' 2 ? 'Silverstein, Z.' 3 ? 'Sundberg, E.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Antimicrob. Agents Chemother.' _citation.journal_id_ASTM AMACCQ _citation.journal_id_CSD 0788 _citation.journal_id_ISSN 1098-6596 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 61 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structure and Dynamics of FosA-Mediated Fosfomycin Resistance in Klebsiella pneumoniae and Escherichia coli.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1128/AAC.01572-17 _citation.pdbx_database_id_PubMed 28874374 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Klontz, E.H.' 1 ? primary 'Tomich, A.D.' 2 ? primary 'Gunther, S.' 3 ? primary 'Lemkul, J.A.' 4 ? primary 'Deredge, D.' 5 ? primary 'Silverstein, Z.' 6 ? primary 'Shaw, J.F.' 7 ? primary 'McElheny, C.' 8 ? primary 'Doi, Y.' 9 ? primary 'Wintrode, P.L.' 10 ? primary 'MacKerell, A.D.' 11 ? primary 'Sluis-Cremer, N.' 12 ? primary 'Sundberg, E.J.' 13 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5VB0 _cell.details ? _cell.formula_units_Z ? _cell.length_a 87.608 _cell.length_a_esd ? _cell.length_b 87.608 _cell.length_b_esd ? _cell.length_c 357.038 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 64 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5VB0 _symmetry.cell_setting ? _symmetry.Int_Tables_number 91 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Fosfomycin resistance protein FosA3' 16246.203 8 ? ? ? ? 2 non-polymer man 'MANGANESE (II) ION' 54.938 8 ? ? ? ? 3 non-polymer man 'NICKEL (II) ION' 58.693 6 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Fosfomycin resistance protein,Fosfomycin resistance protein FosA,Fosfomycin resistance protein FosA3,FosA3,Glutathione transferase,Glutathione transferase FosA ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MLQGLNHLTLAVSDLASSLAFYQQLPGMRLHASWDSGAYLSCGALWLCLSLDEQRRKTPPQESDYTHYAFSVAEEEFAGV VALLAQAGAEVWKDNRSEGASYYFLDPDGHKLELHVGNLAQRLAACRERPYKGMVFFDHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MLQGLNHLTLAVSDLASSLAFYQQLPGMRLHASWDSGAYLSCGALWLCLSLDEQRRKTPPQESDYTHYAFSVAEEEFAGV VALLAQAGAEVWKDNRSEGASYYFLDPDGHKLELHVGNLAQRLAACRERPYKGMVFFDHHHHHH ; _entity_poly.pdbx_strand_id A,B,C,D,E,F,G,H _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LEU n 1 3 GLN n 1 4 GLY n 1 5 LEU n 1 6 ASN n 1 7 HIS n 1 8 LEU n 1 9 THR n 1 10 LEU n 1 11 ALA n 1 12 VAL n 1 13 SER n 1 14 ASP n 1 15 LEU n 1 16 ALA n 1 17 SER n 1 18 SER n 1 19 LEU n 1 20 ALA n 1 21 PHE n 1 22 TYR n 1 23 GLN n 1 24 GLN n 1 25 LEU n 1 26 PRO n 1 27 GLY n 1 28 MET n 1 29 ARG n 1 30 LEU n 1 31 HIS n 1 32 ALA n 1 33 SER n 1 34 TRP n 1 35 ASP n 1 36 SER n 1 37 GLY n 1 38 ALA n 1 39 TYR n 1 40 LEU n 1 41 SER n 1 42 CYS n 1 43 GLY n 1 44 ALA n 1 45 LEU n 1 46 TRP n 1 47 LEU n 1 48 CYS n 1 49 LEU n 1 50 SER n 1 51 LEU n 1 52 ASP n 1 53 GLU n 1 54 GLN n 1 55 ARG n 1 56 ARG n 1 57 LYS n 1 58 THR n 1 59 PRO n 1 60 PRO n 1 61 GLN n 1 62 GLU n 1 63 SER n 1 64 ASP n 1 65 TYR n 1 66 THR n 1 67 HIS n 1 68 TYR n 1 69 ALA n 1 70 PHE n 1 71 SER n 1 72 VAL n 1 73 ALA n 1 74 GLU n 1 75 GLU n 1 76 GLU n 1 77 PHE n 1 78 ALA n 1 79 GLY n 1 80 VAL n 1 81 VAL n 1 82 ALA n 1 83 LEU n 1 84 LEU n 1 85 ALA n 1 86 GLN n 1 87 ALA n 1 88 GLY n 1 89 ALA n 1 90 GLU n 1 91 VAL n 1 92 TRP n 1 93 LYS n 1 94 ASP n 1 95 ASN n 1 96 ARG n 1 97 SER n 1 98 GLU n 1 99 GLY n 1 100 ALA n 1 101 SER n 1 102 TYR n 1 103 TYR n 1 104 PHE n 1 105 LEU n 1 106 ASP n 1 107 PRO n 1 108 ASP n 1 109 GLY n 1 110 HIS n 1 111 LYS n 1 112 LEU n 1 113 GLU n 1 114 LEU n 1 115 HIS n 1 116 VAL n 1 117 GLY n 1 118 ASN n 1 119 LEU n 1 120 ALA n 1 121 GLN n 1 122 ARG n 1 123 LEU n 1 124 ALA n 1 125 ALA n 1 126 CYS n 1 127 ARG n 1 128 GLU n 1 129 ARG n 1 130 PRO n 1 131 TYR n 1 132 LYS n 1 133 GLY n 1 134 MET n 1 135 VAL n 1 136 PHE n 1 137 PHE n 1 138 ASP n 1 139 HIS n 1 140 HIS n 1 141 HIS n 1 142 HIS n 1 143 HIS n 1 144 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 144 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ;fosA3, BJJ90_27535, BJJ90_28665, BK248_24890, BK251_28530, BK259_26930, BK292_28610, BK334_27385, BK337_26185, BK373_27910, BK375_28485, BK383_28445, BK400_25020, pCTXM123_C0996_13, pEC012_00045, pHN7A8_014, pHNFP460_053 ; _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code D7UQM0_ECOLX _struct_ref.pdbx_db_accession D7UQM0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MLQGLNHLTLAVSDLASSLAFYQQLPGMRLHASWDSGAYLSCGALWLCLSLDEQRRKTPPQESDYTHYAFSVAEEEFAGV VALLAQAGAEVWKDNRSEGASYYFLDPDGHKLELHVGNLAQRLAACRERPYKGMVFFD ; _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5VB0 A 1 ? 138 ? D7UQM0 1 ? 138 ? 1 138 2 1 5VB0 B 1 ? 138 ? D7UQM0 1 ? 138 ? 1 138 3 1 5VB0 C 1 ? 138 ? D7UQM0 1 ? 138 ? 1 138 4 1 5VB0 D 1 ? 138 ? D7UQM0 1 ? 138 ? 1 138 5 1 5VB0 E 1 ? 138 ? D7UQM0 1 ? 138 ? 1 138 6 1 5VB0 F 1 ? 138 ? D7UQM0 1 ? 138 ? 1 138 7 1 5VB0 G 1 ? 138 ? D7UQM0 1 ? 138 ? 1 138 8 1 5VB0 H 1 ? 138 ? D7UQM0 1 ? 138 ? 1 138 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5VB0 HIS A 139 ? UNP D7UQM0 ? ? 'expression tag' 139 1 1 5VB0 HIS A 140 ? UNP D7UQM0 ? ? 'expression tag' 140 2 1 5VB0 HIS A 141 ? UNP D7UQM0 ? ? 'expression tag' 141 3 1 5VB0 HIS A 142 ? UNP D7UQM0 ? ? 'expression tag' 142 4 1 5VB0 HIS A 143 ? UNP D7UQM0 ? ? 'expression tag' 143 5 1 5VB0 HIS A 144 ? UNP D7UQM0 ? ? 'expression tag' 144 6 2 5VB0 HIS B 139 ? UNP D7UQM0 ? ? 'expression tag' 139 7 2 5VB0 HIS B 140 ? UNP D7UQM0 ? ? 'expression tag' 140 8 2 5VB0 HIS B 141 ? UNP D7UQM0 ? ? 'expression tag' 141 9 2 5VB0 HIS B 142 ? UNP D7UQM0 ? ? 'expression tag' 142 10 2 5VB0 HIS B 143 ? UNP D7UQM0 ? ? 'expression tag' 143 11 2 5VB0 HIS B 144 ? UNP D7UQM0 ? ? 'expression tag' 144 12 3 5VB0 HIS C 139 ? UNP D7UQM0 ? ? 'expression tag' 139 13 3 5VB0 HIS C 140 ? UNP D7UQM0 ? ? 'expression tag' 140 14 3 5VB0 HIS C 141 ? UNP D7UQM0 ? ? 'expression tag' 141 15 3 5VB0 HIS C 142 ? UNP D7UQM0 ? ? 'expression tag' 142 16 3 5VB0 HIS C 143 ? UNP D7UQM0 ? ? 'expression tag' 143 17 3 5VB0 HIS C 144 ? UNP D7UQM0 ? ? 'expression tag' 144 18 4 5VB0 HIS D 139 ? UNP D7UQM0 ? ? 'expression tag' 139 19 4 5VB0 HIS D 140 ? UNP D7UQM0 ? ? 'expression tag' 140 20 4 5VB0 HIS D 141 ? UNP D7UQM0 ? ? 'expression tag' 141 21 4 5VB0 HIS D 142 ? UNP D7UQM0 ? ? 'expression tag' 142 22 4 5VB0 HIS D 143 ? UNP D7UQM0 ? ? 'expression tag' 143 23 4 5VB0 HIS D 144 ? UNP D7UQM0 ? ? 'expression tag' 144 24 5 5VB0 HIS E 139 ? UNP D7UQM0 ? ? 'expression tag' 139 25 5 5VB0 HIS E 140 ? UNP D7UQM0 ? ? 'expression tag' 140 26 5 5VB0 HIS E 141 ? UNP D7UQM0 ? ? 'expression tag' 141 27 5 5VB0 HIS E 142 ? UNP D7UQM0 ? ? 'expression tag' 142 28 5 5VB0 HIS E 143 ? UNP D7UQM0 ? ? 'expression tag' 143 29 5 5VB0 HIS E 144 ? UNP D7UQM0 ? ? 'expression tag' 144 30 6 5VB0 HIS F 139 ? UNP D7UQM0 ? ? 'expression tag' 139 31 6 5VB0 HIS F 140 ? UNP D7UQM0 ? ? 'expression tag' 140 32 6 5VB0 HIS F 141 ? UNP D7UQM0 ? ? 'expression tag' 141 33 6 5VB0 HIS F 142 ? UNP D7UQM0 ? ? 'expression tag' 142 34 6 5VB0 HIS F 143 ? UNP D7UQM0 ? ? 'expression tag' 143 35 6 5VB0 HIS F 144 ? UNP D7UQM0 ? ? 'expression tag' 144 36 7 5VB0 HIS G 139 ? UNP D7UQM0 ? ? 'expression tag' 139 37 7 5VB0 HIS G 140 ? UNP D7UQM0 ? ? 'expression tag' 140 38 7 5VB0 HIS G 141 ? UNP D7UQM0 ? ? 'expression tag' 141 39 7 5VB0 HIS G 142 ? UNP D7UQM0 ? ? 'expression tag' 142 40 7 5VB0 HIS G 143 ? UNP D7UQM0 ? ? 'expression tag' 143 41 7 5VB0 HIS G 144 ? UNP D7UQM0 ? ? 'expression tag' 144 42 8 5VB0 HIS H 139 ? UNP D7UQM0 ? ? 'expression tag' 139 43 8 5VB0 HIS H 140 ? UNP D7UQM0 ? ? 'expression tag' 140 44 8 5VB0 HIS H 141 ? UNP D7UQM0 ? ? 'expression tag' 141 45 8 5VB0 HIS H 142 ? UNP D7UQM0 ? ? 'expression tag' 142 46 8 5VB0 HIS H 143 ? UNP D7UQM0 ? ? 'expression tag' 143 47 8 5VB0 HIS H 144 ? UNP D7UQM0 ? ? 'expression tag' 144 48 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MN non-polymer . 'MANGANESE (II) ION' ? 'Mn 2' 54.938 NI non-polymer . 'NICKEL (II) ION' ? 'Ni 2' 58.693 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5VB0 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.64 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 53.33 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.95 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;FosA3, protein was concentrated to 9mg/ml and combined with 6mM fosfomycin and 6mM MnCl2. The solution was centrifuged (13500 rpm for 5 minutes) and 250nL of the supernatant was combined with 250nL of mother liquor (7% ethylene glycol, 7% PEG6000, 0.1M HEPES pH 6.95) in sitting drops ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 S 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-07-17 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0332 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 23-ID-D' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0332 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 23-ID-D _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5VB0 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.68856 _reflns.d_resolution_low 29.7532 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 39913 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.400 _reflns.pdbx_Rmerge_I_obs 0.081 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 20.400 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.085 _reflns.pdbx_Rpim_I_all 0.028 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.690 2.800 ? ? ? ? ? ? ? 99.700 ? ? ? ? 0.647 ? ? ? ? ? ? ? ? 9.700 ? ? ? ? 0.683 0.218 ? 1 1 0.958 ? 9.690 29.750 ? ? ? ? ? ? ? 96.800 ? ? ? ? 0.030 ? ? ? ? ? ? ? ? 7.800 ? ? ? ? 0.032 0.011 ? 2 1 0.999 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 147.230 _refine.B_iso_mean 65.6076 _refine.B_iso_min 32.680 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5VB0 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.6890 _refine.ls_d_res_low 29.7530 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 39869 _refine.ls_number_reflns_R_free ? _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.8300 _refine.ls_percent_reflns_R_free 4.7900 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2071 _refine.ls_R_factor_R_free 0.2491 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2050 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5V3D _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 28.5000 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3500 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.6890 _refine_hist.d_res_low 29.7530 _refine_hist.pdbx_number_atoms_ligand 14 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 8600 _refine_hist.pdbx_number_residues_total 1091 _refine_hist.pdbx_B_iso_mean_ligand 70.37 _refine_hist.pdbx_number_atoms_protein 8586 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 ? 8823 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.973 ? 11972 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.054 ? 1257 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 1551 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 13.384 ? 5104 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.pdbx_ens_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_weight 1 'X-RAY DIFFRACTION' 1 1 TORSIONAL A 3693 7.918 ? ? ? ? ? ? ? 2 'X-RAY DIFFRACTION' 1 2 TORSIONAL B 3693 7.918 ? ? ? ? ? ? ? 3 'X-RAY DIFFRACTION' 1 3 TORSIONAL C 3693 7.918 ? ? ? ? ? ? ? 4 'X-RAY DIFFRACTION' 1 4 TORSIONAL E 3693 7.918 ? ? ? ? ? ? ? 5 'X-RAY DIFFRACTION' 1 5 TORSIONAL F 3693 7.918 ? ? ? ? ? ? ? 6 'X-RAY DIFFRACTION' 1 6 TORSIONAL G 3693 7.918 ? ? ? ? ? ? ? 7 'X-RAY DIFFRACTION' 1 7 TORSIONAL H 3693 7.918 ? ? ? ? ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.6886 2.7254 2917 . 134 2783 98.0000 . . . 0.3593 0.0000 0.3128 . . . . . . 25 . . . 'X-RAY DIFFRACTION' 2.7254 2.7643 2927 . 151 2776 100.0000 . . . 0.3600 0.0000 0.2869 . . . . . . 25 . . . 'X-RAY DIFFRACTION' 2.7643 2.8055 3008 . 148 2860 100.0000 . . . 0.3301 0.0000 0.2892 . . . . . . 25 . . . 'X-RAY DIFFRACTION' 2.8055 2.8493 2896 . 122 2774 100.0000 . . . 0.3621 0.0000 0.2887 . . . . . . 25 . . . 'X-RAY DIFFRACTION' 2.8493 2.8960 2950 . 140 2810 100.0000 . . . 0.3065 0.0000 0.2799 . . . . . . 25 . . . 'X-RAY DIFFRACTION' 2.8960 2.9459 2959 . 148 2811 100.0000 . . . 0.3659 0.0000 0.2715 . . . . . . 25 . . . 'X-RAY DIFFRACTION' 2.9459 2.9994 2912 . 158 2754 100.0000 . . . 0.2994 0.0000 0.2458 . . . . . . 25 . . . 'X-RAY DIFFRACTION' 2.9994 3.0570 2962 . 161 2801 100.0000 . . . 0.3167 0.0000 0.2480 . . . . . . 25 . . . 'X-RAY DIFFRACTION' 3.0570 3.1194 2966 . 141 2825 100.0000 . . . 0.3640 0.0000 0.2519 . . . . . . 25 . . . 'X-RAY DIFFRACTION' 3.1194 3.1871 2901 . 155 2746 100.0000 . . . 0.3091 0.0000 0.2399 . . . . . . 25 . . . 'X-RAY DIFFRACTION' 3.1871 3.2612 3021 . 141 2880 100.0000 . . . 0.2947 0.0000 0.2464 . . . . . . 25 . . . 'X-RAY DIFFRACTION' 3.2612 3.3426 2942 . 126 2816 100.0000 . . . 0.3589 0.0000 0.2524 . . . . . . 25 . . . 'X-RAY DIFFRACTION' 3.3426 3.4329 2918 . 146 2772 100.0000 . . . 0.2637 0.0000 0.2428 . . . . . . 25 . . . 'X-RAY DIFFRACTION' 3.4329 3.5337 2967 . 104 2863 100.0000 . . . 0.2685 0.0000 0.2291 . . . . . . 25 . . . 'X-RAY DIFFRACTION' 3.5337 3.6476 2979 . 148 2831 100.0000 . . . 0.2746 0.0000 0.2292 . . . . . . 25 . . . 'X-RAY DIFFRACTION' 3.6476 3.7777 2910 . 130 2780 100.0000 . . . 0.2838 0.0000 0.2040 . . . . . . 25 . . . 'X-RAY DIFFRACTION' 3.7777 3.9286 2935 . 118 2817 100.0000 . . . 0.2328 0.0000 0.2068 . . . . . . 25 . . . 'X-RAY DIFFRACTION' 3.9286 4.1070 2969 . 136 2833 100.0000 . . . 0.2302 0.0000 0.1839 . . . . . . 25 . . . 'X-RAY DIFFRACTION' 4.1070 4.3229 2937 . 110 2827 100.0000 . . . 0.2081 0.0000 0.1729 . . . . . . 25 . . . 'X-RAY DIFFRACTION' 4.3229 4.5929 2973 . 150 2823 100.0000 . . . 0.2155 0.0000 0.1592 . . . . . . 25 . . . 'X-RAY DIFFRACTION' 4.5929 4.9460 2940 . 132 2808 100.0000 . . . 0.1601 0.0000 0.1611 . . . . . . 25 . . . 'X-RAY DIFFRACTION' 4.9460 5.4410 2965 . 163 2802 100.0000 . . . 0.2150 0.0000 0.1721 . . . . . . 25 . . . 'X-RAY DIFFRACTION' 5.4410 6.2220 2945 . 174 2771 100.0000 . . . 0.2245 0.0000 0.1938 . . . . . . 25 . . . 'X-RAY DIFFRACTION' 6.2220 7.8155 2954 . 134 2820 100.0000 . . . 0.2573 0.0000 0.1986 . . . . . . 25 . . . 'X-RAY DIFFRACTION' 7.8155 29.7550 2941 . 162 2779 100.0000 . . . 0.1793 0.0000 0.1616 . . . . . . 25 . . . # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 ;(chain A and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 2 ;(chain B and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 3 ;(chain C and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 4 ;(chain E and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 5 ;(chain F and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 6 ;(chain G and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 7 ;(chain H and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 1 A MET 1 . A ALA 20 . A MET 1 A ALA 20 ? ;(chain A and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 1 2 A PHE 21 . A PHE 21 . A PHE 21 A PHE 21 ? ;(chain A and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 1 3 A MET 1 . A HIS 143 . A MET 1 A HIS 143 ? ;(chain A and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 1 4 A MET 1 . A HIS 143 . A MET 1 A HIS 143 ? ;(chain A and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 1 5 A MET 1 . A HIS 143 . A MET 1 A HIS 143 ? ;(chain A and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 1 6 A MET 1 . A HIS 143 . A MET 1 A HIS 143 ? ;(chain A and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 1 7 A MET 1 . A HIS 143 . A MET 1 A HIS 143 ? ;(chain A and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 1 8 A MET 1 . A HIS 143 . A MET 1 A HIS 143 ? ;(chain A and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 2 1 B MET 1 . B ALA 20 . B MET 1 B ALA 20 ? ;(chain B and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 2 2 B PHE 21 . B PHE 21 . B PHE 21 B PHE 21 ? ;(chain B and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 2 3 B MET 1 . B ASP 138 . B MET 1 B ASP 138 ? ;(chain B and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 2 4 B MET 1 . B ASP 138 . B MET 1 B ASP 138 ? ;(chain B and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 2 5 B MET 1 . B ASP 138 . B MET 1 B ASP 138 ? ;(chain B and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 2 6 B MET 1 . B ASP 138 . B MET 1 B ASP 138 ? ;(chain B and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 2 7 B MET 1 . B ASP 138 . B MET 1 B ASP 138 ? ;(chain B and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 2 8 B MET 1 . B ASP 138 . B MET 1 B ASP 138 ? ;(chain B and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 3 1 C MET 1 . C ALA 20 . C MET 1 C ALA 20 ? ;(chain C and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 3 2 C PHE 21 . C PHE 21 . C PHE 21 C PHE 21 ? ;(chain C and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 3 3 C MET 1 . C HIS 143 . C MET 1 C HIS 143 ? ;(chain C and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 3 4 C MET 1 . C HIS 143 . C MET 1 C HIS 143 ? ;(chain C and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 3 5 C MET 1 . C HIS 143 . C MET 1 C HIS 143 ? ;(chain C and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 3 6 C MET 1 . C HIS 143 . C MET 1 C HIS 143 ? ;(chain C and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 3 7 C MET 1 . C HIS 143 . C MET 1 C HIS 143 ? ;(chain C and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 3 8 C MET 1 . C HIS 143 . C MET 1 C HIS 143 ? ;(chain C and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 4 1 E MET 1 . E ALA 20 . E MET 1 E ALA 20 ? ;(chain E and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 4 2 E PHE 21 . E PHE 21 . E PHE 21 E PHE 21 ? ;(chain E and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 4 3 E MET 1 . E ASP 138 . E MET 1 E ASP 138 ? ;(chain E and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 4 4 E MET 1 . E ASP 138 . E MET 1 E ASP 138 ? ;(chain E and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 4 5 E MET 1 . E ASP 138 . E MET 1 E ASP 138 ? ;(chain E and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 4 6 E MET 1 . E ASP 138 . E MET 1 E ASP 138 ? ;(chain E and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 4 7 E MET 1 . E ASP 138 . E MET 1 E ASP 138 ? ;(chain E and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 4 8 E MET 1 . E ASP 138 . E MET 1 E ASP 138 ? ;(chain E and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 5 1 F MET 1 . F ALA 20 . F MET 1 F ALA 20 ? ;(chain F and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 5 2 F PHE 21 . F PHE 21 . F PHE 21 F PHE 21 ? ;(chain F and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 5 3 F MET 1 . F HIS 143 . F MET 1 F HIS 143 ? ;(chain F and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 5 4 F MET 1 . F HIS 143 . F MET 1 F HIS 143 ? ;(chain F and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 5 5 F MET 1 . F HIS 143 . F MET 1 F HIS 143 ? ;(chain F and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 5 6 F MET 1 . F HIS 143 . F MET 1 F HIS 143 ? ;(chain F and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 5 7 F MET 1 . F HIS 143 . F MET 1 F HIS 143 ? ;(chain F and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 5 8 F MET 1 . F HIS 143 . F MET 1 F HIS 143 ? ;(chain F and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 6 1 G MET 1 . G ALA 20 . G MET 1 G ALA 20 ? ;(chain G and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 6 2 G PHE 21 . G PHE 21 . G PHE 21 G PHE 21 ? ;(chain G and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 6 3 G MET 1 . G PHE 137 . G MET 1 G PHE 137 ? ;(chain G and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 6 4 G MET 1 . G PHE 137 . G MET 1 G PHE 137 ? ;(chain G and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 6 5 G MET 1 . G PHE 137 . G MET 1 G PHE 137 ? ;(chain G and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 6 6 G MET 1 . G PHE 137 . G MET 1 G PHE 137 ? ;(chain G and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 6 7 G MET 1 . G PHE 137 . G MET 1 G PHE 137 ? ;(chain G and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 6 8 G MET 1 . G PHE 137 . G MET 1 G PHE 137 ? ;(chain G and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 7 1 H MET 1 . H ALA 20 . H MET 1 H ALA 20 ? ;(chain H and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 7 2 H PHE 21 . H PHE 21 . H PHE 21 H PHE 21 ? ;(chain H and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 7 3 H MET 1 . H HIS 143 . H MET 1 H HIS 143 ? ;(chain H and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 7 4 H MET 1 . H HIS 143 . H MET 1 H HIS 143 ? ;(chain H and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 7 5 H MET 1 . H HIS 143 . H MET 1 H HIS 143 ? ;(chain H and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 7 6 H MET 1 . H HIS 143 . H MET 1 H HIS 143 ? ;(chain H and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 7 7 H MET 1 . H HIS 143 . H MET 1 H HIS 143 ? ;(chain H and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; 1 7 8 H MET 1 . H HIS 143 . H MET 1 H HIS 143 ? ;(chain H and (resseq 1:20 or (resid 21 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 22:28 or resseq 30:34 or resseq 36:52 or resseq 55 or resseq 58:61 or (resid 62 and (name N or name CA or name C or name O )) or resseq 63:94 or resseq 100:121 or resseq 123:126 or resseq 128 or resseq 130:131 or (resid 132 and (name N or name CA or name C or name O )) or resseq 133:135 or (resid 136 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 137)) ; # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 5VB0 _struct.title 'Crystal structure of fosfomycin resistance protein FosA3' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5VB0 _struct_keywords.text 'FosA, FosA3, fosfomycin, glutathione transferase, transferase' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 1 ? E N N 1 ? F N N 1 ? G N N 1 ? H N N 1 ? I N N 2 ? J N N 3 ? K N N 3 ? L N N 2 ? M N N 2 ? N N N 3 ? O N N 3 ? P N N 2 ? Q N N 2 ? R N N 2 ? S N N 3 ? T N N 2 ? U N N 2 ? V N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 14 ? GLN A 24 ? ASP A 14 GLN A 24 1 ? 11 HELX_P HELX_P2 AA2 PRO A 59 ? SER A 63 ? PRO A 59 SER A 63 5 ? 5 HELX_P HELX_P3 AA3 GLU A 76 ? GLY A 88 ? GLU A 76 GLY A 88 1 ? 13 HELX_P HELX_P4 AA4 ASN A 118 ? ARG A 129 ? ASN A 118 ARG A 129 1 ? 12 HELX_P HELX_P5 AA5 ASP B 14 ? GLN B 24 ? ASP B 14 GLN B 24 1 ? 11 HELX_P HELX_P6 AA6 PRO B 59 ? SER B 63 ? PRO B 59 SER B 63 5 ? 5 HELX_P HELX_P7 AA7 ALA B 73 ? GLY B 88 ? ALA B 73 GLY B 88 1 ? 16 HELX_P HELX_P8 AA8 ASN B 118 ? ARG B 129 ? ASN B 118 ARG B 129 1 ? 12 HELX_P HELX_P9 AA9 ASP C 14 ? GLN C 24 ? ASP C 14 GLN C 24 1 ? 11 HELX_P HELX_P10 AB1 PRO C 59 ? SER C 63 ? PRO C 59 SER C 63 5 ? 5 HELX_P HELX_P11 AB2 ALA C 73 ? ALA C 87 ? ALA C 73 ALA C 87 1 ? 15 HELX_P HELX_P12 AB3 ASN C 118 ? ARG C 129 ? ASN C 118 ARG C 129 1 ? 12 HELX_P HELX_P13 AB4 ASP D 14 ? GLN D 24 ? ASP D 14 GLN D 24 1 ? 11 HELX_P HELX_P14 AB5 PRO D 59 ? SER D 63 ? PRO D 59 SER D 63 5 ? 5 HELX_P HELX_P15 AB6 GLU D 76 ? GLY D 88 ? GLU D 76 GLY D 88 1 ? 13 HELX_P HELX_P16 AB7 ASN D 118 ? ARG D 129 ? ASN D 118 ARG D 129 1 ? 12 HELX_P HELX_P17 AB8 ASP E 14 ? GLN E 24 ? ASP E 14 GLN E 24 1 ? 11 HELX_P HELX_P18 AB9 PRO E 59 ? SER E 63 ? PRO E 59 SER E 63 5 ? 5 HELX_P HELX_P19 AC1 ALA E 73 ? GLY E 88 ? ALA E 73 GLY E 88 1 ? 16 HELX_P HELX_P20 AC2 ASN E 118 ? ARG E 129 ? ASN E 118 ARG E 129 1 ? 12 HELX_P HELX_P21 AC3 ASP F 14 ? GLN F 24 ? ASP F 14 GLN F 24 1 ? 11 HELX_P HELX_P22 AC4 PRO F 59 ? SER F 63 ? PRO F 59 SER F 63 5 ? 5 HELX_P HELX_P23 AC5 ALA F 73 ? GLY F 88 ? ALA F 73 GLY F 88 1 ? 16 HELX_P HELX_P24 AC6 ASN F 118 ? ARG F 129 ? ASN F 118 ARG F 129 1 ? 12 HELX_P HELX_P25 AC7 ASP G 14 ? GLN G 24 ? ASP G 14 GLN G 24 1 ? 11 HELX_P HELX_P26 AC8 PRO G 59 ? SER G 63 ? PRO G 59 SER G 63 5 ? 5 HELX_P HELX_P27 AC9 GLU G 76 ? GLY G 88 ? GLU G 76 GLY G 88 1 ? 13 HELX_P HELX_P28 AD1 ASN G 118 ? ARG G 129 ? ASN G 118 ARG G 129 1 ? 12 HELX_P HELX_P29 AD2 ASP H 14 ? GLN H 24 ? ASP H 14 GLN H 24 1 ? 11 HELX_P HELX_P30 AD3 PRO H 59 ? SER H 63 ? PRO H 59 SER H 63 5 ? 5 HELX_P HELX_P31 AD4 GLU H 76 ? ALA H 87 ? GLU H 76 ALA H 87 1 ? 12 HELX_P HELX_P32 AD5 ASN H 118 ? ARG H 129 ? ASN H 118 ARG H 129 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 7 NE2 ? ? ? 1_555 L MN . MN ? ? A HIS 7 B MN 201 1_555 ? ? ? ? ? ? ? 2.271 ? ? metalc2 metalc ? ? A HIS 67 NE2 ? ? ? 1_555 I MN . MN ? ? A HIS 67 A MN 201 1_555 ? ? ? ? ? ? ? 2.379 ? ? metalc3 metalc ? ? A GLU 113 OE1 ? ? ? 1_555 I MN . MN ? ? A GLU 113 A MN 201 1_555 ? ? ? ? ? ? ? 2.181 ? ? metalc4 metalc ? ? A GLU 128 OE1 ? ? ? 1_555 K NI . NI ? ? A GLU 128 A NI 203 1_555 ? ? ? ? ? ? ? 2.198 ? ? metalc5 metalc ? ? A HIS 139 NE2 ? ? ? 1_555 J NI . NI ? ? A HIS 139 A NI 202 1_555 ? ? ? ? ? ? ? 1.900 ? ? metalc6 metalc ? ? A HIS 141 NE2 ? ? ? 1_555 J NI . NI ? ? A HIS 141 A NI 202 1_555 ? ? ? ? ? ? ? 2.249 ? ? metalc7 metalc ? ? A HIS 142 NE2 ? ? ? 1_555 K NI . NI ? ? A HIS 142 A NI 203 1_555 ? ? ? ? ? ? ? 2.623 ? ? metalc8 metalc ? ? I MN . MN ? ? ? 1_555 B HIS 7 NE2 ? ? A MN 201 B HIS 7 1_555 ? ? ? ? ? ? ? 2.255 ? ? metalc9 metalc ? ? J NI . NI ? ? ? 1_555 F HIS 139 NE2 ? ? A NI 202 F HIS 139 1_555 ? ? ? ? ? ? ? 2.074 ? ? metalc10 metalc ? ? J NI . NI ? ? ? 1_555 F HIS 141 NE2 ? ? A NI 202 F HIS 141 1_555 ? ? ? ? ? ? ? 2.120 ? ? metalc11 metalc ? ? B HIS 67 NE2 ? ? ? 1_555 L MN . MN ? ? B HIS 67 B MN 201 1_555 ? ? ? ? ? ? ? 2.270 ? ? metalc12 metalc ? ? B GLU 113 OE1 ? ? ? 1_555 L MN . MN ? ? B GLU 113 B MN 201 1_555 ? ? ? ? ? ? ? 2.175 ? ? metalc13 metalc ? ? C HIS 7 NE2 ? ? ? 1_555 P MN . MN ? ? C HIS 7 D MN 201 1_555 ? ? ? ? ? ? ? 2.241 ? ? metalc14 metalc ? ? C HIS 67 NE2 ? ? ? 1_555 M MN . MN ? ? C HIS 67 C MN 201 1_555 ? ? ? ? ? ? ? 2.069 ? ? metalc15 metalc ? ? C GLU 113 OE1 ? ? ? 1_555 M MN . MN ? ? C GLU 113 C MN 201 1_555 ? ? ? ? ? ? ? 2.226 ? ? metalc16 metalc ? ? C GLU 128 OE1 ? ? ? 1_555 O NI . NI ? ? C GLU 128 C NI 203 1_555 ? ? ? ? ? ? ? 2.247 ? ? metalc17 metalc ? ? C HIS 139 NE2 ? ? ? 1_555 N NI . NI ? ? C HIS 139 C NI 202 1_555 ? ? ? ? ? ? ? 2.035 ? ? metalc18 metalc ? ? C HIS 141 NE2 ? ? ? 1_555 N NI . NI ? ? C HIS 141 C NI 202 1_555 ? ? ? ? ? ? ? 2.228 ? ? metalc19 metalc ? ? C HIS 142 NE2 ? ? ? 1_555 O NI . NI ? ? C HIS 142 C NI 203 1_555 ? ? ? ? ? ? ? 2.358 ? ? metalc20 metalc ? ? M MN . MN ? ? ? 1_555 D HIS 7 NE2 ? ? C MN 201 D HIS 7 1_555 ? ? ? ? ? ? ? 2.294 ? ? metalc21 metalc ? ? N NI . NI ? ? ? 1_555 H HIS 139 NE2 ? ? C NI 202 H HIS 139 1_555 ? ? ? ? ? ? ? 2.036 ? ? metalc22 metalc ? ? N NI . NI ? ? ? 1_555 H HIS 141 NE2 ? ? C NI 202 H HIS 141 1_555 ? ? ? ? ? ? ? 2.171 ? ? metalc23 metalc ? ? D HIS 67 NE2 ? ? ? 1_555 P MN . MN ? ? D HIS 67 D MN 201 1_555 ? ? ? ? ? ? ? 2.320 ? ? metalc24 metalc ? ? D GLU 113 OE1 ? ? ? 1_555 P MN . MN ? ? D GLU 113 D MN 201 1_555 ? ? ? ? ? ? ? 2.190 ? ? metalc25 metalc ? ? E HIS 7 NE2 ? ? ? 1_555 R MN . MN ? ? E HIS 7 F MN 201 1_555 ? ? ? ? ? ? ? 2.300 ? ? metalc26 metalc ? ? E HIS 67 NE2 ? ? ? 1_555 Q MN . MN ? ? E HIS 67 E MN 201 1_555 ? ? ? ? ? ? ? 2.227 ? ? metalc27 metalc ? ? E GLU 113 OE1 ? ? ? 1_555 Q MN . MN ? ? E GLU 113 E MN 201 1_555 ? ? ? ? ? ? ? 2.329 ? ? metalc28 metalc ? ? Q MN . MN ? ? ? 1_555 F HIS 7 NE2 ? ? E MN 201 F HIS 7 1_555 ? ? ? ? ? ? ? 2.332 ? ? metalc29 metalc ? ? F HIS 67 NE2 ? ? ? 1_555 R MN . MN ? ? F HIS 67 F MN 201 1_555 ? ? ? ? ? ? ? 2.242 ? ? metalc30 metalc ? ? F GLU 113 OE1 ? ? ? 1_555 R MN . MN ? ? F GLU 113 F MN 201 1_555 ? ? ? ? ? ? ? 2.111 ? ? metalc31 metalc ? ? F GLU 128 OE1 ? ? ? 1_555 S NI . NI ? ? F GLU 128 F NI 202 1_555 ? ? ? ? ? ? ? 2.407 ? ? metalc32 metalc ? ? F HIS 142 NE2 ? ? ? 1_555 S NI . NI ? ? F HIS 142 F NI 202 1_555 ? ? ? ? ? ? ? 2.628 ? ? metalc33 metalc ? ? G HIS 7 NE2 ? ? ? 1_555 U MN . MN ? ? G HIS 7 H MN 201 1_555 ? ? ? ? ? ? ? 2.392 ? ? metalc34 metalc ? ? G HIS 67 NE2 ? ? ? 1_555 T MN . MN ? ? G HIS 67 G MN 201 1_555 ? ? ? ? ? ? ? 2.237 ? ? metalc35 metalc ? ? G GLU 113 OE1 ? ? ? 1_555 T MN . MN ? ? G GLU 113 G MN 201 1_555 ? ? ? ? ? ? ? 2.123 ? ? metalc36 metalc ? ? T MN . MN ? ? ? 1_555 H HIS 7 NE2 ? ? G MN 201 H HIS 7 1_555 ? ? ? ? ? ? ? 2.297 ? ? metalc37 metalc ? ? H HIS 67 NE2 ? ? ? 1_555 U MN . MN ? ? H HIS 67 H MN 201 1_555 ? ? ? ? ? ? ? 2.174 ? ? metalc38 metalc ? ? H GLU 113 OE1 ? ? ? 1_555 U MN . MN ? ? H GLU 113 H MN 201 1_555 ? ? ? ? ? ? ? 2.062 ? ? metalc39 metalc ? ? H GLU 128 OE1 ? ? ? 1_555 V NI . NI ? ? H GLU 128 H NI 202 1_555 ? ? ? ? ? ? ? 2.479 ? ? metalc40 metalc ? ? H HIS 142 NE2 ? ? ? 1_555 V NI . NI ? ? H HIS 142 H NI 202 1_555 ? ? ? ? ? ? ? 2.496 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 9 ? AA2 ? 9 ? AA3 ? 8 ? AA4 ? 8 ? AA5 ? 9 ? AA6 ? 9 ? AA7 ? 9 ? AA8 ? 9 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? anti-parallel AA1 5 6 ? parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? parallel AA2 4 5 ? anti-parallel AA2 5 6 ? parallel AA2 6 7 ? anti-parallel AA2 7 8 ? anti-parallel AA2 8 9 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? parallel AA3 3 4 ? anti-parallel AA3 4 5 ? parallel AA3 5 6 ? anti-parallel AA3 6 7 ? anti-parallel AA3 7 8 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? parallel AA4 3 4 ? anti-parallel AA4 4 5 ? parallel AA4 5 6 ? anti-parallel AA4 6 7 ? anti-parallel AA4 7 8 ? anti-parallel AA5 1 2 ? anti-parallel AA5 2 3 ? anti-parallel AA5 3 4 ? parallel AA5 4 5 ? anti-parallel AA5 5 6 ? parallel AA5 6 7 ? anti-parallel AA5 7 8 ? anti-parallel AA5 8 9 ? anti-parallel AA6 1 2 ? anti-parallel AA6 2 3 ? anti-parallel AA6 3 4 ? parallel AA6 4 5 ? anti-parallel AA6 5 6 ? parallel AA6 6 7 ? anti-parallel AA6 7 8 ? anti-parallel AA6 8 9 ? anti-parallel AA7 1 2 ? anti-parallel AA7 2 3 ? anti-parallel AA7 3 4 ? parallel AA7 4 5 ? anti-parallel AA7 5 6 ? parallel AA7 6 7 ? anti-parallel AA7 7 8 ? anti-parallel AA7 8 9 ? anti-parallel AA8 1 2 ? anti-parallel AA8 2 3 ? anti-parallel AA8 3 4 ? parallel AA8 4 5 ? anti-parallel AA8 5 6 ? parallel AA8 6 7 ? anti-parallel AA8 7 8 ? anti-parallel AA8 8 9 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL B 91 ? LYS B 93 ? VAL B 91 LYS B 93 AA1 2 SER B 101 ? LEU B 105 ? SER B 101 LEU B 105 AA1 3 LYS B 111 ? HIS B 115 ? LYS B 111 HIS B 115 AA1 4 HIS B 67 ? VAL B 72 ? HIS B 67 VAL B 72 AA1 5 LEU A 2 ? VAL A 12 ? LEU A 2 VAL A 12 AA1 6 LEU A 45 ? LEU A 51 ? LEU A 45 LEU A 51 AA1 7 GLY A 37 ? CYS A 42 ? GLY A 37 CYS A 42 AA1 8 ARG A 29 ? TRP A 34 ? ARG A 29 TRP A 34 AA1 9 VAL B 135 ? PHE B 136 ? VAL B 135 PHE B 136 AA2 1 VAL A 91 ? LYS A 93 ? VAL A 91 LYS A 93 AA2 2 SER A 101 ? LEU A 105 ? SER A 101 LEU A 105 AA2 3 LYS A 111 ? HIS A 115 ? LYS A 111 HIS A 115 AA2 4 HIS A 67 ? VAL A 72 ? HIS A 67 VAL A 72 AA2 5 LEU B 2 ? VAL B 12 ? LEU B 2 VAL B 12 AA2 6 LEU B 45 ? LEU B 51 ? LEU B 45 LEU B 51 AA2 7 GLY B 37 ? CYS B 42 ? GLY B 37 CYS B 42 AA2 8 MET B 28 ? SER B 33 ? MET B 28 SER B 33 AA2 9 VAL A 135 ? PHE A 136 ? VAL A 135 PHE A 136 AA3 1 SER D 101 ? LEU D 105 ? SER D 101 LEU D 105 AA3 2 LYS D 111 ? HIS D 115 ? LYS D 111 HIS D 115 AA3 3 HIS D 67 ? VAL D 72 ? HIS D 67 VAL D 72 AA3 4 LEU C 2 ? VAL C 12 ? LEU C 2 VAL C 12 AA3 5 LEU C 45 ? LEU C 51 ? LEU C 45 LEU C 51 AA3 6 GLY C 37 ? CYS C 42 ? GLY C 37 CYS C 42 AA3 7 ARG C 29 ? TRP C 34 ? ARG C 29 TRP C 34 AA3 8 VAL D 135 ? PHE D 136 ? VAL D 135 PHE D 136 AA4 1 SER C 101 ? LEU C 105 ? SER C 101 LEU C 105 AA4 2 LYS C 111 ? HIS C 115 ? LYS C 111 HIS C 115 AA4 3 HIS C 67 ? VAL C 72 ? HIS C 67 VAL C 72 AA4 4 LEU D 2 ? VAL D 12 ? LEU D 2 VAL D 12 AA4 5 LEU D 45 ? LEU D 51 ? LEU D 45 LEU D 51 AA4 6 GLY D 37 ? CYS D 42 ? GLY D 37 CYS D 42 AA4 7 MET D 28 ? TRP D 34 ? MET D 28 TRP D 34 AA4 8 VAL C 135 ? PHE C 136 ? VAL C 135 PHE C 136 AA5 1 VAL F 91 ? LYS F 93 ? VAL F 91 LYS F 93 AA5 2 SER F 101 ? LEU F 105 ? SER F 101 LEU F 105 AA5 3 LYS F 111 ? HIS F 115 ? LYS F 111 HIS F 115 AA5 4 HIS F 67 ? SER F 71 ? HIS F 67 SER F 71 AA5 5 LEU E 5 ? VAL E 12 ? LEU E 5 VAL E 12 AA5 6 LEU E 45 ? LEU E 51 ? LEU E 45 LEU E 51 AA5 7 GLY E 37 ? CYS E 42 ? GLY E 37 CYS E 42 AA5 8 MET E 28 ? TRP E 34 ? MET E 28 TRP E 34 AA5 9 VAL F 135 ? PHE F 136 ? VAL F 135 PHE F 136 AA6 1 VAL E 91 ? LYS E 93 ? VAL E 91 LYS E 93 AA6 2 SER E 101 ? LEU E 105 ? SER E 101 LEU E 105 AA6 3 LYS E 111 ? HIS E 115 ? LYS E 111 HIS E 115 AA6 4 HIS E 67 ? VAL E 72 ? HIS E 67 VAL E 72 AA6 5 LEU F 2 ? VAL F 12 ? LEU F 2 VAL F 12 AA6 6 LEU F 45 ? LEU F 51 ? LEU F 45 LEU F 51 AA6 7 GLY F 37 ? CYS F 42 ? GLY F 37 CYS F 42 AA6 8 ARG F 29 ? TRP F 34 ? ARG F 29 TRP F 34 AA6 9 VAL E 135 ? PHE E 136 ? VAL E 135 PHE E 136 AA7 1 VAL H 91 ? LYS H 93 ? VAL H 91 LYS H 93 AA7 2 SER H 101 ? LEU H 105 ? SER H 101 LEU H 105 AA7 3 LYS H 111 ? HIS H 115 ? LYS H 111 HIS H 115 AA7 4 HIS H 67 ? VAL H 72 ? HIS H 67 VAL H 72 AA7 5 LEU G 2 ? VAL G 12 ? LEU G 2 VAL G 12 AA7 6 LEU G 45 ? LEU G 51 ? LEU G 45 LEU G 51 AA7 7 GLY G 37 ? CYS G 42 ? GLY G 37 CYS G 42 AA7 8 MET G 28 ? SER G 33 ? MET G 28 SER G 33 AA7 9 VAL H 135 ? PHE H 136 ? VAL H 135 PHE H 136 AA8 1 VAL G 91 ? LYS G 93 ? VAL G 91 LYS G 93 AA8 2 SER G 101 ? LEU G 105 ? SER G 101 LEU G 105 AA8 3 LYS G 111 ? HIS G 115 ? LYS G 111 HIS G 115 AA8 4 HIS G 67 ? VAL G 72 ? HIS G 67 VAL G 72 AA8 5 LEU H 2 ? VAL H 12 ? LEU H 2 VAL H 12 AA8 6 LEU H 45 ? LEU H 51 ? LEU H 45 LEU H 51 AA8 7 GLY H 37 ? CYS H 42 ? GLY H 37 CYS H 42 AA8 8 ARG H 29 ? TRP H 34 ? ARG H 29 TRP H 34 AA8 9 VAL G 135 ? PHE G 136 ? VAL G 135 PHE G 136 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N TRP B 92 ? N TRP B 92 O TYR B 103 ? O TYR B 103 AA1 2 3 N PHE B 104 ? N PHE B 104 O LEU B 112 ? O LEU B 112 AA1 3 4 O GLU B 113 ? O GLU B 113 N PHE B 70 ? N PHE B 70 AA1 4 5 O SER B 71 ? O SER B 71 N GLN A 3 ? N GLN A 3 AA1 5 6 N LEU A 8 ? N LEU A 8 O CYS A 48 ? O CYS A 48 AA1 6 7 O LEU A 47 ? O LEU A 47 N LEU A 40 ? N LEU A 40 AA1 7 8 O TYR A 39 ? O TYR A 39 N ALA A 32 ? N ALA A 32 AA1 8 9 N SER A 33 ? N SER A 33 O VAL B 135 ? O VAL B 135 AA2 1 2 N TRP A 92 ? N TRP A 92 O TYR A 103 ? O TYR A 103 AA2 2 3 N PHE A 104 ? N PHE A 104 O LEU A 112 ? O LEU A 112 AA2 3 4 O GLU A 113 ? O GLU A 113 N PHE A 70 ? N PHE A 70 AA2 4 5 N ALA A 69 ? N ALA A 69 O ASN B 6 ? O ASN B 6 AA2 5 6 N LEU B 8 ? N LEU B 8 O CYS B 48 ? O CYS B 48 AA2 6 7 O LEU B 47 ? O LEU B 47 N LEU B 40 ? N LEU B 40 AA2 7 8 O TYR B 39 ? O TYR B 39 N HIS B 31 ? N HIS B 31 AA2 8 9 O SER B 33 ? O SER B 33 N VAL A 135 ? N VAL A 135 AA3 1 2 N PHE D 104 ? N PHE D 104 O LEU D 112 ? O LEU D 112 AA3 2 3 O GLU D 113 ? O GLU D 113 N PHE D 70 ? N PHE D 70 AA3 3 4 O ALA D 69 ? O ALA D 69 N ASN C 6 ? N ASN C 6 AA3 4 5 N LEU C 8 ? N LEU C 8 O CYS C 48 ? O CYS C 48 AA3 5 6 O LEU C 47 ? O LEU C 47 N LEU C 40 ? N LEU C 40 AA3 6 7 O TYR C 39 ? O TYR C 39 N ALA C 32 ? N ALA C 32 AA3 7 8 N SER C 33 ? N SER C 33 O VAL D 135 ? O VAL D 135 AA4 1 2 N PHE C 104 ? N PHE C 104 O LEU C 112 ? O LEU C 112 AA4 2 3 O HIS C 115 ? O HIS C 115 N PHE C 70 ? N PHE C 70 AA4 3 4 N SER C 71 ? N SER C 71 O GLN D 3 ? O GLN D 3 AA4 4 5 N LEU D 8 ? N LEU D 8 O CYS D 48 ? O CYS D 48 AA4 5 6 O LEU D 47 ? O LEU D 47 N LEU D 40 ? N LEU D 40 AA4 6 7 O TYR D 39 ? O TYR D 39 N ALA D 32 ? N ALA D 32 AA4 7 8 O SER D 33 ? O SER D 33 N VAL C 135 ? N VAL C 135 AA5 1 2 N TRP F 92 ? N TRP F 92 O TYR F 103 ? O TYR F 103 AA5 2 3 N TYR F 102 ? N TYR F 102 O LEU F 114 ? O LEU F 114 AA5 3 4 O GLU F 113 ? O GLU F 113 N PHE F 70 ? N PHE F 70 AA5 4 5 O ALA F 69 ? O ALA F 69 N ASN E 6 ? N ASN E 6 AA5 5 6 N LEU E 8 ? N LEU E 8 O CYS E 48 ? O CYS E 48 AA5 6 7 O LEU E 47 ? O LEU E 47 N LEU E 40 ? N LEU E 40 AA5 7 8 O SER E 41 ? O SER E 41 N ARG E 29 ? N ARG E 29 AA5 8 9 N SER E 33 ? N SER E 33 O VAL F 135 ? O VAL F 135 AA6 1 2 N TRP E 92 ? N TRP E 92 O TYR E 103 ? O TYR E 103 AA6 2 3 N PHE E 104 ? N PHE E 104 O LEU E 112 ? O LEU E 112 AA6 3 4 O GLU E 113 ? O GLU E 113 N PHE E 70 ? N PHE E 70 AA6 4 5 N ALA E 69 ? N ALA E 69 O ASN F 6 ? O ASN F 6 AA6 5 6 N LEU F 8 ? N LEU F 8 O CYS F 48 ? O CYS F 48 AA6 6 7 O LEU F 47 ? O LEU F 47 N LEU F 40 ? N LEU F 40 AA6 7 8 O TYR F 39 ? O TYR F 39 N ALA F 32 ? N ALA F 32 AA6 8 9 O SER F 33 ? O SER F 33 N VAL E 135 ? N VAL E 135 AA7 1 2 N TRP H 92 ? N TRP H 92 O TYR H 103 ? O TYR H 103 AA7 2 3 N PHE H 104 ? N PHE H 104 O LEU H 112 ? O LEU H 112 AA7 3 4 O GLU H 113 ? O GLU H 113 N PHE H 70 ? N PHE H 70 AA7 4 5 O SER H 71 ? O SER H 71 N GLN G 3 ? N GLN G 3 AA7 5 6 N LEU G 8 ? N LEU G 8 O CYS G 48 ? O CYS G 48 AA7 6 7 O LEU G 47 ? O LEU G 47 N LEU G 40 ? N LEU G 40 AA7 7 8 O TYR G 39 ? O TYR G 39 N ALA G 32 ? N ALA G 32 AA7 8 9 N SER G 33 ? N SER G 33 O VAL H 135 ? O VAL H 135 AA8 1 2 N TRP G 92 ? N TRP G 92 O TYR G 103 ? O TYR G 103 AA8 2 3 N PHE G 104 ? N PHE G 104 O LEU G 112 ? O LEU G 112 AA8 3 4 O GLU G 113 ? O GLU G 113 N PHE G 70 ? N PHE G 70 AA8 4 5 N ALA G 69 ? N ALA G 69 O ASN H 6 ? O ASN H 6 AA8 5 6 N LEU H 8 ? N LEU H 8 O CYS H 48 ? O CYS H 48 AA8 6 7 O LEU H 47 ? O LEU H 47 N LEU H 40 ? N LEU H 40 AA8 7 8 O GLY H 37 ? O GLY H 37 N TRP H 34 ? N TRP H 34 AA8 8 9 O SER H 33 ? O SER H 33 N VAL G 135 ? N VAL G 135 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A MN 201 ? 3 'binding site for residue MN A 201' AC2 Software A NI 202 ? 4 'binding site for residue NI A 202' AC3 Software A NI 203 ? 3 'binding site for residue NI A 203' AC4 Software B MN 201 ? 3 'binding site for residue MN B 201' AC5 Software C MN 201 ? 3 'binding site for residue MN C 201' AC6 Software C NI 202 ? 4 'binding site for residue NI C 202' AC7 Software C NI 203 ? 2 'binding site for residue NI C 203' AC8 Software D MN 201 ? 3 'binding site for residue MN D 201' AC9 Software E MN 201 ? 3 'binding site for residue MN E 201' AD1 Software F MN 201 ? 3 'binding site for residue MN F 201' AD2 Software F NI 202 ? 2 'binding site for residue NI F 202' AD3 Software G MN 201 ? 3 'binding site for residue MN G 201' AD4 Software H MN 201 ? 3 'binding site for residue MN H 201' AD5 Software H NI 202 ? 2 'binding site for residue NI H 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 HIS A 67 ? HIS A 67 . ? 1_555 ? 2 AC1 3 GLU A 113 ? GLU A 113 . ? 1_555 ? 3 AC1 3 HIS B 7 ? HIS B 7 . ? 1_555 ? 4 AC2 4 HIS A 139 ? HIS A 139 . ? 1_555 ? 5 AC2 4 HIS A 141 ? HIS A 141 . ? 1_555 ? 6 AC2 4 HIS F 139 ? HIS F 139 . ? 1_555 ? 7 AC2 4 HIS F 141 ? HIS F 141 . ? 1_555 ? 8 AC3 3 GLU A 128 ? GLU A 128 . ? 1_555 ? 9 AC3 3 HIS A 142 ? HIS A 142 . ? 1_555 ? 10 AC3 3 HIS A 143 ? HIS A 143 . ? 1_555 ? 11 AC4 3 HIS A 7 ? HIS A 7 . ? 1_555 ? 12 AC4 3 HIS B 67 ? HIS B 67 . ? 1_555 ? 13 AC4 3 GLU B 113 ? GLU B 113 . ? 1_555 ? 14 AC5 3 HIS C 67 ? HIS C 67 . ? 1_555 ? 15 AC5 3 GLU C 113 ? GLU C 113 . ? 1_555 ? 16 AC5 3 HIS D 7 ? HIS D 7 . ? 1_555 ? 17 AC6 4 HIS C 139 ? HIS C 139 . ? 1_555 ? 18 AC6 4 HIS C 141 ? HIS C 141 . ? 1_555 ? 19 AC6 4 HIS H 139 ? HIS H 139 . ? 1_555 ? 20 AC6 4 HIS H 141 ? HIS H 141 . ? 1_555 ? 21 AC7 2 GLU C 128 ? GLU C 128 . ? 1_555 ? 22 AC7 2 HIS C 142 ? HIS C 142 . ? 1_555 ? 23 AC8 3 HIS C 7 ? HIS C 7 . ? 1_555 ? 24 AC8 3 HIS D 67 ? HIS D 67 . ? 1_555 ? 25 AC8 3 GLU D 113 ? GLU D 113 . ? 1_555 ? 26 AC9 3 HIS E 67 ? HIS E 67 . ? 1_555 ? 27 AC9 3 GLU E 113 ? GLU E 113 . ? 1_555 ? 28 AC9 3 HIS F 7 ? HIS F 7 . ? 1_555 ? 29 AD1 3 HIS E 7 ? HIS E 7 . ? 1_555 ? 30 AD1 3 HIS F 67 ? HIS F 67 . ? 1_555 ? 31 AD1 3 GLU F 113 ? GLU F 113 . ? 1_555 ? 32 AD2 2 GLU F 128 ? GLU F 128 . ? 1_555 ? 33 AD2 2 HIS F 142 ? HIS F 142 . ? 1_555 ? 34 AD3 3 HIS G 67 ? HIS G 67 . ? 1_555 ? 35 AD3 3 GLU G 113 ? GLU G 113 . ? 1_555 ? 36 AD3 3 HIS H 7 ? HIS H 7 . ? 1_555 ? 37 AD4 3 HIS G 7 ? HIS G 7 . ? 1_555 ? 38 AD4 3 HIS H 67 ? HIS H 67 . ? 1_555 ? 39 AD4 3 GLU H 113 ? GLU H 113 . ? 1_555 ? 40 AD5 2 GLU H 128 ? GLU H 128 . ? 1_555 ? 41 AD5 2 HIS H 142 ? HIS H 142 . ? 1_555 ? # _atom_sites.entry_id 5VB0 _atom_sites.fract_transf_matrix[1][1] 0.011414 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011414 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.002801 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C MN N NI O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 ASN 6 6 6 ASN ASN A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 MET 28 28 28 MET MET A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 HIS 31 31 31 HIS HIS A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 TRP 34 34 34 TRP TRP A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 TRP 46 46 46 TRP TRP A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 PRO 59 59 59 PRO PRO A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 TYR 65 65 65 TYR TYR A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 HIS 67 67 67 HIS HIS A . n A 1 68 TYR 68 68 68 TYR TYR A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 PHE 77 77 77 PHE PHE A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 GLN 86 86 86 GLN GLN A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 TRP 92 92 92 TRP TRP A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 ASN 95 95 95 ASN ASN A . n A 1 96 ARG 96 96 ? ? ? A . n A 1 97 SER 97 97 ? ? ? A . n A 1 98 GLU 98 98 ? ? ? A . n A 1 99 GLY 99 99 ? ? ? A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 TYR 102 102 102 TYR TYR A . n A 1 103 TYR 103 103 103 TYR TYR A . n A 1 104 PHE 104 104 104 PHE PHE A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 ASP 106 106 106 ASP ASP A . n A 1 107 PRO 107 107 107 PRO PRO A . n A 1 108 ASP 108 108 108 ASP ASP A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 HIS 110 110 110 HIS HIS A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 HIS 115 115 115 HIS HIS A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 ASN 118 118 118 ASN ASN A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 GLN 121 121 121 GLN GLN A . n A 1 122 ARG 122 122 122 ARG ARG A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 CYS 126 126 126 CYS CYS A . n A 1 127 ARG 127 127 127 ARG ARG A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 ARG 129 129 129 ARG ARG A . n A 1 130 PRO 130 130 130 PRO PRO A . n A 1 131 TYR 131 131 131 TYR TYR A . n A 1 132 LYS 132 132 132 LYS LYS A . n A 1 133 GLY 133 133 133 GLY GLY A . n A 1 134 MET 134 134 134 MET MET A . n A 1 135 VAL 135 135 135 VAL VAL A . n A 1 136 PHE 136 136 136 PHE PHE A . n A 1 137 PHE 137 137 137 PHE PHE A . n A 1 138 ASP 138 138 138 ASP ASP A . n A 1 139 HIS 139 139 139 HIS HIS A . n A 1 140 HIS 140 140 140 HIS HIS A . n A 1 141 HIS 141 141 141 HIS HIS A . n A 1 142 HIS 142 142 142 HIS HIS A . n A 1 143 HIS 143 143 143 HIS HIS A . n A 1 144 HIS 144 144 ? ? ? A . n B 1 1 MET 1 1 1 MET MET B . n B 1 2 LEU 2 2 2 LEU LEU B . n B 1 3 GLN 3 3 3 GLN GLN B . n B 1 4 GLY 4 4 4 GLY GLY B . n B 1 5 LEU 5 5 5 LEU LEU B . n B 1 6 ASN 6 6 6 ASN ASN B . n B 1 7 HIS 7 7 7 HIS HIS B . n B 1 8 LEU 8 8 8 LEU LEU B . n B 1 9 THR 9 9 9 THR THR B . n B 1 10 LEU 10 10 10 LEU LEU B . n B 1 11 ALA 11 11 11 ALA ALA B . n B 1 12 VAL 12 12 12 VAL VAL B . n B 1 13 SER 13 13 13 SER SER B . n B 1 14 ASP 14 14 14 ASP ASP B . n B 1 15 LEU 15 15 15 LEU LEU B . n B 1 16 ALA 16 16 16 ALA ALA B . n B 1 17 SER 17 17 17 SER SER B . n B 1 18 SER 18 18 18 SER SER B . n B 1 19 LEU 19 19 19 LEU LEU B . n B 1 20 ALA 20 20 20 ALA ALA B . n B 1 21 PHE 21 21 21 PHE PHE B . n B 1 22 TYR 22 22 22 TYR TYR B . n B 1 23 GLN 23 23 23 GLN GLN B . n B 1 24 GLN 24 24 24 GLN GLN B . n B 1 25 LEU 25 25 25 LEU LEU B . n B 1 26 PRO 26 26 26 PRO PRO B . n B 1 27 GLY 27 27 27 GLY GLY B . n B 1 28 MET 28 28 28 MET MET B . n B 1 29 ARG 29 29 29 ARG ARG B . n B 1 30 LEU 30 30 30 LEU LEU B . n B 1 31 HIS 31 31 31 HIS HIS B . n B 1 32 ALA 32 32 32 ALA ALA B . n B 1 33 SER 33 33 33 SER SER B . n B 1 34 TRP 34 34 34 TRP TRP B . n B 1 35 ASP 35 35 35 ASP ASP B . n B 1 36 SER 36 36 36 SER SER B . n B 1 37 GLY 37 37 37 GLY GLY B . n B 1 38 ALA 38 38 38 ALA ALA B . n B 1 39 TYR 39 39 39 TYR TYR B . n B 1 40 LEU 40 40 40 LEU LEU B . n B 1 41 SER 41 41 41 SER SER B . n B 1 42 CYS 42 42 42 CYS CYS B . n B 1 43 GLY 43 43 43 GLY GLY B . n B 1 44 ALA 44 44 44 ALA ALA B . n B 1 45 LEU 45 45 45 LEU LEU B . n B 1 46 TRP 46 46 46 TRP TRP B . n B 1 47 LEU 47 47 47 LEU LEU B . n B 1 48 CYS 48 48 48 CYS CYS B . n B 1 49 LEU 49 49 49 LEU LEU B . n B 1 50 SER 50 50 50 SER SER B . n B 1 51 LEU 51 51 51 LEU LEU B . n B 1 52 ASP 52 52 52 ASP ASP B . n B 1 53 GLU 53 53 53 GLU GLU B . n B 1 54 GLN 54 54 54 GLN GLN B . n B 1 55 ARG 55 55 55 ARG ARG B . n B 1 56 ARG 56 56 56 ARG ARG B . n B 1 57 LYS 57 57 57 LYS LYS B . n B 1 58 THR 58 58 58 THR THR B . n B 1 59 PRO 59 59 59 PRO PRO B . n B 1 60 PRO 60 60 60 PRO PRO B . n B 1 61 GLN 61 61 61 GLN GLN B . n B 1 62 GLU 62 62 62 GLU GLU B . n B 1 63 SER 63 63 63 SER SER B . n B 1 64 ASP 64 64 64 ASP ASP B . n B 1 65 TYR 65 65 65 TYR TYR B . n B 1 66 THR 66 66 66 THR THR B . n B 1 67 HIS 67 67 67 HIS HIS B . n B 1 68 TYR 68 68 68 TYR TYR B . n B 1 69 ALA 69 69 69 ALA ALA B . n B 1 70 PHE 70 70 70 PHE PHE B . n B 1 71 SER 71 71 71 SER SER B . n B 1 72 VAL 72 72 72 VAL VAL B . n B 1 73 ALA 73 73 73 ALA ALA B . n B 1 74 GLU 74 74 74 GLU GLU B . n B 1 75 GLU 75 75 75 GLU GLU B . n B 1 76 GLU 76 76 76 GLU GLU B . n B 1 77 PHE 77 77 77 PHE PHE B . n B 1 78 ALA 78 78 78 ALA ALA B . n B 1 79 GLY 79 79 79 GLY GLY B . n B 1 80 VAL 80 80 80 VAL VAL B . n B 1 81 VAL 81 81 81 VAL VAL B . n B 1 82 ALA 82 82 82 ALA ALA B . n B 1 83 LEU 83 83 83 LEU LEU B . n B 1 84 LEU 84 84 84 LEU LEU B . n B 1 85 ALA 85 85 85 ALA ALA B . n B 1 86 GLN 86 86 86 GLN GLN B . n B 1 87 ALA 87 87 87 ALA ALA B . n B 1 88 GLY 88 88 88 GLY GLY B . n B 1 89 ALA 89 89 89 ALA ALA B . n B 1 90 GLU 90 90 90 GLU GLU B . n B 1 91 VAL 91 91 91 VAL VAL B . n B 1 92 TRP 92 92 92 TRP TRP B . n B 1 93 LYS 93 93 93 LYS LYS B . n B 1 94 ASP 94 94 94 ASP ASP B . n B 1 95 ASN 95 95 ? ? ? B . n B 1 96 ARG 96 96 ? ? ? B . n B 1 97 SER 97 97 ? ? ? B . n B 1 98 GLU 98 98 ? ? ? B . n B 1 99 GLY 99 99 ? ? ? B . n B 1 100 ALA 100 100 100 ALA ALA B . n B 1 101 SER 101 101 101 SER SER B . n B 1 102 TYR 102 102 102 TYR TYR B . n B 1 103 TYR 103 103 103 TYR TYR B . n B 1 104 PHE 104 104 104 PHE PHE B . n B 1 105 LEU 105 105 105 LEU LEU B . n B 1 106 ASP 106 106 106 ASP ASP B . n B 1 107 PRO 107 107 107 PRO PRO B . n B 1 108 ASP 108 108 108 ASP ASP B . n B 1 109 GLY 109 109 109 GLY GLY B . n B 1 110 HIS 110 110 110 HIS HIS B . n B 1 111 LYS 111 111 111 LYS LYS B . n B 1 112 LEU 112 112 112 LEU LEU B . n B 1 113 GLU 113 113 113 GLU GLU B . n B 1 114 LEU 114 114 114 LEU LEU B . n B 1 115 HIS 115 115 115 HIS HIS B . n B 1 116 VAL 116 116 116 VAL VAL B . n B 1 117 GLY 117 117 117 GLY GLY B . n B 1 118 ASN 118 118 118 ASN ASN B . n B 1 119 LEU 119 119 119 LEU LEU B . n B 1 120 ALA 120 120 120 ALA ALA B . n B 1 121 GLN 121 121 121 GLN GLN B . n B 1 122 ARG 122 122 122 ARG ARG B . n B 1 123 LEU 123 123 123 LEU LEU B . n B 1 124 ALA 124 124 124 ALA ALA B . n B 1 125 ALA 125 125 125 ALA ALA B . n B 1 126 CYS 126 126 126 CYS CYS B . n B 1 127 ARG 127 127 127 ARG ARG B . n B 1 128 GLU 128 128 128 GLU GLU B . n B 1 129 ARG 129 129 129 ARG ARG B . n B 1 130 PRO 130 130 130 PRO PRO B . n B 1 131 TYR 131 131 131 TYR TYR B . n B 1 132 LYS 132 132 132 LYS LYS B . n B 1 133 GLY 133 133 133 GLY GLY B . n B 1 134 MET 134 134 134 MET MET B . n B 1 135 VAL 135 135 135 VAL VAL B . n B 1 136 PHE 136 136 136 PHE PHE B . n B 1 137 PHE 137 137 137 PHE PHE B . n B 1 138 ASP 138 138 138 ASP ASP B . n B 1 139 HIS 139 139 ? ? ? B . n B 1 140 HIS 140 140 ? ? ? B . n B 1 141 HIS 141 141 ? ? ? B . n B 1 142 HIS 142 142 ? ? ? B . n B 1 143 HIS 143 143 ? ? ? B . n B 1 144 HIS 144 144 ? ? ? B . n C 1 1 MET 1 1 1 MET MET C . n C 1 2 LEU 2 2 2 LEU LEU C . n C 1 3 GLN 3 3 3 GLN GLN C . n C 1 4 GLY 4 4 4 GLY GLY C . n C 1 5 LEU 5 5 5 LEU LEU C . n C 1 6 ASN 6 6 6 ASN ASN C . n C 1 7 HIS 7 7 7 HIS HIS C . n C 1 8 LEU 8 8 8 LEU LEU C . n C 1 9 THR 9 9 9 THR THR C . n C 1 10 LEU 10 10 10 LEU LEU C . n C 1 11 ALA 11 11 11 ALA ALA C . n C 1 12 VAL 12 12 12 VAL VAL C . n C 1 13 SER 13 13 13 SER SER C . n C 1 14 ASP 14 14 14 ASP ASP C . n C 1 15 LEU 15 15 15 LEU LEU C . n C 1 16 ALA 16 16 16 ALA ALA C . n C 1 17 SER 17 17 17 SER SER C . n C 1 18 SER 18 18 18 SER SER C . n C 1 19 LEU 19 19 19 LEU LEU C . n C 1 20 ALA 20 20 20 ALA ALA C . n C 1 21 PHE 21 21 21 PHE PHE C . n C 1 22 TYR 22 22 22 TYR TYR C . n C 1 23 GLN 23 23 23 GLN GLN C . n C 1 24 GLN 24 24 24 GLN GLN C . n C 1 25 LEU 25 25 25 LEU LEU C . n C 1 26 PRO 26 26 26 PRO PRO C . n C 1 27 GLY 27 27 27 GLY GLY C . n C 1 28 MET 28 28 28 MET MET C . n C 1 29 ARG 29 29 29 ARG ARG C . n C 1 30 LEU 30 30 30 LEU LEU C . n C 1 31 HIS 31 31 31 HIS HIS C . n C 1 32 ALA 32 32 32 ALA ALA C . n C 1 33 SER 33 33 33 SER SER C . n C 1 34 TRP 34 34 34 TRP TRP C . n C 1 35 ASP 35 35 35 ASP ASP C . n C 1 36 SER 36 36 36 SER SER C . n C 1 37 GLY 37 37 37 GLY GLY C . n C 1 38 ALA 38 38 38 ALA ALA C . n C 1 39 TYR 39 39 39 TYR TYR C . n C 1 40 LEU 40 40 40 LEU LEU C . n C 1 41 SER 41 41 41 SER SER C . n C 1 42 CYS 42 42 42 CYS CYS C . n C 1 43 GLY 43 43 43 GLY GLY C . n C 1 44 ALA 44 44 44 ALA ALA C . n C 1 45 LEU 45 45 45 LEU LEU C . n C 1 46 TRP 46 46 46 TRP TRP C . n C 1 47 LEU 47 47 47 LEU LEU C . n C 1 48 CYS 48 48 48 CYS CYS C . n C 1 49 LEU 49 49 49 LEU LEU C . n C 1 50 SER 50 50 50 SER SER C . n C 1 51 LEU 51 51 51 LEU LEU C . n C 1 52 ASP 52 52 52 ASP ASP C . n C 1 53 GLU 53 53 53 GLU GLU C . n C 1 54 GLN 54 54 54 GLN GLN C . n C 1 55 ARG 55 55 55 ARG ARG C . n C 1 56 ARG 56 56 56 ARG ARG C . n C 1 57 LYS 57 57 57 LYS LYS C . n C 1 58 THR 58 58 58 THR THR C . n C 1 59 PRO 59 59 59 PRO PRO C . n C 1 60 PRO 60 60 60 PRO PRO C . n C 1 61 GLN 61 61 61 GLN GLN C . n C 1 62 GLU 62 62 62 GLU GLU C . n C 1 63 SER 63 63 63 SER SER C . n C 1 64 ASP 64 64 64 ASP ASP C . n C 1 65 TYR 65 65 65 TYR TYR C . n C 1 66 THR 66 66 66 THR THR C . n C 1 67 HIS 67 67 67 HIS HIS C . n C 1 68 TYR 68 68 68 TYR TYR C . n C 1 69 ALA 69 69 69 ALA ALA C . n C 1 70 PHE 70 70 70 PHE PHE C . n C 1 71 SER 71 71 71 SER SER C . n C 1 72 VAL 72 72 72 VAL VAL C . n C 1 73 ALA 73 73 73 ALA ALA C . n C 1 74 GLU 74 74 74 GLU GLU C . n C 1 75 GLU 75 75 75 GLU GLU C . n C 1 76 GLU 76 76 76 GLU GLU C . n C 1 77 PHE 77 77 77 PHE PHE C . n C 1 78 ALA 78 78 78 ALA ALA C . n C 1 79 GLY 79 79 79 GLY GLY C . n C 1 80 VAL 80 80 80 VAL VAL C . n C 1 81 VAL 81 81 81 VAL VAL C . n C 1 82 ALA 82 82 82 ALA ALA C . n C 1 83 LEU 83 83 83 LEU LEU C . n C 1 84 LEU 84 84 84 LEU LEU C . n C 1 85 ALA 85 85 85 ALA ALA C . n C 1 86 GLN 86 86 86 GLN GLN C . n C 1 87 ALA 87 87 87 ALA ALA C . n C 1 88 GLY 88 88 88 GLY GLY C . n C 1 89 ALA 89 89 89 ALA ALA C . n C 1 90 GLU 90 90 90 GLU GLU C . n C 1 91 VAL 91 91 91 VAL VAL C . n C 1 92 TRP 92 92 92 TRP TRP C . n C 1 93 LYS 93 93 93 LYS LYS C . n C 1 94 ASP 94 94 94 ASP ASP C . n C 1 95 ASN 95 95 95 ASN ASN C . n C 1 96 ARG 96 96 96 ARG ARG C . n C 1 97 SER 97 97 97 SER SER C . n C 1 98 GLU 98 98 98 GLU GLU C . n C 1 99 GLY 99 99 99 GLY GLY C . n C 1 100 ALA 100 100 100 ALA ALA C . n C 1 101 SER 101 101 101 SER SER C . n C 1 102 TYR 102 102 102 TYR TYR C . n C 1 103 TYR 103 103 103 TYR TYR C . n C 1 104 PHE 104 104 104 PHE PHE C . n C 1 105 LEU 105 105 105 LEU LEU C . n C 1 106 ASP 106 106 106 ASP ASP C . n C 1 107 PRO 107 107 107 PRO PRO C . n C 1 108 ASP 108 108 108 ASP ASP C . n C 1 109 GLY 109 109 109 GLY GLY C . n C 1 110 HIS 110 110 110 HIS HIS C . n C 1 111 LYS 111 111 111 LYS LYS C . n C 1 112 LEU 112 112 112 LEU LEU C . n C 1 113 GLU 113 113 113 GLU GLU C . n C 1 114 LEU 114 114 114 LEU LEU C . n C 1 115 HIS 115 115 115 HIS HIS C . n C 1 116 VAL 116 116 116 VAL VAL C . n C 1 117 GLY 117 117 117 GLY GLY C . n C 1 118 ASN 118 118 118 ASN ASN C . n C 1 119 LEU 119 119 119 LEU LEU C . n C 1 120 ALA 120 120 120 ALA ALA C . n C 1 121 GLN 121 121 121 GLN GLN C . n C 1 122 ARG 122 122 122 ARG ARG C . n C 1 123 LEU 123 123 123 LEU LEU C . n C 1 124 ALA 124 124 124 ALA ALA C . n C 1 125 ALA 125 125 125 ALA ALA C . n C 1 126 CYS 126 126 126 CYS CYS C . n C 1 127 ARG 127 127 127 ARG ARG C . n C 1 128 GLU 128 128 128 GLU GLU C . n C 1 129 ARG 129 129 129 ARG ARG C . n C 1 130 PRO 130 130 130 PRO PRO C . n C 1 131 TYR 131 131 131 TYR TYR C . n C 1 132 LYS 132 132 132 LYS LYS C . n C 1 133 GLY 133 133 133 GLY GLY C . n C 1 134 MET 134 134 134 MET MET C . n C 1 135 VAL 135 135 135 VAL VAL C . n C 1 136 PHE 136 136 136 PHE PHE C . n C 1 137 PHE 137 137 137 PHE PHE C . n C 1 138 ASP 138 138 138 ASP ASP C . n C 1 139 HIS 139 139 139 HIS HIS C . n C 1 140 HIS 140 140 140 HIS HIS C . n C 1 141 HIS 141 141 141 HIS HIS C . n C 1 142 HIS 142 142 142 HIS HIS C . n C 1 143 HIS 143 143 143 HIS HIS C . n C 1 144 HIS 144 144 ? ? ? C . n D 1 1 MET 1 1 1 MET MET D . n D 1 2 LEU 2 2 2 LEU LEU D . n D 1 3 GLN 3 3 3 GLN GLN D . n D 1 4 GLY 4 4 4 GLY GLY D . n D 1 5 LEU 5 5 5 LEU LEU D . n D 1 6 ASN 6 6 6 ASN ASN D . n D 1 7 HIS 7 7 7 HIS HIS D . n D 1 8 LEU 8 8 8 LEU LEU D . n D 1 9 THR 9 9 9 THR THR D . n D 1 10 LEU 10 10 10 LEU LEU D . n D 1 11 ALA 11 11 11 ALA ALA D . n D 1 12 VAL 12 12 12 VAL VAL D . n D 1 13 SER 13 13 13 SER SER D . n D 1 14 ASP 14 14 14 ASP ASP D . n D 1 15 LEU 15 15 15 LEU LEU D . n D 1 16 ALA 16 16 16 ALA ALA D . n D 1 17 SER 17 17 17 SER SER D . n D 1 18 SER 18 18 18 SER SER D . n D 1 19 LEU 19 19 19 LEU LEU D . n D 1 20 ALA 20 20 20 ALA ALA D . n D 1 21 PHE 21 21 21 PHE PHE D . n D 1 22 TYR 22 22 22 TYR TYR D . n D 1 23 GLN 23 23 23 GLN GLN D . n D 1 24 GLN 24 24 24 GLN GLN D . n D 1 25 LEU 25 25 25 LEU LEU D . n D 1 26 PRO 26 26 26 PRO PRO D . n D 1 27 GLY 27 27 27 GLY GLY D . n D 1 28 MET 28 28 28 MET MET D . n D 1 29 ARG 29 29 29 ARG ARG D . n D 1 30 LEU 30 30 30 LEU LEU D . n D 1 31 HIS 31 31 31 HIS HIS D . n D 1 32 ALA 32 32 32 ALA ALA D . n D 1 33 SER 33 33 33 SER SER D . n D 1 34 TRP 34 34 34 TRP TRP D . n D 1 35 ASP 35 35 35 ASP ASP D . n D 1 36 SER 36 36 36 SER SER D . n D 1 37 GLY 37 37 37 GLY GLY D . n D 1 38 ALA 38 38 38 ALA ALA D . n D 1 39 TYR 39 39 39 TYR TYR D . n D 1 40 LEU 40 40 40 LEU LEU D . n D 1 41 SER 41 41 41 SER SER D . n D 1 42 CYS 42 42 42 CYS CYS D . n D 1 43 GLY 43 43 43 GLY GLY D . n D 1 44 ALA 44 44 44 ALA ALA D . n D 1 45 LEU 45 45 45 LEU LEU D . n D 1 46 TRP 46 46 46 TRP TRP D . n D 1 47 LEU 47 47 47 LEU LEU D . n D 1 48 CYS 48 48 48 CYS CYS D . n D 1 49 LEU 49 49 49 LEU LEU D . n D 1 50 SER 50 50 50 SER SER D . n D 1 51 LEU 51 51 51 LEU LEU D . n D 1 52 ASP 52 52 52 ASP ASP D . n D 1 53 GLU 53 53 53 GLU GLU D . n D 1 54 GLN 54 54 54 GLN GLN D . n D 1 55 ARG 55 55 55 ARG ARG D . n D 1 56 ARG 56 56 56 ARG ARG D . n D 1 57 LYS 57 57 57 LYS LYS D . n D 1 58 THR 58 58 58 THR THR D . n D 1 59 PRO 59 59 59 PRO PRO D . n D 1 60 PRO 60 60 60 PRO PRO D . n D 1 61 GLN 61 61 61 GLN GLN D . n D 1 62 GLU 62 62 62 GLU GLU D . n D 1 63 SER 63 63 63 SER SER D . n D 1 64 ASP 64 64 64 ASP ASP D . n D 1 65 TYR 65 65 65 TYR TYR D . n D 1 66 THR 66 66 66 THR THR D . n D 1 67 HIS 67 67 67 HIS HIS D . n D 1 68 TYR 68 68 68 TYR TYR D . n D 1 69 ALA 69 69 69 ALA ALA D . n D 1 70 PHE 70 70 70 PHE PHE D . n D 1 71 SER 71 71 71 SER SER D . n D 1 72 VAL 72 72 72 VAL VAL D . n D 1 73 ALA 73 73 73 ALA ALA D . n D 1 74 GLU 74 74 74 GLU GLU D . n D 1 75 GLU 75 75 75 GLU GLU D . n D 1 76 GLU 76 76 76 GLU GLU D . n D 1 77 PHE 77 77 77 PHE PHE D . n D 1 78 ALA 78 78 78 ALA ALA D . n D 1 79 GLY 79 79 79 GLY GLY D . n D 1 80 VAL 80 80 80 VAL VAL D . n D 1 81 VAL 81 81 81 VAL VAL D . n D 1 82 ALA 82 82 82 ALA ALA D . n D 1 83 LEU 83 83 83 LEU LEU D . n D 1 84 LEU 84 84 84 LEU LEU D . n D 1 85 ALA 85 85 85 ALA ALA D . n D 1 86 GLN 86 86 86 GLN GLN D . n D 1 87 ALA 87 87 87 ALA ALA D . n D 1 88 GLY 88 88 88 GLY GLY D . n D 1 89 ALA 89 89 89 ALA ALA D . n D 1 90 GLU 90 90 90 GLU GLU D . n D 1 91 VAL 91 91 91 VAL VAL D . n D 1 92 TRP 92 92 92 TRP TRP D . n D 1 93 LYS 93 93 93 LYS LYS D . n D 1 94 ASP 94 94 94 ASP ASP D . n D 1 95 ASN 95 95 ? ? ? D . n D 1 96 ARG 96 96 ? ? ? D . n D 1 97 SER 97 97 ? ? ? D . n D 1 98 GLU 98 98 ? ? ? D . n D 1 99 GLY 99 99 ? ? ? D . n D 1 100 ALA 100 100 100 ALA ALA D . n D 1 101 SER 101 101 101 SER SER D . n D 1 102 TYR 102 102 102 TYR TYR D . n D 1 103 TYR 103 103 103 TYR TYR D . n D 1 104 PHE 104 104 104 PHE PHE D . n D 1 105 LEU 105 105 105 LEU LEU D . n D 1 106 ASP 106 106 106 ASP ASP D . n D 1 107 PRO 107 107 107 PRO PRO D . n D 1 108 ASP 108 108 108 ASP ASP D . n D 1 109 GLY 109 109 109 GLY GLY D . n D 1 110 HIS 110 110 110 HIS HIS D . n D 1 111 LYS 111 111 111 LYS LYS D . n D 1 112 LEU 112 112 112 LEU LEU D . n D 1 113 GLU 113 113 113 GLU GLU D . n D 1 114 LEU 114 114 114 LEU LEU D . n D 1 115 HIS 115 115 115 HIS HIS D . n D 1 116 VAL 116 116 116 VAL VAL D . n D 1 117 GLY 117 117 117 GLY GLY D . n D 1 118 ASN 118 118 118 ASN ASN D . n D 1 119 LEU 119 119 119 LEU LEU D . n D 1 120 ALA 120 120 120 ALA ALA D . n D 1 121 GLN 121 121 121 GLN GLN D . n D 1 122 ARG 122 122 122 ARG ARG D . n D 1 123 LEU 123 123 123 LEU LEU D . n D 1 124 ALA 124 124 124 ALA ALA D . n D 1 125 ALA 125 125 125 ALA ALA D . n D 1 126 CYS 126 126 126 CYS CYS D . n D 1 127 ARG 127 127 127 ARG ARG D . n D 1 128 GLU 128 128 128 GLU GLU D . n D 1 129 ARG 129 129 129 ARG ARG D . n D 1 130 PRO 130 130 130 PRO PRO D . n D 1 131 TYR 131 131 131 TYR TYR D . n D 1 132 LYS 132 132 132 LYS LYS D . n D 1 133 GLY 133 133 133 GLY GLY D . n D 1 134 MET 134 134 134 MET MET D . n D 1 135 VAL 135 135 135 VAL VAL D . n D 1 136 PHE 136 136 136 PHE PHE D . n D 1 137 PHE 137 137 137 PHE PHE D . n D 1 138 ASP 138 138 ? ? ? D . n D 1 139 HIS 139 139 ? ? ? D . n D 1 140 HIS 140 140 ? ? ? D . n D 1 141 HIS 141 141 ? ? ? D . n D 1 142 HIS 142 142 ? ? ? D . n D 1 143 HIS 143 143 ? ? ? D . n D 1 144 HIS 144 144 ? ? ? D . n E 1 1 MET 1 1 1 MET MET E . n E 1 2 LEU 2 2 2 LEU LEU E . n E 1 3 GLN 3 3 3 GLN GLN E . n E 1 4 GLY 4 4 4 GLY GLY E . n E 1 5 LEU 5 5 5 LEU LEU E . n E 1 6 ASN 6 6 6 ASN ASN E . n E 1 7 HIS 7 7 7 HIS HIS E . n E 1 8 LEU 8 8 8 LEU LEU E . n E 1 9 THR 9 9 9 THR THR E . n E 1 10 LEU 10 10 10 LEU LEU E . n E 1 11 ALA 11 11 11 ALA ALA E . n E 1 12 VAL 12 12 12 VAL VAL E . n E 1 13 SER 13 13 13 SER SER E . n E 1 14 ASP 14 14 14 ASP ASP E . n E 1 15 LEU 15 15 15 LEU LEU E . n E 1 16 ALA 16 16 16 ALA ALA E . n E 1 17 SER 17 17 17 SER SER E . n E 1 18 SER 18 18 18 SER SER E . n E 1 19 LEU 19 19 19 LEU LEU E . n E 1 20 ALA 20 20 20 ALA ALA E . n E 1 21 PHE 21 21 21 PHE PHE E . n E 1 22 TYR 22 22 22 TYR TYR E . n E 1 23 GLN 23 23 23 GLN GLN E . n E 1 24 GLN 24 24 24 GLN GLN E . n E 1 25 LEU 25 25 25 LEU LEU E . n E 1 26 PRO 26 26 26 PRO PRO E . n E 1 27 GLY 27 27 27 GLY GLY E . n E 1 28 MET 28 28 28 MET MET E . n E 1 29 ARG 29 29 29 ARG ARG E . n E 1 30 LEU 30 30 30 LEU LEU E . n E 1 31 HIS 31 31 31 HIS HIS E . n E 1 32 ALA 32 32 32 ALA ALA E . n E 1 33 SER 33 33 33 SER SER E . n E 1 34 TRP 34 34 34 TRP TRP E . n E 1 35 ASP 35 35 35 ASP ASP E . n E 1 36 SER 36 36 36 SER SER E . n E 1 37 GLY 37 37 37 GLY GLY E . n E 1 38 ALA 38 38 38 ALA ALA E . n E 1 39 TYR 39 39 39 TYR TYR E . n E 1 40 LEU 40 40 40 LEU LEU E . n E 1 41 SER 41 41 41 SER SER E . n E 1 42 CYS 42 42 42 CYS CYS E . n E 1 43 GLY 43 43 43 GLY GLY E . n E 1 44 ALA 44 44 44 ALA ALA E . n E 1 45 LEU 45 45 45 LEU LEU E . n E 1 46 TRP 46 46 46 TRP TRP E . n E 1 47 LEU 47 47 47 LEU LEU E . n E 1 48 CYS 48 48 48 CYS CYS E . n E 1 49 LEU 49 49 49 LEU LEU E . n E 1 50 SER 50 50 50 SER SER E . n E 1 51 LEU 51 51 51 LEU LEU E . n E 1 52 ASP 52 52 52 ASP ASP E . n E 1 53 GLU 53 53 53 GLU GLU E . n E 1 54 GLN 54 54 54 GLN GLN E . n E 1 55 ARG 55 55 55 ARG ARG E . n E 1 56 ARG 56 56 56 ARG ARG E . n E 1 57 LYS 57 57 57 LYS LYS E . n E 1 58 THR 58 58 58 THR THR E . n E 1 59 PRO 59 59 59 PRO PRO E . n E 1 60 PRO 60 60 60 PRO PRO E . n E 1 61 GLN 61 61 61 GLN GLN E . n E 1 62 GLU 62 62 62 GLU GLU E . n E 1 63 SER 63 63 63 SER SER E . n E 1 64 ASP 64 64 64 ASP ASP E . n E 1 65 TYR 65 65 65 TYR TYR E . n E 1 66 THR 66 66 66 THR THR E . n E 1 67 HIS 67 67 67 HIS HIS E . n E 1 68 TYR 68 68 68 TYR TYR E . n E 1 69 ALA 69 69 69 ALA ALA E . n E 1 70 PHE 70 70 70 PHE PHE E . n E 1 71 SER 71 71 71 SER SER E . n E 1 72 VAL 72 72 72 VAL VAL E . n E 1 73 ALA 73 73 73 ALA ALA E . n E 1 74 GLU 74 74 74 GLU GLU E . n E 1 75 GLU 75 75 75 GLU GLU E . n E 1 76 GLU 76 76 76 GLU GLU E . n E 1 77 PHE 77 77 77 PHE PHE E . n E 1 78 ALA 78 78 78 ALA ALA E . n E 1 79 GLY 79 79 79 GLY GLY E . n E 1 80 VAL 80 80 80 VAL VAL E . n E 1 81 VAL 81 81 81 VAL VAL E . n E 1 82 ALA 82 82 82 ALA ALA E . n E 1 83 LEU 83 83 83 LEU LEU E . n E 1 84 LEU 84 84 84 LEU LEU E . n E 1 85 ALA 85 85 85 ALA ALA E . n E 1 86 GLN 86 86 86 GLN GLN E . n E 1 87 ALA 87 87 87 ALA ALA E . n E 1 88 GLY 88 88 88 GLY GLY E . n E 1 89 ALA 89 89 89 ALA ALA E . n E 1 90 GLU 90 90 90 GLU GLU E . n E 1 91 VAL 91 91 91 VAL VAL E . n E 1 92 TRP 92 92 92 TRP TRP E . n E 1 93 LYS 93 93 93 LYS LYS E . n E 1 94 ASP 94 94 94 ASP ASP E . n E 1 95 ASN 95 95 ? ? ? E . n E 1 96 ARG 96 96 ? ? ? E . n E 1 97 SER 97 97 ? ? ? E . n E 1 98 GLU 98 98 ? ? ? E . n E 1 99 GLY 99 99 ? ? ? E . n E 1 100 ALA 100 100 100 ALA ALA E . n E 1 101 SER 101 101 101 SER SER E . n E 1 102 TYR 102 102 102 TYR TYR E . n E 1 103 TYR 103 103 103 TYR TYR E . n E 1 104 PHE 104 104 104 PHE PHE E . n E 1 105 LEU 105 105 105 LEU LEU E . n E 1 106 ASP 106 106 106 ASP ASP E . n E 1 107 PRO 107 107 107 PRO PRO E . n E 1 108 ASP 108 108 108 ASP ASP E . n E 1 109 GLY 109 109 109 GLY GLY E . n E 1 110 HIS 110 110 110 HIS HIS E . n E 1 111 LYS 111 111 111 LYS LYS E . n E 1 112 LEU 112 112 112 LEU LEU E . n E 1 113 GLU 113 113 113 GLU GLU E . n E 1 114 LEU 114 114 114 LEU LEU E . n E 1 115 HIS 115 115 115 HIS HIS E . n E 1 116 VAL 116 116 116 VAL VAL E . n E 1 117 GLY 117 117 117 GLY GLY E . n E 1 118 ASN 118 118 118 ASN ASN E . n E 1 119 LEU 119 119 119 LEU LEU E . n E 1 120 ALA 120 120 120 ALA ALA E . n E 1 121 GLN 121 121 121 GLN GLN E . n E 1 122 ARG 122 122 122 ARG ARG E . n E 1 123 LEU 123 123 123 LEU LEU E . n E 1 124 ALA 124 124 124 ALA ALA E . n E 1 125 ALA 125 125 125 ALA ALA E . n E 1 126 CYS 126 126 126 CYS CYS E . n E 1 127 ARG 127 127 127 ARG ARG E . n E 1 128 GLU 128 128 128 GLU GLU E . n E 1 129 ARG 129 129 129 ARG ARG E . n E 1 130 PRO 130 130 130 PRO PRO E . n E 1 131 TYR 131 131 131 TYR TYR E . n E 1 132 LYS 132 132 132 LYS LYS E . n E 1 133 GLY 133 133 133 GLY GLY E . n E 1 134 MET 134 134 134 MET MET E . n E 1 135 VAL 135 135 135 VAL VAL E . n E 1 136 PHE 136 136 136 PHE PHE E . n E 1 137 PHE 137 137 137 PHE PHE E . n E 1 138 ASP 138 138 138 ASP ASP E . n E 1 139 HIS 139 139 ? ? ? E . n E 1 140 HIS 140 140 ? ? ? E . n E 1 141 HIS 141 141 ? ? ? E . n E 1 142 HIS 142 142 ? ? ? E . n E 1 143 HIS 143 143 ? ? ? E . n E 1 144 HIS 144 144 ? ? ? E . n F 1 1 MET 1 1 1 MET MET F . n F 1 2 LEU 2 2 2 LEU LEU F . n F 1 3 GLN 3 3 3 GLN GLN F . n F 1 4 GLY 4 4 4 GLY GLY F . n F 1 5 LEU 5 5 5 LEU LEU F . n F 1 6 ASN 6 6 6 ASN ASN F . n F 1 7 HIS 7 7 7 HIS HIS F . n F 1 8 LEU 8 8 8 LEU LEU F . n F 1 9 THR 9 9 9 THR THR F . n F 1 10 LEU 10 10 10 LEU LEU F . n F 1 11 ALA 11 11 11 ALA ALA F . n F 1 12 VAL 12 12 12 VAL VAL F . n F 1 13 SER 13 13 13 SER SER F . n F 1 14 ASP 14 14 14 ASP ASP F . n F 1 15 LEU 15 15 15 LEU LEU F . n F 1 16 ALA 16 16 16 ALA ALA F . n F 1 17 SER 17 17 17 SER SER F . n F 1 18 SER 18 18 18 SER SER F . n F 1 19 LEU 19 19 19 LEU LEU F . n F 1 20 ALA 20 20 20 ALA ALA F . n F 1 21 PHE 21 21 21 PHE PHE F . n F 1 22 TYR 22 22 22 TYR TYR F . n F 1 23 GLN 23 23 23 GLN GLN F . n F 1 24 GLN 24 24 24 GLN GLN F . n F 1 25 LEU 25 25 25 LEU LEU F . n F 1 26 PRO 26 26 26 PRO PRO F . n F 1 27 GLY 27 27 27 GLY GLY F . n F 1 28 MET 28 28 28 MET MET F . n F 1 29 ARG 29 29 29 ARG ARG F . n F 1 30 LEU 30 30 30 LEU LEU F . n F 1 31 HIS 31 31 31 HIS HIS F . n F 1 32 ALA 32 32 32 ALA ALA F . n F 1 33 SER 33 33 33 SER SER F . n F 1 34 TRP 34 34 34 TRP TRP F . n F 1 35 ASP 35 35 35 ASP ASP F . n F 1 36 SER 36 36 36 SER SER F . n F 1 37 GLY 37 37 37 GLY GLY F . n F 1 38 ALA 38 38 38 ALA ALA F . n F 1 39 TYR 39 39 39 TYR TYR F . n F 1 40 LEU 40 40 40 LEU LEU F . n F 1 41 SER 41 41 41 SER SER F . n F 1 42 CYS 42 42 42 CYS CYS F . n F 1 43 GLY 43 43 43 GLY GLY F . n F 1 44 ALA 44 44 44 ALA ALA F . n F 1 45 LEU 45 45 45 LEU LEU F . n F 1 46 TRP 46 46 46 TRP TRP F . n F 1 47 LEU 47 47 47 LEU LEU F . n F 1 48 CYS 48 48 48 CYS CYS F . n F 1 49 LEU 49 49 49 LEU LEU F . n F 1 50 SER 50 50 50 SER SER F . n F 1 51 LEU 51 51 51 LEU LEU F . n F 1 52 ASP 52 52 52 ASP ASP F . n F 1 53 GLU 53 53 53 GLU GLU F . n F 1 54 GLN 54 54 54 GLN GLN F . n F 1 55 ARG 55 55 55 ARG ARG F . n F 1 56 ARG 56 56 56 ARG ARG F . n F 1 57 LYS 57 57 57 LYS LYS F . n F 1 58 THR 58 58 58 THR THR F . n F 1 59 PRO 59 59 59 PRO PRO F . n F 1 60 PRO 60 60 60 PRO PRO F . n F 1 61 GLN 61 61 61 GLN GLN F . n F 1 62 GLU 62 62 62 GLU GLU F . n F 1 63 SER 63 63 63 SER SER F . n F 1 64 ASP 64 64 64 ASP ASP F . n F 1 65 TYR 65 65 65 TYR TYR F . n F 1 66 THR 66 66 66 THR THR F . n F 1 67 HIS 67 67 67 HIS HIS F . n F 1 68 TYR 68 68 68 TYR TYR F . n F 1 69 ALA 69 69 69 ALA ALA F . n F 1 70 PHE 70 70 70 PHE PHE F . n F 1 71 SER 71 71 71 SER SER F . n F 1 72 VAL 72 72 72 VAL VAL F . n F 1 73 ALA 73 73 73 ALA ALA F . n F 1 74 GLU 74 74 74 GLU GLU F . n F 1 75 GLU 75 75 75 GLU GLU F . n F 1 76 GLU 76 76 76 GLU GLU F . n F 1 77 PHE 77 77 77 PHE PHE F . n F 1 78 ALA 78 78 78 ALA ALA F . n F 1 79 GLY 79 79 79 GLY GLY F . n F 1 80 VAL 80 80 80 VAL VAL F . n F 1 81 VAL 81 81 81 VAL VAL F . n F 1 82 ALA 82 82 82 ALA ALA F . n F 1 83 LEU 83 83 83 LEU LEU F . n F 1 84 LEU 84 84 84 LEU LEU F . n F 1 85 ALA 85 85 85 ALA ALA F . n F 1 86 GLN 86 86 86 GLN GLN F . n F 1 87 ALA 87 87 87 ALA ALA F . n F 1 88 GLY 88 88 88 GLY GLY F . n F 1 89 ALA 89 89 89 ALA ALA F . n F 1 90 GLU 90 90 90 GLU GLU F . n F 1 91 VAL 91 91 91 VAL VAL F . n F 1 92 TRP 92 92 92 TRP TRP F . n F 1 93 LYS 93 93 93 LYS LYS F . n F 1 94 ASP 94 94 94 ASP ASP F . n F 1 95 ASN 95 95 95 ASN ASN F . n F 1 96 ARG 96 96 ? ? ? F . n F 1 97 SER 97 97 ? ? ? F . n F 1 98 GLU 98 98 ? ? ? F . n F 1 99 GLY 99 99 ? ? ? F . n F 1 100 ALA 100 100 100 ALA ALA F . n F 1 101 SER 101 101 101 SER SER F . n F 1 102 TYR 102 102 102 TYR TYR F . n F 1 103 TYR 103 103 103 TYR TYR F . n F 1 104 PHE 104 104 104 PHE PHE F . n F 1 105 LEU 105 105 105 LEU LEU F . n F 1 106 ASP 106 106 106 ASP ASP F . n F 1 107 PRO 107 107 107 PRO PRO F . n F 1 108 ASP 108 108 108 ASP ASP F . n F 1 109 GLY 109 109 109 GLY GLY F . n F 1 110 HIS 110 110 110 HIS HIS F . n F 1 111 LYS 111 111 111 LYS LYS F . n F 1 112 LEU 112 112 112 LEU LEU F . n F 1 113 GLU 113 113 113 GLU GLU F . n F 1 114 LEU 114 114 114 LEU LEU F . n F 1 115 HIS 115 115 115 HIS HIS F . n F 1 116 VAL 116 116 116 VAL VAL F . n F 1 117 GLY 117 117 117 GLY GLY F . n F 1 118 ASN 118 118 118 ASN ASN F . n F 1 119 LEU 119 119 119 LEU LEU F . n F 1 120 ALA 120 120 120 ALA ALA F . n F 1 121 GLN 121 121 121 GLN GLN F . n F 1 122 ARG 122 122 122 ARG ARG F . n F 1 123 LEU 123 123 123 LEU LEU F . n F 1 124 ALA 124 124 124 ALA ALA F . n F 1 125 ALA 125 125 125 ALA ALA F . n F 1 126 CYS 126 126 126 CYS CYS F . n F 1 127 ARG 127 127 127 ARG ARG F . n F 1 128 GLU 128 128 128 GLU GLU F . n F 1 129 ARG 129 129 129 ARG ARG F . n F 1 130 PRO 130 130 130 PRO PRO F . n F 1 131 TYR 131 131 131 TYR TYR F . n F 1 132 LYS 132 132 132 LYS LYS F . n F 1 133 GLY 133 133 133 GLY GLY F . n F 1 134 MET 134 134 134 MET MET F . n F 1 135 VAL 135 135 135 VAL VAL F . n F 1 136 PHE 136 136 136 PHE PHE F . n F 1 137 PHE 137 137 137 PHE PHE F . n F 1 138 ASP 138 138 138 ASP ASP F . n F 1 139 HIS 139 139 139 HIS HIS F . n F 1 140 HIS 140 140 140 HIS HIS F . n F 1 141 HIS 141 141 141 HIS HIS F . n F 1 142 HIS 142 142 142 HIS HIS F . n F 1 143 HIS 143 143 143 HIS HIS F . n F 1 144 HIS 144 144 ? ? ? F . n G 1 1 MET 1 1 1 MET MET G . n G 1 2 LEU 2 2 2 LEU LEU G . n G 1 3 GLN 3 3 3 GLN GLN G . n G 1 4 GLY 4 4 4 GLY GLY G . n G 1 5 LEU 5 5 5 LEU LEU G . n G 1 6 ASN 6 6 6 ASN ASN G . n G 1 7 HIS 7 7 7 HIS HIS G . n G 1 8 LEU 8 8 8 LEU LEU G . n G 1 9 THR 9 9 9 THR THR G . n G 1 10 LEU 10 10 10 LEU LEU G . n G 1 11 ALA 11 11 11 ALA ALA G . n G 1 12 VAL 12 12 12 VAL VAL G . n G 1 13 SER 13 13 13 SER SER G . n G 1 14 ASP 14 14 14 ASP ASP G . n G 1 15 LEU 15 15 15 LEU LEU G . n G 1 16 ALA 16 16 16 ALA ALA G . n G 1 17 SER 17 17 17 SER SER G . n G 1 18 SER 18 18 18 SER SER G . n G 1 19 LEU 19 19 19 LEU LEU G . n G 1 20 ALA 20 20 20 ALA ALA G . n G 1 21 PHE 21 21 21 PHE PHE G . n G 1 22 TYR 22 22 22 TYR TYR G . n G 1 23 GLN 23 23 23 GLN GLN G . n G 1 24 GLN 24 24 24 GLN GLN G . n G 1 25 LEU 25 25 25 LEU LEU G . n G 1 26 PRO 26 26 26 PRO PRO G . n G 1 27 GLY 27 27 27 GLY GLY G . n G 1 28 MET 28 28 28 MET MET G . n G 1 29 ARG 29 29 29 ARG ARG G . n G 1 30 LEU 30 30 30 LEU LEU G . n G 1 31 HIS 31 31 31 HIS HIS G . n G 1 32 ALA 32 32 32 ALA ALA G . n G 1 33 SER 33 33 33 SER SER G . n G 1 34 TRP 34 34 34 TRP TRP G . n G 1 35 ASP 35 35 35 ASP ASP G . n G 1 36 SER 36 36 36 SER SER G . n G 1 37 GLY 37 37 37 GLY GLY G . n G 1 38 ALA 38 38 38 ALA ALA G . n G 1 39 TYR 39 39 39 TYR TYR G . n G 1 40 LEU 40 40 40 LEU LEU G . n G 1 41 SER 41 41 41 SER SER G . n G 1 42 CYS 42 42 42 CYS CYS G . n G 1 43 GLY 43 43 43 GLY GLY G . n G 1 44 ALA 44 44 44 ALA ALA G . n G 1 45 LEU 45 45 45 LEU LEU G . n G 1 46 TRP 46 46 46 TRP TRP G . n G 1 47 LEU 47 47 47 LEU LEU G . n G 1 48 CYS 48 48 48 CYS CYS G . n G 1 49 LEU 49 49 49 LEU LEU G . n G 1 50 SER 50 50 50 SER SER G . n G 1 51 LEU 51 51 51 LEU LEU G . n G 1 52 ASP 52 52 52 ASP ASP G . n G 1 53 GLU 53 53 53 GLU GLU G . n G 1 54 GLN 54 54 54 GLN GLN G . n G 1 55 ARG 55 55 55 ARG ARG G . n G 1 56 ARG 56 56 56 ARG ARG G . n G 1 57 LYS 57 57 57 LYS LYS G . n G 1 58 THR 58 58 58 THR THR G . n G 1 59 PRO 59 59 59 PRO PRO G . n G 1 60 PRO 60 60 60 PRO PRO G . n G 1 61 GLN 61 61 61 GLN GLN G . n G 1 62 GLU 62 62 62 GLU GLU G . n G 1 63 SER 63 63 63 SER SER G . n G 1 64 ASP 64 64 64 ASP ASP G . n G 1 65 TYR 65 65 65 TYR TYR G . n G 1 66 THR 66 66 66 THR THR G . n G 1 67 HIS 67 67 67 HIS HIS G . n G 1 68 TYR 68 68 68 TYR TYR G . n G 1 69 ALA 69 69 69 ALA ALA G . n G 1 70 PHE 70 70 70 PHE PHE G . n G 1 71 SER 71 71 71 SER SER G . n G 1 72 VAL 72 72 72 VAL VAL G . n G 1 73 ALA 73 73 73 ALA ALA G . n G 1 74 GLU 74 74 74 GLU GLU G . n G 1 75 GLU 75 75 75 GLU GLU G . n G 1 76 GLU 76 76 76 GLU GLU G . n G 1 77 PHE 77 77 77 PHE PHE G . n G 1 78 ALA 78 78 78 ALA ALA G . n G 1 79 GLY 79 79 79 GLY GLY G . n G 1 80 VAL 80 80 80 VAL VAL G . n G 1 81 VAL 81 81 81 VAL VAL G . n G 1 82 ALA 82 82 82 ALA ALA G . n G 1 83 LEU 83 83 83 LEU LEU G . n G 1 84 LEU 84 84 84 LEU LEU G . n G 1 85 ALA 85 85 85 ALA ALA G . n G 1 86 GLN 86 86 86 GLN GLN G . n G 1 87 ALA 87 87 87 ALA ALA G . n G 1 88 GLY 88 88 88 GLY GLY G . n G 1 89 ALA 89 89 89 ALA ALA G . n G 1 90 GLU 90 90 90 GLU GLU G . n G 1 91 VAL 91 91 91 VAL VAL G . n G 1 92 TRP 92 92 92 TRP TRP G . n G 1 93 LYS 93 93 93 LYS LYS G . n G 1 94 ASP 94 94 94 ASP ASP G . n G 1 95 ASN 95 95 ? ? ? G . n G 1 96 ARG 96 96 ? ? ? G . n G 1 97 SER 97 97 ? ? ? G . n G 1 98 GLU 98 98 ? ? ? G . n G 1 99 GLY 99 99 ? ? ? G . n G 1 100 ALA 100 100 100 ALA ALA G . n G 1 101 SER 101 101 101 SER SER G . n G 1 102 TYR 102 102 102 TYR TYR G . n G 1 103 TYR 103 103 103 TYR TYR G . n G 1 104 PHE 104 104 104 PHE PHE G . n G 1 105 LEU 105 105 105 LEU LEU G . n G 1 106 ASP 106 106 106 ASP ASP G . n G 1 107 PRO 107 107 107 PRO PRO G . n G 1 108 ASP 108 108 108 ASP ASP G . n G 1 109 GLY 109 109 109 GLY GLY G . n G 1 110 HIS 110 110 110 HIS HIS G . n G 1 111 LYS 111 111 111 LYS LYS G . n G 1 112 LEU 112 112 112 LEU LEU G . n G 1 113 GLU 113 113 113 GLU GLU G . n G 1 114 LEU 114 114 114 LEU LEU G . n G 1 115 HIS 115 115 115 HIS HIS G . n G 1 116 VAL 116 116 116 VAL VAL G . n G 1 117 GLY 117 117 117 GLY GLY G . n G 1 118 ASN 118 118 118 ASN ASN G . n G 1 119 LEU 119 119 119 LEU LEU G . n G 1 120 ALA 120 120 120 ALA ALA G . n G 1 121 GLN 121 121 121 GLN GLN G . n G 1 122 ARG 122 122 122 ARG ARG G . n G 1 123 LEU 123 123 123 LEU LEU G . n G 1 124 ALA 124 124 124 ALA ALA G . n G 1 125 ALA 125 125 125 ALA ALA G . n G 1 126 CYS 126 126 126 CYS CYS G . n G 1 127 ARG 127 127 127 ARG ARG G . n G 1 128 GLU 128 128 128 GLU GLU G . n G 1 129 ARG 129 129 129 ARG ARG G . n G 1 130 PRO 130 130 130 PRO PRO G . n G 1 131 TYR 131 131 131 TYR TYR G . n G 1 132 LYS 132 132 132 LYS LYS G . n G 1 133 GLY 133 133 133 GLY GLY G . n G 1 134 MET 134 134 134 MET MET G . n G 1 135 VAL 135 135 135 VAL VAL G . n G 1 136 PHE 136 136 136 PHE PHE G . n G 1 137 PHE 137 137 137 PHE PHE G . n G 1 138 ASP 138 138 ? ? ? G . n G 1 139 HIS 139 139 ? ? ? G . n G 1 140 HIS 140 140 ? ? ? G . n G 1 141 HIS 141 141 ? ? ? G . n G 1 142 HIS 142 142 ? ? ? G . n G 1 143 HIS 143 143 ? ? ? G . n G 1 144 HIS 144 144 ? ? ? G . n H 1 1 MET 1 1 1 MET MET H . n H 1 2 LEU 2 2 2 LEU LEU H . n H 1 3 GLN 3 3 3 GLN GLN H . n H 1 4 GLY 4 4 4 GLY GLY H . n H 1 5 LEU 5 5 5 LEU LEU H . n H 1 6 ASN 6 6 6 ASN ASN H . n H 1 7 HIS 7 7 7 HIS HIS H . n H 1 8 LEU 8 8 8 LEU LEU H . n H 1 9 THR 9 9 9 THR THR H . n H 1 10 LEU 10 10 10 LEU LEU H . n H 1 11 ALA 11 11 11 ALA ALA H . n H 1 12 VAL 12 12 12 VAL VAL H . n H 1 13 SER 13 13 13 SER SER H . n H 1 14 ASP 14 14 14 ASP ASP H . n H 1 15 LEU 15 15 15 LEU LEU H . n H 1 16 ALA 16 16 16 ALA ALA H . n H 1 17 SER 17 17 17 SER SER H . n H 1 18 SER 18 18 18 SER SER H . n H 1 19 LEU 19 19 19 LEU LEU H . n H 1 20 ALA 20 20 20 ALA ALA H . n H 1 21 PHE 21 21 21 PHE PHE H . n H 1 22 TYR 22 22 22 TYR TYR H . n H 1 23 GLN 23 23 23 GLN GLN H . n H 1 24 GLN 24 24 24 GLN GLN H . n H 1 25 LEU 25 25 25 LEU LEU H . n H 1 26 PRO 26 26 26 PRO PRO H . n H 1 27 GLY 27 27 27 GLY GLY H . n H 1 28 MET 28 28 28 MET MET H . n H 1 29 ARG 29 29 29 ARG ARG H . n H 1 30 LEU 30 30 30 LEU LEU H . n H 1 31 HIS 31 31 31 HIS HIS H . n H 1 32 ALA 32 32 32 ALA ALA H . n H 1 33 SER 33 33 33 SER SER H . n H 1 34 TRP 34 34 34 TRP TRP H . n H 1 35 ASP 35 35 35 ASP ASP H . n H 1 36 SER 36 36 36 SER SER H . n H 1 37 GLY 37 37 37 GLY GLY H . n H 1 38 ALA 38 38 38 ALA ALA H . n H 1 39 TYR 39 39 39 TYR TYR H . n H 1 40 LEU 40 40 40 LEU LEU H . n H 1 41 SER 41 41 41 SER SER H . n H 1 42 CYS 42 42 42 CYS CYS H . n H 1 43 GLY 43 43 43 GLY GLY H . n H 1 44 ALA 44 44 44 ALA ALA H . n H 1 45 LEU 45 45 45 LEU LEU H . n H 1 46 TRP 46 46 46 TRP TRP H . n H 1 47 LEU 47 47 47 LEU LEU H . n H 1 48 CYS 48 48 48 CYS CYS H . n H 1 49 LEU 49 49 49 LEU LEU H . n H 1 50 SER 50 50 50 SER SER H . n H 1 51 LEU 51 51 51 LEU LEU H . n H 1 52 ASP 52 52 52 ASP ASP H . n H 1 53 GLU 53 53 53 GLU GLU H . n H 1 54 GLN 54 54 54 GLN GLN H . n H 1 55 ARG 55 55 55 ARG ARG H . n H 1 56 ARG 56 56 56 ARG ARG H . n H 1 57 LYS 57 57 57 LYS LYS H . n H 1 58 THR 58 58 58 THR THR H . n H 1 59 PRO 59 59 59 PRO PRO H . n H 1 60 PRO 60 60 60 PRO PRO H . n H 1 61 GLN 61 61 61 GLN GLN H . n H 1 62 GLU 62 62 62 GLU GLU H . n H 1 63 SER 63 63 63 SER SER H . n H 1 64 ASP 64 64 64 ASP ASP H . n H 1 65 TYR 65 65 65 TYR TYR H . n H 1 66 THR 66 66 66 THR THR H . n H 1 67 HIS 67 67 67 HIS HIS H . n H 1 68 TYR 68 68 68 TYR TYR H . n H 1 69 ALA 69 69 69 ALA ALA H . n H 1 70 PHE 70 70 70 PHE PHE H . n H 1 71 SER 71 71 71 SER SER H . n H 1 72 VAL 72 72 72 VAL VAL H . n H 1 73 ALA 73 73 73 ALA ALA H . n H 1 74 GLU 74 74 74 GLU GLU H . n H 1 75 GLU 75 75 75 GLU GLU H . n H 1 76 GLU 76 76 76 GLU GLU H . n H 1 77 PHE 77 77 77 PHE PHE H . n H 1 78 ALA 78 78 78 ALA ALA H . n H 1 79 GLY 79 79 79 GLY GLY H . n H 1 80 VAL 80 80 80 VAL VAL H . n H 1 81 VAL 81 81 81 VAL VAL H . n H 1 82 ALA 82 82 82 ALA ALA H . n H 1 83 LEU 83 83 83 LEU LEU H . n H 1 84 LEU 84 84 84 LEU LEU H . n H 1 85 ALA 85 85 85 ALA ALA H . n H 1 86 GLN 86 86 86 GLN GLN H . n H 1 87 ALA 87 87 87 ALA ALA H . n H 1 88 GLY 88 88 88 GLY GLY H . n H 1 89 ALA 89 89 89 ALA ALA H . n H 1 90 GLU 90 90 90 GLU GLU H . n H 1 91 VAL 91 91 91 VAL VAL H . n H 1 92 TRP 92 92 92 TRP TRP H . n H 1 93 LYS 93 93 93 LYS LYS H . n H 1 94 ASP 94 94 94 ASP ASP H . n H 1 95 ASN 95 95 95 ASN ASN H . n H 1 96 ARG 96 96 ? ? ? H . n H 1 97 SER 97 97 ? ? ? H . n H 1 98 GLU 98 98 ? ? ? H . n H 1 99 GLY 99 99 99 GLY GLY H . n H 1 100 ALA 100 100 100 ALA ALA H . n H 1 101 SER 101 101 101 SER SER H . n H 1 102 TYR 102 102 102 TYR TYR H . n H 1 103 TYR 103 103 103 TYR TYR H . n H 1 104 PHE 104 104 104 PHE PHE H . n H 1 105 LEU 105 105 105 LEU LEU H . n H 1 106 ASP 106 106 106 ASP ASP H . n H 1 107 PRO 107 107 107 PRO PRO H . n H 1 108 ASP 108 108 108 ASP ASP H . n H 1 109 GLY 109 109 109 GLY GLY H . n H 1 110 HIS 110 110 110 HIS HIS H . n H 1 111 LYS 111 111 111 LYS LYS H . n H 1 112 LEU 112 112 112 LEU LEU H . n H 1 113 GLU 113 113 113 GLU GLU H . n H 1 114 LEU 114 114 114 LEU LEU H . n H 1 115 HIS 115 115 115 HIS HIS H . n H 1 116 VAL 116 116 116 VAL VAL H . n H 1 117 GLY 117 117 117 GLY GLY H . n H 1 118 ASN 118 118 118 ASN ASN H . n H 1 119 LEU 119 119 119 LEU LEU H . n H 1 120 ALA 120 120 120 ALA ALA H . n H 1 121 GLN 121 121 121 GLN GLN H . n H 1 122 ARG 122 122 122 ARG ARG H . n H 1 123 LEU 123 123 123 LEU LEU H . n H 1 124 ALA 124 124 124 ALA ALA H . n H 1 125 ALA 125 125 125 ALA ALA H . n H 1 126 CYS 126 126 126 CYS CYS H . n H 1 127 ARG 127 127 127 ARG ARG H . n H 1 128 GLU 128 128 128 GLU GLU H . n H 1 129 ARG 129 129 129 ARG ARG H . n H 1 130 PRO 130 130 130 PRO PRO H . n H 1 131 TYR 131 131 131 TYR TYR H . n H 1 132 LYS 132 132 132 LYS LYS H . n H 1 133 GLY 133 133 133 GLY GLY H . n H 1 134 MET 134 134 134 MET MET H . n H 1 135 VAL 135 135 135 VAL VAL H . n H 1 136 PHE 136 136 136 PHE PHE H . n H 1 137 PHE 137 137 137 PHE PHE H . n H 1 138 ASP 138 138 138 ASP ASP H . n H 1 139 HIS 139 139 139 HIS HIS H . n H 1 140 HIS 140 140 140 HIS HIS H . n H 1 141 HIS 141 141 141 HIS HIS H . n H 1 142 HIS 142 142 142 HIS HIS H . n H 1 143 HIS 143 143 143 HIS HIS H . n H 1 144 HIS 144 144 ? ? ? H . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code I 2 MN 1 201 1 MN MN A . J 3 NI 1 202 1 NI NI A . K 3 NI 1 203 2 NI NI A . L 2 MN 1 201 2 MN MN B . M 2 MN 1 201 3 MN MN C . N 3 NI 1 202 3 NI NI C . O 3 NI 1 203 4 NI NI C . P 2 MN 1 201 4 MN MN D . Q 2 MN 1 201 5 MN MN E . R 2 MN 1 201 6 MN MN F . S 3 NI 1 202 5 NI NI F . T 2 MN 1 201 7 MN MN G . U 2 MN 1 201 8 MN MN H . V 3 NI 1 202 6 NI NI H . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA dimeric 2 2 author_and_software_defined_assembly PISA dimeric 2 3 author_and_software_defined_assembly PISA dimeric 2 4 author_and_software_defined_assembly PISA dimeric 2 5 software_defined_assembly PISA tetrameric 4 6 software_defined_assembly PISA tetrameric 4 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,I,J,K,L 2 1 C,D,M,N,O,P 3 1 E,F,Q,R,S 4 1 G,H,T,U,V 5 1 A,B,C,D,I,J,K,L,M,N,O,P 6 1 E,F,G,H,Q,R,S,T,U,V # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5990 ? 1 MORE -50 ? 1 'SSA (A^2)' 13090 ? 2 'ABSA (A^2)' 5840 ? 2 MORE -53 ? 2 'SSA (A^2)' 13200 ? 3 'ABSA (A^2)' 5870 ? 3 MORE -48 ? 3 'SSA (A^2)' 13040 ? 4 'ABSA (A^2)' 5950 ? 4 MORE -50 ? 4 'SSA (A^2)' 13020 ? 5 'ABSA (A^2)' 14420 ? 5 MORE -116 ? 5 'SSA (A^2)' 23710 ? 6 'ABSA (A^2)' 14070 ? 6 MORE -109 ? 6 'SSA (A^2)' 23810 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 7 ? A HIS 7 ? 1_555 MN ? L MN . ? B MN 201 ? 1_555 NE2 ? B HIS 67 ? B HIS 67 ? 1_555 91.9 ? 2 NE2 ? A HIS 7 ? A HIS 7 ? 1_555 MN ? L MN . ? B MN 201 ? 1_555 OE1 ? B GLU 113 ? B GLU 113 ? 1_555 94.9 ? 3 NE2 ? B HIS 67 ? B HIS 67 ? 1_555 MN ? L MN . ? B MN 201 ? 1_555 OE1 ? B GLU 113 ? B GLU 113 ? 1_555 86.7 ? 4 NE2 ? A HIS 67 ? A HIS 67 ? 1_555 MN ? I MN . ? A MN 201 ? 1_555 OE1 ? A GLU 113 ? A GLU 113 ? 1_555 86.9 ? 5 NE2 ? A HIS 67 ? A HIS 67 ? 1_555 MN ? I MN . ? A MN 201 ? 1_555 NE2 ? B HIS 7 ? B HIS 7 ? 1_555 92.8 ? 6 OE1 ? A GLU 113 ? A GLU 113 ? 1_555 MN ? I MN . ? A MN 201 ? 1_555 NE2 ? B HIS 7 ? B HIS 7 ? 1_555 98.5 ? 7 OE1 ? A GLU 128 ? A GLU 128 ? 1_555 NI ? K NI . ? A NI 203 ? 1_555 NE2 ? A HIS 142 ? A HIS 142 ? 1_555 69.9 ? 8 NE2 ? A HIS 139 ? A HIS 139 ? 1_555 NI ? J NI . ? A NI 202 ? 1_555 NE2 ? A HIS 141 ? A HIS 141 ? 1_555 91.6 ? 9 NE2 ? A HIS 139 ? A HIS 139 ? 1_555 NI ? J NI . ? A NI 202 ? 1_555 NE2 ? F HIS 139 ? F HIS 139 ? 1_555 96.8 ? 10 NE2 ? A HIS 141 ? A HIS 141 ? 1_555 NI ? J NI . ? A NI 202 ? 1_555 NE2 ? F HIS 139 ? F HIS 139 ? 1_555 166.0 ? 11 NE2 ? A HIS 139 ? A HIS 139 ? 1_555 NI ? J NI . ? A NI 202 ? 1_555 NE2 ? F HIS 141 ? F HIS 141 ? 1_555 156.8 ? 12 NE2 ? A HIS 141 ? A HIS 141 ? 1_555 NI ? J NI . ? A NI 202 ? 1_555 NE2 ? F HIS 141 ? F HIS 141 ? 1_555 78.7 ? 13 NE2 ? F HIS 139 ? F HIS 139 ? 1_555 NI ? J NI . ? A NI 202 ? 1_555 NE2 ? F HIS 141 ? F HIS 141 ? 1_555 89.3 ? 14 NE2 ? C HIS 7 ? C HIS 7 ? 1_555 MN ? P MN . ? D MN 201 ? 1_555 NE2 ? D HIS 67 ? D HIS 67 ? 1_555 98.6 ? 15 NE2 ? C HIS 7 ? C HIS 7 ? 1_555 MN ? P MN . ? D MN 201 ? 1_555 OE1 ? D GLU 113 ? D GLU 113 ? 1_555 100.1 ? 16 NE2 ? D HIS 67 ? D HIS 67 ? 1_555 MN ? P MN . ? D MN 201 ? 1_555 OE1 ? D GLU 113 ? D GLU 113 ? 1_555 87.4 ? 17 NE2 ? C HIS 67 ? C HIS 67 ? 1_555 MN ? M MN . ? C MN 201 ? 1_555 OE1 ? C GLU 113 ? C GLU 113 ? 1_555 92.7 ? 18 NE2 ? C HIS 67 ? C HIS 67 ? 1_555 MN ? M MN . ? C MN 201 ? 1_555 NE2 ? D HIS 7 ? D HIS 7 ? 1_555 94.3 ? 19 OE1 ? C GLU 113 ? C GLU 113 ? 1_555 MN ? M MN . ? C MN 201 ? 1_555 NE2 ? D HIS 7 ? D HIS 7 ? 1_555 96.7 ? 20 OE1 ? C GLU 128 ? C GLU 128 ? 1_555 NI ? O NI . ? C NI 203 ? 1_555 NE2 ? C HIS 142 ? C HIS 142 ? 1_555 86.9 ? 21 NE2 ? C HIS 139 ? C HIS 139 ? 1_555 NI ? N NI . ? C NI 202 ? 1_555 NE2 ? C HIS 141 ? C HIS 141 ? 1_555 86.6 ? 22 NE2 ? C HIS 139 ? C HIS 139 ? 1_555 NI ? N NI . ? C NI 202 ? 1_555 NE2 ? H HIS 139 ? H HIS 139 ? 1_555 98.8 ? 23 NE2 ? C HIS 141 ? C HIS 141 ? 1_555 NI ? N NI . ? C NI 202 ? 1_555 NE2 ? H HIS 139 ? H HIS 139 ? 1_555 169.1 ? 24 NE2 ? C HIS 139 ? C HIS 139 ? 1_555 NI ? N NI . ? C NI 202 ? 1_555 NE2 ? H HIS 141 ? H HIS 141 ? 1_555 167.8 ? 25 NE2 ? C HIS 141 ? C HIS 141 ? 1_555 NI ? N NI . ? C NI 202 ? 1_555 NE2 ? H HIS 141 ? H HIS 141 ? 1_555 81.9 ? 26 NE2 ? H HIS 139 ? H HIS 139 ? 1_555 NI ? N NI . ? C NI 202 ? 1_555 NE2 ? H HIS 141 ? H HIS 141 ? 1_555 91.9 ? 27 NE2 ? E HIS 7 ? E HIS 7 ? 1_555 MN ? R MN . ? F MN 201 ? 1_555 NE2 ? F HIS 67 ? F HIS 67 ? 1_555 96.5 ? 28 NE2 ? E HIS 7 ? E HIS 7 ? 1_555 MN ? R MN . ? F MN 201 ? 1_555 OE1 ? F GLU 113 ? F GLU 113 ? 1_555 96.8 ? 29 NE2 ? F HIS 67 ? F HIS 67 ? 1_555 MN ? R MN . ? F MN 201 ? 1_555 OE1 ? F GLU 113 ? F GLU 113 ? 1_555 88.5 ? 30 NE2 ? E HIS 67 ? E HIS 67 ? 1_555 MN ? Q MN . ? E MN 201 ? 1_555 OE1 ? E GLU 113 ? E GLU 113 ? 1_555 81.0 ? 31 NE2 ? E HIS 67 ? E HIS 67 ? 1_555 MN ? Q MN . ? E MN 201 ? 1_555 NE2 ? F HIS 7 ? F HIS 7 ? 1_555 96.0 ? 32 OE1 ? E GLU 113 ? E GLU 113 ? 1_555 MN ? Q MN . ? E MN 201 ? 1_555 NE2 ? F HIS 7 ? F HIS 7 ? 1_555 93.2 ? 33 OE1 ? F GLU 128 ? F GLU 128 ? 1_555 NI ? S NI . ? F NI 202 ? 1_555 NE2 ? F HIS 142 ? F HIS 142 ? 1_555 80.7 ? 34 NE2 ? G HIS 7 ? G HIS 7 ? 1_555 MN ? U MN . ? H MN 201 ? 1_555 NE2 ? H HIS 67 ? H HIS 67 ? 1_555 87.9 ? 35 NE2 ? G HIS 7 ? G HIS 7 ? 1_555 MN ? U MN . ? H MN 201 ? 1_555 OE1 ? H GLU 113 ? H GLU 113 ? 1_555 93.7 ? 36 NE2 ? H HIS 67 ? H HIS 67 ? 1_555 MN ? U MN . ? H MN 201 ? 1_555 OE1 ? H GLU 113 ? H GLU 113 ? 1_555 90.6 ? 37 NE2 ? G HIS 67 ? G HIS 67 ? 1_555 MN ? T MN . ? G MN 201 ? 1_555 OE1 ? G GLU 113 ? G GLU 113 ? 1_555 89.2 ? 38 NE2 ? G HIS 67 ? G HIS 67 ? 1_555 MN ? T MN . ? G MN 201 ? 1_555 NE2 ? H HIS 7 ? H HIS 7 ? 1_555 91.0 ? 39 OE1 ? G GLU 113 ? G GLU 113 ? 1_555 MN ? T MN . ? G MN 201 ? 1_555 NE2 ? H HIS 7 ? H HIS 7 ? 1_555 96.8 ? 40 OE1 ? H GLU 128 ? H GLU 128 ? 1_555 NI ? V NI . ? H NI 202 ? 1_555 NE2 ? H HIS 142 ? H HIS 142 ? 1_555 82.6 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-08-30 2 'Structure model' 1 1 2017-09-20 3 'Structure model' 1 2 2017-11-08 4 'Structure model' 1 3 2023-10-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' database_2 8 4 'Structure model' pdbx_initial_refinement_model 9 4 'Structure model' struct_conn 10 4 'Structure model' struct_ncs_dom_lim # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation_author.name' 10 3 'Structure model' '_citation.journal_volume' 11 3 'Structure model' '_citation.title' 12 3 'Structure model' '_citation_author.name' 13 4 'Structure model' '_database_2.pdbx_DOI' 14 4 'Structure model' '_database_2.pdbx_database_accession' 15 4 'Structure model' '_struct_conn.pdbx_dist_value' 16 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 17 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 18 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 23 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 24 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 25 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 28 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 29 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 30 4 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id' 31 4 'Structure model' '_struct_ncs_dom_lim.beg_label_asym_id' 32 4 'Structure model' '_struct_ncs_dom_lim.beg_label_comp_id' 33 4 'Structure model' '_struct_ncs_dom_lim.beg_label_seq_id' 34 4 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id' 35 4 'Structure model' '_struct_ncs_dom_lim.end_label_asym_id' 36 4 'Structure model' '_struct_ncs_dom_lim.end_label_comp_id' 37 4 'Structure model' '_struct_ncs_dom_lim.end_label_seq_id' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.10.1_2155 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O B GLU 53 ? ? NH2 B ARG 56 ? ? 2.09 2 1 OE2 C GLU 98 ? ? N C SER 101 ? ? 2.15 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 NE A ARG 56 ? ? CZ A ARG 56 ? ? 1.223 1.326 -0.103 0.013 N 2 1 CZ A ARG 56 ? ? NH1 A ARG 56 ? ? 1.223 1.326 -0.103 0.013 N 3 1 CZ A ARG 56 ? ? NH2 A ARG 56 ? ? 1.244 1.326 -0.082 0.013 N 4 1 CD E LYS 132 ? ? CE E LYS 132 ? ? 1.358 1.508 -0.150 0.025 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA E LYS 132 ? ? CB E LYS 132 ? ? CG E LYS 132 ? ? 135.82 113.40 22.42 2.20 N 2 1 CB E LYS 132 ? ? CG E LYS 132 ? ? CD E LYS 132 ? ? 131.58 111.60 19.98 2.60 N 3 1 CG F ARG 129 ? ? CD F ARG 129 ? ? NE F ARG 129 ? ? 125.79 111.80 13.99 2.10 N 4 1 CA H LEU 19 ? ? CB H LEU 19 ? ? CG H LEU 19 ? ? 97.78 115.30 -17.52 2.30 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 54 ? ? -75.97 27.71 2 1 ARG B 129 ? ? -157.56 83.93 3 1 GLN C 54 ? ? -87.44 47.63 4 1 LYS C 57 ? ? -65.82 90.74 5 1 SER C 97 ? ? -162.51 92.61 6 1 GLU C 98 ? ? -151.27 -9.04 7 1 GLN D 54 ? ? -79.48 46.01 8 1 ASN D 118 ? ? -110.33 -169.64 9 1 LYS E 57 ? ? -56.61 96.79 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 132 ? CG ? A LYS 132 CG 2 1 Y 1 A LYS 132 ? CD ? A LYS 132 CD 3 1 Y 1 A LYS 132 ? CE ? A LYS 132 CE 4 1 Y 1 A LYS 132 ? NZ ? A LYS 132 NZ 5 1 Y 1 C GLN 54 ? CG ? C GLN 54 CG 6 1 Y 1 C GLN 54 ? CD ? C GLN 54 CD 7 1 Y 1 C GLN 54 ? OE1 ? C GLN 54 OE1 8 1 Y 1 C GLN 54 ? NE2 ? C GLN 54 NE2 9 1 Y 1 C LYS 57 ? CG ? C LYS 57 CG 10 1 Y 1 C LYS 57 ? CD ? C LYS 57 CD 11 1 Y 1 C LYS 57 ? CE ? C LYS 57 CE 12 1 Y 1 C LYS 57 ? NZ ? C LYS 57 NZ 13 1 Y 1 C GLU 62 ? CG ? C GLU 62 CG 14 1 Y 1 C GLU 62 ? CD ? C GLU 62 CD 15 1 Y 1 C GLU 62 ? OE1 ? C GLU 62 OE1 16 1 Y 1 C GLU 62 ? OE2 ? C GLU 62 OE2 17 1 Y 1 C LYS 132 ? CG ? C LYS 132 CG 18 1 Y 1 C LYS 132 ? CD ? C LYS 132 CD 19 1 Y 1 C LYS 132 ? CE ? C LYS 132 CE 20 1 Y 1 C LYS 132 ? NZ ? C LYS 132 NZ 21 1 Y 1 E ARG 56 ? CG ? E ARG 56 CG 22 1 Y 1 E ARG 56 ? CD ? E ARG 56 CD 23 1 Y 1 E ARG 56 ? NE ? E ARG 56 NE 24 1 Y 1 E ARG 56 ? CZ ? E ARG 56 CZ 25 1 Y 1 E ARG 56 ? NH1 ? E ARG 56 NH1 26 1 Y 1 E ARG 56 ? NH2 ? E ARG 56 NH2 27 1 Y 1 E LYS 57 ? CG ? E LYS 57 CG 28 1 Y 1 E LYS 57 ? CD ? E LYS 57 CD 29 1 Y 1 E LYS 57 ? CE ? E LYS 57 CE 30 1 Y 1 E LYS 57 ? NZ ? E LYS 57 NZ 31 1 Y 1 F GLU 53 ? CG ? F GLU 53 CG 32 1 Y 1 F GLU 53 ? CD ? F GLU 53 CD 33 1 Y 1 F GLU 53 ? OE1 ? F GLU 53 OE1 34 1 Y 1 F GLU 53 ? OE2 ? F GLU 53 OE2 35 1 Y 1 G ARG 56 ? CG ? G ARG 56 CG 36 1 Y 1 G ARG 56 ? CD ? G ARG 56 CD 37 1 Y 1 G ARG 56 ? NE ? G ARG 56 NE 38 1 Y 1 G ARG 56 ? CZ ? G ARG 56 CZ 39 1 Y 1 G ARG 56 ? NH1 ? G ARG 56 NH1 40 1 Y 1 G ARG 56 ? NH2 ? G ARG 56 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ARG 96 ? A ARG 96 2 1 Y 1 A SER 97 ? A SER 97 3 1 Y 1 A GLU 98 ? A GLU 98 4 1 Y 1 A GLY 99 ? A GLY 99 5 1 Y 1 A HIS 144 ? A HIS 144 6 1 Y 1 B ASN 95 ? B ASN 95 7 1 Y 1 B ARG 96 ? B ARG 96 8 1 Y 1 B SER 97 ? B SER 97 9 1 Y 1 B GLU 98 ? B GLU 98 10 1 Y 1 B GLY 99 ? B GLY 99 11 1 Y 1 B HIS 139 ? B HIS 139 12 1 Y 1 B HIS 140 ? B HIS 140 13 1 Y 1 B HIS 141 ? B HIS 141 14 1 Y 1 B HIS 142 ? B HIS 142 15 1 Y 1 B HIS 143 ? B HIS 143 16 1 Y 1 B HIS 144 ? B HIS 144 17 1 Y 1 C HIS 144 ? C HIS 144 18 1 Y 1 D ASN 95 ? D ASN 95 19 1 Y 1 D ARG 96 ? D ARG 96 20 1 Y 1 D SER 97 ? D SER 97 21 1 Y 1 D GLU 98 ? D GLU 98 22 1 Y 1 D GLY 99 ? D GLY 99 23 1 Y 1 D ASP 138 ? D ASP 138 24 1 Y 1 D HIS 139 ? D HIS 139 25 1 Y 1 D HIS 140 ? D HIS 140 26 1 Y 1 D HIS 141 ? D HIS 141 27 1 Y 1 D HIS 142 ? D HIS 142 28 1 Y 1 D HIS 143 ? D HIS 143 29 1 Y 1 D HIS 144 ? D HIS 144 30 1 Y 1 E ASN 95 ? E ASN 95 31 1 Y 1 E ARG 96 ? E ARG 96 32 1 Y 1 E SER 97 ? E SER 97 33 1 Y 1 E GLU 98 ? E GLU 98 34 1 Y 1 E GLY 99 ? E GLY 99 35 1 Y 1 E HIS 139 ? E HIS 139 36 1 Y 1 E HIS 140 ? E HIS 140 37 1 Y 1 E HIS 141 ? E HIS 141 38 1 Y 1 E HIS 142 ? E HIS 142 39 1 Y 1 E HIS 143 ? E HIS 143 40 1 Y 1 E HIS 144 ? E HIS 144 41 1 Y 1 F ARG 96 ? F ARG 96 42 1 Y 1 F SER 97 ? F SER 97 43 1 Y 1 F GLU 98 ? F GLU 98 44 1 Y 1 F GLY 99 ? F GLY 99 45 1 Y 1 F HIS 144 ? F HIS 144 46 1 Y 1 G ASN 95 ? G ASN 95 47 1 Y 1 G ARG 96 ? G ARG 96 48 1 Y 1 G SER 97 ? G SER 97 49 1 Y 1 G GLU 98 ? G GLU 98 50 1 Y 1 G GLY 99 ? G GLY 99 51 1 Y 1 G ASP 138 ? G ASP 138 52 1 Y 1 G HIS 139 ? G HIS 139 53 1 Y 1 G HIS 140 ? G HIS 140 54 1 Y 1 G HIS 141 ? G HIS 141 55 1 Y 1 G HIS 142 ? G HIS 142 56 1 Y 1 G HIS 143 ? G HIS 143 57 1 Y 1 G HIS 144 ? G HIS 144 58 1 Y 1 H ARG 96 ? H ARG 96 59 1 Y 1 H SER 97 ? H SER 97 60 1 Y 1 H GLU 98 ? H GLU 98 61 1 Y 1 H HIS 144 ? H HIS 144 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 LEU N N N N 158 LEU CA C N S 159 LEU C C N N 160 LEU O O N N 161 LEU CB C N N 162 LEU CG C N N 163 LEU CD1 C N N 164 LEU CD2 C N N 165 LEU OXT O N N 166 LEU H H N N 167 LEU H2 H N N 168 LEU HA H N N 169 LEU HB2 H N N 170 LEU HB3 H N N 171 LEU HG H N N 172 LEU HD11 H N N 173 LEU HD12 H N N 174 LEU HD13 H N N 175 LEU HD21 H N N 176 LEU HD22 H N N 177 LEU HD23 H N N 178 LEU HXT H N N 179 LYS N N N N 180 LYS CA C N S 181 LYS C C N N 182 LYS O O N N 183 LYS CB C N N 184 LYS CG C N N 185 LYS CD C N N 186 LYS CE C N N 187 LYS NZ N N N 188 LYS OXT O N N 189 LYS H H N N 190 LYS H2 H N N 191 LYS HA H N N 192 LYS HB2 H N N 193 LYS HB3 H N N 194 LYS HG2 H N N 195 LYS HG3 H N N 196 LYS HD2 H N N 197 LYS HD3 H N N 198 LYS HE2 H N N 199 LYS HE3 H N N 200 LYS HZ1 H N N 201 LYS HZ2 H N N 202 LYS HZ3 H N N 203 LYS HXT H N N 204 MET N N N N 205 MET CA C N S 206 MET C C N N 207 MET O O N N 208 MET CB C N N 209 MET CG C N N 210 MET SD S N N 211 MET CE C N N 212 MET OXT O N N 213 MET H H N N 214 MET H2 H N N 215 MET HA H N N 216 MET HB2 H N N 217 MET HB3 H N N 218 MET HG2 H N N 219 MET HG3 H N N 220 MET HE1 H N N 221 MET HE2 H N N 222 MET HE3 H N N 223 MET HXT H N N 224 MN MN MN N N 225 NI NI NI N N 226 PHE N N N N 227 PHE CA C N S 228 PHE C C N N 229 PHE O O N N 230 PHE CB C N N 231 PHE CG C Y N 232 PHE CD1 C Y N 233 PHE CD2 C Y N 234 PHE CE1 C Y N 235 PHE CE2 C Y N 236 PHE CZ C Y N 237 PHE OXT O N N 238 PHE H H N N 239 PHE H2 H N N 240 PHE HA H N N 241 PHE HB2 H N N 242 PHE HB3 H N N 243 PHE HD1 H N N 244 PHE HD2 H N N 245 PHE HE1 H N N 246 PHE HE2 H N N 247 PHE HZ H N N 248 PHE HXT H N N 249 PRO N N N N 250 PRO CA C N S 251 PRO C C N N 252 PRO O O N N 253 PRO CB C N N 254 PRO CG C N N 255 PRO CD C N N 256 PRO OXT O N N 257 PRO H H N N 258 PRO HA H N N 259 PRO HB2 H N N 260 PRO HB3 H N N 261 PRO HG2 H N N 262 PRO HG3 H N N 263 PRO HD2 H N N 264 PRO HD3 H N N 265 PRO HXT H N N 266 SER N N N N 267 SER CA C N S 268 SER C C N N 269 SER O O N N 270 SER CB C N N 271 SER OG O N N 272 SER OXT O N N 273 SER H H N N 274 SER H2 H N N 275 SER HA H N N 276 SER HB2 H N N 277 SER HB3 H N N 278 SER HG H N N 279 SER HXT H N N 280 THR N N N N 281 THR CA C N S 282 THR C C N N 283 THR O O N N 284 THR CB C N R 285 THR OG1 O N N 286 THR CG2 C N N 287 THR OXT O N N 288 THR H H N N 289 THR H2 H N N 290 THR HA H N N 291 THR HB H N N 292 THR HG1 H N N 293 THR HG21 H N N 294 THR HG22 H N N 295 THR HG23 H N N 296 THR HXT H N N 297 TRP N N N N 298 TRP CA C N S 299 TRP C C N N 300 TRP O O N N 301 TRP CB C N N 302 TRP CG C Y N 303 TRP CD1 C Y N 304 TRP CD2 C Y N 305 TRP NE1 N Y N 306 TRP CE2 C Y N 307 TRP CE3 C Y N 308 TRP CZ2 C Y N 309 TRP CZ3 C Y N 310 TRP CH2 C Y N 311 TRP OXT O N N 312 TRP H H N N 313 TRP H2 H N N 314 TRP HA H N N 315 TRP HB2 H N N 316 TRP HB3 H N N 317 TRP HD1 H N N 318 TRP HE1 H N N 319 TRP HE3 H N N 320 TRP HZ2 H N N 321 TRP HZ3 H N N 322 TRP HH2 H N N 323 TRP HXT H N N 324 TYR N N N N 325 TYR CA C N S 326 TYR C C N N 327 TYR O O N N 328 TYR CB C N N 329 TYR CG C Y N 330 TYR CD1 C Y N 331 TYR CD2 C Y N 332 TYR CE1 C Y N 333 TYR CE2 C Y N 334 TYR CZ C Y N 335 TYR OH O N N 336 TYR OXT O N N 337 TYR H H N N 338 TYR H2 H N N 339 TYR HA H N N 340 TYR HB2 H N N 341 TYR HB3 H N N 342 TYR HD1 H N N 343 TYR HD2 H N N 344 TYR HE1 H N N 345 TYR HE2 H N N 346 TYR HH H N N 347 TYR HXT H N N 348 VAL N N N N 349 VAL CA C N S 350 VAL C C N N 351 VAL O O N N 352 VAL CB C N N 353 VAL CG1 C N N 354 VAL CG2 C N N 355 VAL OXT O N N 356 VAL H H N N 357 VAL H2 H N N 358 VAL HA H N N 359 VAL HB H N N 360 VAL HG11 H N N 361 VAL HG12 H N N 362 VAL HG13 H N N 363 VAL HG21 H N N 364 VAL HG22 H N N 365 VAL HG23 H N N 366 VAL HXT H N N 367 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 LEU N CA sing N N 150 LEU N H sing N N 151 LEU N H2 sing N N 152 LEU CA C sing N N 153 LEU CA CB sing N N 154 LEU CA HA sing N N 155 LEU C O doub N N 156 LEU C OXT sing N N 157 LEU CB CG sing N N 158 LEU CB HB2 sing N N 159 LEU CB HB3 sing N N 160 LEU CG CD1 sing N N 161 LEU CG CD2 sing N N 162 LEU CG HG sing N N 163 LEU CD1 HD11 sing N N 164 LEU CD1 HD12 sing N N 165 LEU CD1 HD13 sing N N 166 LEU CD2 HD21 sing N N 167 LEU CD2 HD22 sing N N 168 LEU CD2 HD23 sing N N 169 LEU OXT HXT sing N N 170 LYS N CA sing N N 171 LYS N H sing N N 172 LYS N H2 sing N N 173 LYS CA C sing N N 174 LYS CA CB sing N N 175 LYS CA HA sing N N 176 LYS C O doub N N 177 LYS C OXT sing N N 178 LYS CB CG sing N N 179 LYS CB HB2 sing N N 180 LYS CB HB3 sing N N 181 LYS CG CD sing N N 182 LYS CG HG2 sing N N 183 LYS CG HG3 sing N N 184 LYS CD CE sing N N 185 LYS CD HD2 sing N N 186 LYS CD HD3 sing N N 187 LYS CE NZ sing N N 188 LYS CE HE2 sing N N 189 LYS CE HE3 sing N N 190 LYS NZ HZ1 sing N N 191 LYS NZ HZ2 sing N N 192 LYS NZ HZ3 sing N N 193 LYS OXT HXT sing N N 194 MET N CA sing N N 195 MET N H sing N N 196 MET N H2 sing N N 197 MET CA C sing N N 198 MET CA CB sing N N 199 MET CA HA sing N N 200 MET C O doub N N 201 MET C OXT sing N N 202 MET CB CG sing N N 203 MET CB HB2 sing N N 204 MET CB HB3 sing N N 205 MET CG SD sing N N 206 MET CG HG2 sing N N 207 MET CG HG3 sing N N 208 MET SD CE sing N N 209 MET CE HE1 sing N N 210 MET CE HE2 sing N N 211 MET CE HE3 sing N N 212 MET OXT HXT sing N N 213 PHE N CA sing N N 214 PHE N H sing N N 215 PHE N H2 sing N N 216 PHE CA C sing N N 217 PHE CA CB sing N N 218 PHE CA HA sing N N 219 PHE C O doub N N 220 PHE C OXT sing N N 221 PHE CB CG sing N N 222 PHE CB HB2 sing N N 223 PHE CB HB3 sing N N 224 PHE CG CD1 doub Y N 225 PHE CG CD2 sing Y N 226 PHE CD1 CE1 sing Y N 227 PHE CD1 HD1 sing N N 228 PHE CD2 CE2 doub Y N 229 PHE CD2 HD2 sing N N 230 PHE CE1 CZ doub Y N 231 PHE CE1 HE1 sing N N 232 PHE CE2 CZ sing Y N 233 PHE CE2 HE2 sing N N 234 PHE CZ HZ sing N N 235 PHE OXT HXT sing N N 236 PRO N CA sing N N 237 PRO N CD sing N N 238 PRO N H sing N N 239 PRO CA C sing N N 240 PRO CA CB sing N N 241 PRO CA HA sing N N 242 PRO C O doub N N 243 PRO C OXT sing N N 244 PRO CB CG sing N N 245 PRO CB HB2 sing N N 246 PRO CB HB3 sing N N 247 PRO CG CD sing N N 248 PRO CG HG2 sing N N 249 PRO CG HG3 sing N N 250 PRO CD HD2 sing N N 251 PRO CD HD3 sing N N 252 PRO OXT HXT sing N N 253 SER N CA sing N N 254 SER N H sing N N 255 SER N H2 sing N N 256 SER CA C sing N N 257 SER CA CB sing N N 258 SER CA HA sing N N 259 SER C O doub N N 260 SER C OXT sing N N 261 SER CB OG sing N N 262 SER CB HB2 sing N N 263 SER CB HB3 sing N N 264 SER OG HG sing N N 265 SER OXT HXT sing N N 266 THR N CA sing N N 267 THR N H sing N N 268 THR N H2 sing N N 269 THR CA C sing N N 270 THR CA CB sing N N 271 THR CA HA sing N N 272 THR C O doub N N 273 THR C OXT sing N N 274 THR CB OG1 sing N N 275 THR CB CG2 sing N N 276 THR CB HB sing N N 277 THR OG1 HG1 sing N N 278 THR CG2 HG21 sing N N 279 THR CG2 HG22 sing N N 280 THR CG2 HG23 sing N N 281 THR OXT HXT sing N N 282 TRP N CA sing N N 283 TRP N H sing N N 284 TRP N H2 sing N N 285 TRP CA C sing N N 286 TRP CA CB sing N N 287 TRP CA HA sing N N 288 TRP C O doub N N 289 TRP C OXT sing N N 290 TRP CB CG sing N N 291 TRP CB HB2 sing N N 292 TRP CB HB3 sing N N 293 TRP CG CD1 doub Y N 294 TRP CG CD2 sing Y N 295 TRP CD1 NE1 sing Y N 296 TRP CD1 HD1 sing N N 297 TRP CD2 CE2 doub Y N 298 TRP CD2 CE3 sing Y N 299 TRP NE1 CE2 sing Y N 300 TRP NE1 HE1 sing N N 301 TRP CE2 CZ2 sing Y N 302 TRP CE3 CZ3 doub Y N 303 TRP CE3 HE3 sing N N 304 TRP CZ2 CH2 doub Y N 305 TRP CZ2 HZ2 sing N N 306 TRP CZ3 CH2 sing Y N 307 TRP CZ3 HZ3 sing N N 308 TRP CH2 HH2 sing N N 309 TRP OXT HXT sing N N 310 TYR N CA sing N N 311 TYR N H sing N N 312 TYR N H2 sing N N 313 TYR CA C sing N N 314 TYR CA CB sing N N 315 TYR CA HA sing N N 316 TYR C O doub N N 317 TYR C OXT sing N N 318 TYR CB CG sing N N 319 TYR CB HB2 sing N N 320 TYR CB HB3 sing N N 321 TYR CG CD1 doub Y N 322 TYR CG CD2 sing Y N 323 TYR CD1 CE1 sing Y N 324 TYR CD1 HD1 sing N N 325 TYR CD2 CE2 doub Y N 326 TYR CD2 HD2 sing N N 327 TYR CE1 CZ doub Y N 328 TYR CE1 HE1 sing N N 329 TYR CE2 CZ sing Y N 330 TYR CE2 HE2 sing N N 331 TYR CZ OH sing N N 332 TYR OH HH sing N N 333 TYR OXT HXT sing N N 334 VAL N CA sing N N 335 VAL N H sing N N 336 VAL N H2 sing N N 337 VAL CA C sing N N 338 VAL CA CB sing N N 339 VAL CA HA sing N N 340 VAL C O doub N N 341 VAL C OXT sing N N 342 VAL CB CG1 sing N N 343 VAL CB CG2 sing N N 344 VAL CB HB sing N N 345 VAL CG1 HG11 sing N N 346 VAL CG1 HG12 sing N N 347 VAL CG1 HG13 sing N N 348 VAL CG2 HG21 sing N N 349 VAL CG2 HG22 sing N N 350 VAL CG2 HG23 sing N N 351 VAL OXT HXT sing N N 352 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MANGANESE (II) ION' MN 3 'NICKEL (II) ION' NI # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5V3D _pdbx_initial_refinement_model.details ? # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 homology 'FosA3 shares high sequence similarity with other fosfomycin resistance proteins known to be functional homodimers' 2 2 homology 'FosA3 shares high sequence similarity with other fosfomycin resistance proteins known to be functional homodimers' 3 3 homology 'FosA3 shares high sequence similarity with other fosfomycin resistance proteins known to be functional homodimers' 4 4 homology 'FosA3 shares high sequence similarity with other fosfomycin resistance proteins known to be functional homodimers' #