data_5VC9 # _entry.id 5VC9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.389 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5VC9 pdb_00005vc9 10.2210/pdb5vc9/pdb WWPDB D_1000227134 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-06-28 2 'Structure model' 1 1 2018-01-03 3 'Structure model' 1 2 2018-01-10 4 'Structure model' 1 3 2024-03-06 5 'Structure model' 1 4 2024-04-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 7 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 3 'Structure model' '_citation.journal_volume' 11 3 'Structure model' '_citation.page_first' 12 3 'Structure model' '_citation.page_last' 13 3 'Structure model' '_citation.year' 14 4 'Structure model' '_database_2.pdbx_DOI' 15 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5VC9 _pdbx_database_status.recvd_initial_deposition_date 2017-03-31 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Liu, K.' 1 ? 'Xu, C.' 2 ? 'Tempel, W.' 3 ? 'Walker, J.R.' 4 ? 'Arrowsmith, C.H.' 5 ? 'Bountra, C.' 6 ? 'Edwards, A.M.' 7 ? 'Min, J.' 8 ? 'Structural Genomics Consortium (SGC)' 9 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Structure _citation.journal_id_ASTM STRUE6 _citation.journal_id_CSD 2005 _citation.journal_id_ISSN 1878-4186 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 26 _citation.language ? _citation.page_first 85 _citation.page_last 95.e3 _citation.title 'DNA Sequence Recognition of Human CXXC Domains and Their Structural Determinants.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.str.2017.11.022 _citation.pdbx_database_id_PubMed 29276034 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Xu, C.' 1 ? primary 'Liu, K.' 2 ? primary 'Lei, M.' 3 ? primary 'Yang, A.' 4 ? primary 'Li, Y.' 5 ? primary 'Hughes, T.R.' 6 ? primary 'Min, J.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer syn 'CpG DNA' 3663.392 4 ? ? ? ? 2 polymer man 'CXXC-type zinc finger protein 4' 5611.951 2 ? ? ? ? 3 non-polymer syn 'UNKNOWN ATOM OR ION' ? 7 ? ? ? ? 4 non-polymer syn 'ZINC ION' 65.409 4 ? ? ? ? 5 water nat water 18.015 30 ? ? ? ? # _entity_name_com.entity_id 2 _entity_name_com.name 'Inhibition of the Dvl and axin complex protein' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 polydeoxyribonucleotide no no '(DG)(DC)(DC)(DA)(DA)(DC)(DG)(DT)(DT)(DG)(DG)(DC)' GCCAACGTTGGC A,B,D,E ? 2 'polypeptide(L)' no no GKKKRKRCGVCVPCKRLINCGVCSSCRNRKTGHQICKFRKCEELKKKPG GKKKRKRCGVCVPCKRLINCGVCSSCRNRKTGHQICKFRKCEELKKKPG C,F ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'UNKNOWN ATOM OR ION' UNX 4 'ZINC ION' ZN 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 DG n 1 2 DC n 1 3 DC n 1 4 DA n 1 5 DA n 1 6 DC n 1 7 DG n 1 8 DT n 1 9 DT n 1 10 DG n 1 11 DG n 1 12 DC n 2 1 GLY n 2 2 LYS n 2 3 LYS n 2 4 LYS n 2 5 ARG n 2 6 LYS n 2 7 ARG n 2 8 CYS n 2 9 GLY n 2 10 VAL n 2 11 CYS n 2 12 VAL n 2 13 PRO n 2 14 CYS n 2 15 LYS n 2 16 ARG n 2 17 LEU n 2 18 ILE n 2 19 ASN n 2 20 CYS n 2 21 GLY n 2 22 VAL n 2 23 CYS n 2 24 SER n 2 25 SER n 2 26 CYS n 2 27 ARG n 2 28 ASN n 2 29 ARG n 2 30 LYS n 2 31 THR n 2 32 GLY n 2 33 HIS n 2 34 GLN n 2 35 ILE n 2 36 CYS n 2 37 LYS n 2 38 PHE n 2 39 ARG n 2 40 LYS n 2 41 CYS n 2 42 GLU n 2 43 GLU n 2 44 LEU n 2 45 LYS n 2 46 LYS n 2 47 LYS n 2 48 PRO n 2 49 GLY n # _entity_src_gen.entity_id 2 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 49 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CXXC4, IDAX' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)-V2R-pRARE2' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28-MHL _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 12 _pdbx_entity_src_syn.organism_scientific 'synthetic construct' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 32630 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DA 'DNA linking' y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 DC 'DNA linking' y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O7 P' 307.197 DG 'DNA linking' y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 DT 'DNA linking' y "THYMIDINE-5'-MONOPHOSPHATE" ? 'C10 H15 N2 O8 P' 322.208 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 UNX non-polymer . 'UNKNOWN ATOM OR ION' ? ? ? VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 DG 1 1 1 DG DG A . n A 1 2 DC 2 2 2 DC DC A . n A 1 3 DC 3 3 3 DC DC A . n A 1 4 DA 4 4 4 DA DA A . n A 1 5 DA 5 5 5 DA DA A . n A 1 6 DC 6 6 6 DC DC A . n A 1 7 DG 7 7 7 DG DG A . n A 1 8 DT 8 8 8 DT DT A . n A 1 9 DT 9 9 9 DT DT A . n A 1 10 DG 10 10 10 DG DG A . n A 1 11 DG 11 11 11 DG DG A . n A 1 12 DC 12 12 12 DC DC A . n B 1 1 DG 1 1 1 DG DG B . n B 1 2 DC 2 2 2 DC DC B . n B 1 3 DC 3 3 3 DC DC B . n B 1 4 DA 4 4 4 DA DA B . n B 1 5 DA 5 5 5 DA DA B . n B 1 6 DC 6 6 6 DC DC B . n B 1 7 DG 7 7 7 DG DG B . n B 1 8 DT 8 8 8 DT DT B . n B 1 9 DT 9 9 9 DT DT B . n B 1 10 DG 10 10 10 DG DG B . n B 1 11 DG 11 11 11 DG DG B . n B 1 12 DC 12 12 12 DC DC B . n C 2 1 GLY 1 132 ? ? ? C . n C 2 2 LYS 2 133 ? ? ? C . n C 2 3 LYS 3 134 134 LYS LYS C . n C 2 4 LYS 4 135 135 LYS LYS C . n C 2 5 ARG 5 136 136 ARG ARG C . n C 2 6 LYS 6 137 137 LYS LYS C . n C 2 7 ARG 7 138 138 ARG ARG C . n C 2 8 CYS 8 139 139 CYS CYS C . n C 2 9 GLY 9 140 140 GLY GLY C . n C 2 10 VAL 10 141 141 VAL VAL C . n C 2 11 CYS 11 142 142 CYS CYS C . n C 2 12 VAL 12 143 143 VAL VAL C . n C 2 13 PRO 13 144 144 PRO PRO C . n C 2 14 CYS 14 145 145 CYS CYS C . n C 2 15 LYS 15 146 146 LYS LYS C . n C 2 16 ARG 16 147 147 ARG ARG C . n C 2 17 LEU 17 148 148 LEU LEU C . n C 2 18 ILE 18 149 149 ILE ILE C . n C 2 19 ASN 19 150 150 ASN ASN C . n C 2 20 CYS 20 151 151 CYS CYS C . n C 2 21 GLY 21 152 152 GLY GLY C . n C 2 22 VAL 22 153 153 VAL VAL C . n C 2 23 CYS 23 154 154 CYS CYS C . n C 2 24 SER 24 155 155 SER SER C . n C 2 25 SER 25 156 156 SER SER C . n C 2 26 CYS 26 157 157 CYS CYS C . n C 2 27 ARG 27 158 158 ARG ARG C . n C 2 28 ASN 28 159 159 ASN ASN C . n C 2 29 ARG 29 160 160 ARG ARG C . n C 2 30 LYS 30 161 161 LYS LYS C . n C 2 31 THR 31 162 162 THR THR C . n C 2 32 GLY 32 163 163 GLY GLY C . n C 2 33 HIS 33 164 164 HIS HIS C . n C 2 34 GLN 34 165 165 GLN GLN C . n C 2 35 ILE 35 166 166 ILE ILE C . n C 2 36 CYS 36 167 167 CYS CYS C . n C 2 37 LYS 37 168 168 LYS LYS C . n C 2 38 PHE 38 169 169 PHE PHE C . n C 2 39 ARG 39 170 170 ARG ARG C . n C 2 40 LYS 40 171 171 LYS LYS C . n C 2 41 CYS 41 172 172 CYS CYS C . n C 2 42 GLU 42 173 173 GLU GLU C . n C 2 43 GLU 43 174 174 GLU GLU C . n C 2 44 LEU 44 175 175 LEU LEU C . n C 2 45 LYS 45 176 176 LYS LYS C . n C 2 46 LYS 46 177 177 LYS LYS C . n C 2 47 LYS 47 178 178 LYS LYS C . n C 2 48 PRO 48 179 179 PRO PRO C . n C 2 49 GLY 49 180 ? ? ? C . n D 1 1 DG 1 1 1 DG DG D . n D 1 2 DC 2 2 2 DC DC D . n D 1 3 DC 3 3 3 DC DC D . n D 1 4 DA 4 4 4 DA DA D . n D 1 5 DA 5 5 5 DA DA D . n D 1 6 DC 6 6 6 DC DC D . n D 1 7 DG 7 7 7 DG DG D . n D 1 8 DT 8 8 8 DT DT D . n D 1 9 DT 9 9 9 DT DT D . n D 1 10 DG 10 10 10 DG DG D . n D 1 11 DG 11 11 11 DG DG D . n D 1 12 DC 12 12 12 DC DC D . n E 1 1 DG 1 1 1 DG DG E . n E 1 2 DC 2 2 2 DC DC E . n E 1 3 DC 3 3 3 DC DC E . n E 1 4 DA 4 4 4 DA DA E . n E 1 5 DA 5 5 5 DA DA E . n E 1 6 DC 6 6 6 DC DC E . n E 1 7 DG 7 7 7 DG DG E . n E 1 8 DT 8 8 8 DT DT E . n E 1 9 DT 9 9 9 DT DT E . n E 1 10 DG 10 10 10 DG DG E . n E 1 11 DG 11 11 11 DG DG E . n E 1 12 DC 12 12 12 DC DC E . n F 2 1 GLY 1 132 ? ? ? F . n F 2 2 LYS 2 133 ? ? ? F . n F 2 3 LYS 3 134 134 LYS LYS F . n F 2 4 LYS 4 135 135 LYS LYS F . n F 2 5 ARG 5 136 136 ARG ARG F . n F 2 6 LYS 6 137 137 LYS LYS F . n F 2 7 ARG 7 138 138 ARG ARG F . n F 2 8 CYS 8 139 139 CYS CYS F . n F 2 9 GLY 9 140 140 GLY GLY F . n F 2 10 VAL 10 141 141 VAL VAL F . n F 2 11 CYS 11 142 142 CYS CYS F . n F 2 12 VAL 12 143 143 VAL VAL F . n F 2 13 PRO 13 144 144 PRO PRO F . n F 2 14 CYS 14 145 145 CYS CYS F . n F 2 15 LYS 15 146 146 LYS LYS F . n F 2 16 ARG 16 147 147 ARG ARG F . n F 2 17 LEU 17 148 148 LEU LEU F . n F 2 18 ILE 18 149 149 ILE ILE F . n F 2 19 ASN 19 150 150 ASN ASN F . n F 2 20 CYS 20 151 151 CYS CYS F . n F 2 21 GLY 21 152 152 GLY GLY F . n F 2 22 VAL 22 153 153 VAL VAL F . n F 2 23 CYS 23 154 154 CYS CYS F . n F 2 24 SER 24 155 155 SER SER F . n F 2 25 SER 25 156 156 SER SER F . n F 2 26 CYS 26 157 157 CYS CYS F . n F 2 27 ARG 27 158 158 ARG ARG F . n F 2 28 ASN 28 159 159 ASN ASN F . n F 2 29 ARG 29 160 160 ARG ARG F . n F 2 30 LYS 30 161 161 LYS LYS F . n F 2 31 THR 31 162 162 THR THR F . n F 2 32 GLY 32 163 163 GLY GLY F . n F 2 33 HIS 33 164 164 HIS HIS F . n F 2 34 GLN 34 165 165 GLN GLN F . n F 2 35 ILE 35 166 166 ILE ILE F . n F 2 36 CYS 36 167 167 CYS CYS F . n F 2 37 LYS 37 168 168 LYS LYS F . n F 2 38 PHE 38 169 169 PHE PHE F . n F 2 39 ARG 39 170 170 ARG ARG F . n F 2 40 LYS 40 171 171 LYS LYS F . n F 2 41 CYS 41 172 172 CYS CYS F . n F 2 42 GLU 42 173 173 GLU GLU F . n F 2 43 GLU 43 174 174 GLU GLU F . n F 2 44 LEU 44 175 175 LEU LEU F . n F 2 45 LYS 45 176 176 LYS LYS F . n F 2 46 LYS 46 177 177 LYS LYS F . n F 2 47 LYS 47 178 ? ? ? F . n F 2 48 PRO 48 179 ? ? ? F . n F 2 49 GLY 49 180 ? ? ? F . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code G 3 UNX 1 101 2 UNX UNX A . H 3 UNX 1 102 4 UNX UNX A . I 4 ZN 1 1001 1001 ZN ZN C . J 4 ZN 1 1002 1002 ZN ZN C . K 3 UNX 1 101 3 UNX UNX D . L 3 UNX 1 102 5 UNX UNX D . M 3 UNX 1 103 6 UNX UNX D . N 3 UNX 1 101 7 UNX UNX E . O 4 ZN 1 1001 1001 ZN ZN F . P 4 ZN 1 1002 1002 ZN ZN F . Q 3 UNX 1 1003 1 UNX UNX F . R 5 HOH 1 201 16 HOH HOH A . R 5 HOH 2 202 17 HOH HOH A . R 5 HOH 3 203 1 HOH HOH A . R 5 HOH 4 204 23 HOH HOH A . R 5 HOH 5 205 21 HOH HOH A . R 5 HOH 6 206 34 HOH HOH A . S 5 HOH 1 101 2 HOH HOH B . T 5 HOH 1 1101 5 HOH HOH C . T 5 HOH 2 1102 29 HOH HOH C . T 5 HOH 3 1103 4 HOH HOH C . T 5 HOH 4 1104 45 HOH HOH C . T 5 HOH 5 1105 41 HOH HOH C . T 5 HOH 6 1106 3 HOH HOH C . T 5 HOH 7 1107 6 HOH HOH C . T 5 HOH 8 1108 33 HOH HOH C . U 5 HOH 1 201 9 HOH HOH D . U 5 HOH 2 202 47 HOH HOH D . U 5 HOH 3 203 20 HOH HOH D . U 5 HOH 4 204 49 HOH HOH D . V 5 HOH 1 201 59 HOH HOH E . V 5 HOH 2 202 19 HOH HOH E . W 5 HOH 1 1101 12 HOH HOH F . W 5 HOH 2 1102 7 HOH HOH F . W 5 HOH 3 1103 8 HOH HOH F . W 5 HOH 4 1104 13 HOH HOH F . W 5 HOH 5 1105 14 HOH HOH F . W 5 HOH 6 1106 63 HOH HOH F . W 5 HOH 7 1107 10 HOH HOH F . W 5 HOH 8 1108 70 HOH HOH F . W 5 HOH 9 1109 15 HOH HOH F . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 C LYS 134 ? CG ? C LYS 3 CG 2 1 Y 1 C LYS 134 ? CD ? C LYS 3 CD 3 1 Y 1 C LYS 134 ? CE ? C LYS 3 CE 4 1 Y 1 C LYS 134 ? NZ ? C LYS 3 NZ 5 1 Y 1 C LYS 135 ? CE ? C LYS 4 CE 6 1 Y 1 C LYS 135 ? NZ ? C LYS 4 NZ 7 1 Y 1 C LYS 137 ? CD ? C LYS 6 CD 8 1 Y 1 C LYS 137 ? CE ? C LYS 6 CE 9 1 Y 1 C LYS 137 ? NZ ? C LYS 6 NZ 10 1 Y 1 C LYS 146 ? CE ? C LYS 15 CE 11 1 Y 1 C LYS 146 ? NZ ? C LYS 15 NZ 12 1 Y 1 C ARG 147 ? CD ? C ARG 16 CD 13 1 Y 1 C ARG 147 ? NE ? C ARG 16 NE 14 1 Y 1 C ARG 147 ? CZ ? C ARG 16 CZ 15 1 Y 1 C ARG 147 ? NH1 ? C ARG 16 NH1 16 1 Y 1 C ARG 147 ? NH2 ? C ARG 16 NH2 17 1 Y 1 C LYS 161 ? CD ? C LYS 30 CD 18 1 Y 1 C LYS 161 ? CE ? C LYS 30 CE 19 1 Y 1 C LYS 161 ? NZ ? C LYS 30 NZ 20 1 Y 1 C LYS 168 ? CG ? C LYS 37 CG 21 1 Y 1 C LYS 168 ? CD ? C LYS 37 CD 22 1 Y 1 C LYS 168 ? CE ? C LYS 37 CE 23 1 Y 1 C LYS 168 ? NZ ? C LYS 37 NZ 24 1 Y 1 C LYS 177 ? CD ? C LYS 46 CD 25 1 Y 1 C LYS 177 ? CE ? C LYS 46 CE 26 1 Y 1 C LYS 177 ? NZ ? C LYS 46 NZ 27 1 Y 1 C LYS 178 ? NZ ? C LYS 47 NZ 28 1 Y 1 F LYS 134 ? CG ? F LYS 3 CG 29 1 Y 1 F LYS 134 ? CD ? F LYS 3 CD 30 1 Y 1 F LYS 134 ? CE ? F LYS 3 CE 31 1 Y 1 F LYS 134 ? NZ ? F LYS 3 NZ 32 1 Y 1 F LYS 135 ? CD ? F LYS 4 CD 33 1 Y 1 F LYS 135 ? CE ? F LYS 4 CE 34 1 Y 1 F LYS 135 ? NZ ? F LYS 4 NZ 35 1 Y 1 F LYS 137 ? CE ? F LYS 6 CE 36 1 Y 1 F LYS 137 ? NZ ? F LYS 6 NZ 37 1 Y 1 F LYS 146 ? CE ? F LYS 15 CE 38 1 Y 1 F LYS 146 ? NZ ? F LYS 15 NZ 39 1 Y 1 F LYS 161 ? CD ? F LYS 30 CD 40 1 Y 1 F LYS 161 ? CE ? F LYS 30 CE 41 1 Y 1 F LYS 161 ? NZ ? F LYS 30 NZ 42 1 Y 1 F LYS 168 ? CD ? F LYS 37 CD 43 1 Y 1 F LYS 168 ? CE ? F LYS 37 CE 44 1 Y 1 F LYS 168 ? NZ ? F LYS 37 NZ 45 1 Y 1 F LYS 177 ? CG ? F LYS 46 CG 46 1 Y 1 F LYS 177 ? CD ? F LYS 46 CD 47 1 Y 1 F LYS 177 ? CE ? F LYS 46 CE 48 1 Y 1 F LYS 177 ? NZ ? F LYS 46 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.5.31 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0158 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 4 # _cell.angle_alpha 70.980 _cell.angle_alpha_esd ? _cell.angle_beta 86.430 _cell.angle_beta_esd ? _cell.angle_gamma 67.830 _cell.angle_gamma_esd ? _cell.entry_id 5VC9 _cell.details ? _cell.formula_units_Z ? _cell.length_a 29.983 _cell.length_a_esd ? _cell.length_b 40.290 _cell.length_b_esd ? _cell.length_c 57.760 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5VC9 _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5VC9 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.4 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 49.3 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '30% PEG-1500, 5% MPD, 0.2 M sodium chloride, 0.1 M HEPES' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-06-19 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97918 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 19-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97918 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 19-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5VC9 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.100 _reflns.d_resolution_low 27.240 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13389 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.200 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 2.100 _reflns.pdbx_Rmerge_I_obs 0.061 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.100 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects 0 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.081 _reflns.pdbx_Rpim_I_all 0.054 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 28017 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.995 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.100 2.160 ? ? 1874 ? ? 1057 ? 92.600 ? ? ? ? 0.597 ? ? ? ? ? ? ? ? 1.800 ? ? ? 1.300 0.820 0.559 ? 1 1 0.653 ? 8.910 27.240 ? ? 346 ? ? 164 ? 88.200 ? ? ? ? 0.050 ? ? ? ? ? ? ? ? 2.100 ? ? ? 32.000 0.066 0.042 ? 2 1 0.992 ? # _refine.aniso_B[1][1] 2.3600 _refine.aniso_B[1][2] 0.7000 _refine.aniso_B[1][3] -0.7800 _refine.aniso_B[2][2] -1.1700 _refine.aniso_B[2][3] 0.4000 _refine.aniso_B[3][3] 0.1800 _refine.B_iso_max 97.520 _refine.B_iso_mean 45.8180 _refine.B_iso_min 14.090 _refine.correlation_coeff_Fo_to_Fc 0.9570 _refine.correlation_coeff_Fo_to_Fc_free 0.9370 _refine.details 'coot was used for interactive model building. Model geometry was assessed with phenix.molprobity.' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5VC9 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.1000 _refine.ls_d_res_low 27.2000 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12637 _refine.ls_number_reflns_R_free 750 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.1300 _refine.ls_percent_reflns_R_free 5.6000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2132 _refine.ls_R_factor_R_free 0.2481 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2110 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'unpublished model of related protein-DNA complex' _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details 'thin resolution shells (sftools)' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.2450 _refine.pdbx_overall_ESU_R_Free 0.1960 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 13.8410 _refine.overall_SU_ML 0.1740 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.1000 _refine_hist.d_res_low 27.2000 _refine_hist.pdbx_number_atoms_ligand 11 _refine_hist.number_atoms_solvent 30 _refine_hist.number_atoms_total 1681 _refine_hist.pdbx_number_residues_total 138 _refine_hist.pdbx_B_iso_mean_ligand 39.77 _refine_hist.pdbx_B_iso_mean_solvent 32.80 _refine_hist.pdbx_number_atoms_protein 668 _refine_hist.pdbx_number_atoms_nucleic_acid 972 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.017 0.014 1790 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.005 0.020 1206 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.554 1.456 2602 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.474 3.011 2790 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.769 5.000 92 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 34.972 19.600 25 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 11.367 15.000 134 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 23.250 15.000 11 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.092 0.200 247 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.012 0.020 1333 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 394 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 1.781 3.003 367 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 1.783 3.001 365 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 2.489 4.488 455 ? r_mcangle_it ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.1000 _refine_ls_shell.d_res_low 2.1540 _refine_ls_shell.number_reflns_all 939 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 36 _refine_ls_shell.number_reflns_R_work 903 _refine_ls_shell.percent_reflns_obs 92.0600 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3450 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.3010 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5VC9 _struct.title 'Zinc finger of human CXXC4 in complex with CpG DNA' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5VC9 _struct_keywords.text 'CXXC, DNA, Structural Genomics, Structural Genomics Consortium, SGC, DNA BINDING PROTEIN' _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 1 ? E N N 1 ? F N N 2 ? G N N 3 ? H N N 3 ? I N N 4 ? J N N 4 ? K N N 3 ? L N N 3 ? M N N 3 ? N N N 3 ? O N N 4 ? P N N 4 ? Q N N 3 ? R N N 5 ? S N N 5 ? T N N 5 ? U N N 5 ? V N N 5 ? W N N 5 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 PDB 5VC9 5VC9 ? 1 ? 1 2 UNP CXXC4_HUMAN Q9H2H0 ? 2 KKKRKRCGVCVPCKRLINCGVCSSCRNRKTGHQICKFRKCEELKKKPG 133 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5VC9 A 1 ? 12 ? 5VC9 1 ? 12 ? 1 12 2 1 5VC9 B 1 ? 12 ? 5VC9 1 ? 12 ? 1 12 3 2 5VC9 C 2 ? 49 ? Q9H2H0 133 ? 180 ? 133 180 4 1 5VC9 D 1 ? 12 ? 5VC9 1 ? 12 ? 1 12 5 1 5VC9 E 1 ? 12 ? 5VC9 1 ? 12 ? 1 12 6 2 5VC9 F 2 ? 49 ? Q9H2H0 133 ? 180 ? 133 180 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 3 5VC9 GLY C 1 ? UNP Q9H2H0 ? ? 'expression tag' 132 1 6 5VC9 GLY F 1 ? UNP Q9H2H0 ? ? 'expression tag' 132 2 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA trimeric 3 2 author_and_software_defined_assembly PISA trimeric 3 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2410 ? 1 MORE -14 ? 1 'SSA (A^2)' 7190 ? 2 'ABSA (A^2)' 2410 ? 2 MORE -13 ? 2 'SSA (A^2)' 7000 ? # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,G,H,I,J,R,S,T 2 1 D,E,F,K,L,M,N,O,P,Q,U,V,W # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 CYS C 11 ? ARG C 16 ? CYS C 142 ARG C 147 1 ? 6 HELX_P HELX_P2 AA2 CYS C 23 ? ASN C 28 ? CYS C 154 ASN C 159 1 ? 6 HELX_P HELX_P3 AA3 ASN C 28 ? HIS C 33 ? ASN C 159 HIS C 164 1 ? 6 HELX_P HELX_P4 AA4 CYS C 41 ? LYS C 45 ? CYS C 172 LYS C 176 5 ? 5 HELX_P HELX_P5 AA5 CYS F 23 ? ASN F 28 ? CYS F 154 ASN F 159 1 ? 6 HELX_P HELX_P6 AA6 ASN F 28 ? HIS F 33 ? ASN F 159 HIS F 164 1 ? 6 HELX_P HELX_P7 AA7 CYS F 41 ? LYS F 45 ? CYS F 172 LYS F 176 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? C CYS 8 SG ? ? ? 1_555 I ZN . ZN ? ? C CYS 139 C ZN 1001 1_555 ? ? ? ? ? ? ? 2.327 ? ? metalc2 metalc ? ? C CYS 11 SG ? ? ? 1_555 I ZN . ZN ? ? C CYS 142 C ZN 1001 1_555 ? ? ? ? ? ? ? 2.271 ? ? metalc3 metalc ? ? C CYS 14 SG ? ? ? 1_555 I ZN . ZN ? ? C CYS 145 C ZN 1001 1_555 ? ? ? ? ? ? ? 2.336 ? ? metalc4 metalc ? ? C CYS 20 SG ? ? ? 1_555 J ZN . ZN ? ? C CYS 151 C ZN 1002 1_555 ? ? ? ? ? ? ? 2.287 ? ? metalc5 metalc ? ? C CYS 23 SG ? ? ? 1_555 J ZN . ZN ? ? C CYS 154 C ZN 1002 1_555 ? ? ? ? ? ? ? 2.348 ? ? metalc6 metalc ? ? C CYS 26 SG ? ? ? 1_555 J ZN . ZN ? ? C CYS 157 C ZN 1002 1_555 ? ? ? ? ? ? ? 2.315 ? ? metalc7 metalc ? ? C CYS 36 SG ? ? ? 1_555 J ZN . ZN ? ? C CYS 167 C ZN 1002 1_555 ? ? ? ? ? ? ? 2.318 ? ? metalc8 metalc ? ? C CYS 41 SG ? ? ? 1_555 I ZN . ZN ? ? C CYS 172 C ZN 1001 1_555 ? ? ? ? ? ? ? 2.344 ? ? metalc9 metalc ? ? F CYS 8 SG ? ? ? 1_555 O ZN . ZN ? ? F CYS 139 F ZN 1001 1_555 ? ? ? ? ? ? ? 2.250 ? ? metalc10 metalc ? ? F CYS 11 SG ? ? ? 1_555 O ZN . ZN ? ? F CYS 142 F ZN 1001 1_555 ? ? ? ? ? ? ? 2.287 ? ? metalc11 metalc ? ? F CYS 14 SG ? ? ? 1_555 O ZN . ZN ? ? F CYS 145 F ZN 1001 1_555 ? ? ? ? ? ? ? 2.333 ? ? metalc12 metalc ? ? F CYS 20 SG ? ? ? 1_555 P ZN . ZN ? ? F CYS 151 F ZN 1002 1_555 ? ? ? ? ? ? ? 2.263 ? ? metalc13 metalc ? ? F CYS 23 SG ? ? ? 1_555 P ZN . ZN ? ? F CYS 154 F ZN 1002 1_555 ? ? ? ? ? ? ? 2.355 ? ? metalc14 metalc ? ? F CYS 26 SG ? ? ? 1_555 P ZN . ZN ? ? F CYS 157 F ZN 1002 1_555 ? ? ? ? ? ? ? 2.279 ? ? metalc15 metalc ? ? F CYS 36 SG ? ? ? 1_555 P ZN . ZN ? ? F CYS 167 F ZN 1002 1_555 ? ? ? ? ? ? ? 2.357 ? ? metalc16 metalc ? ? F CYS 41 SG ? ? ? 1_555 O ZN . ZN ? ? F CYS 172 F ZN 1001 1_555 ? ? ? ? ? ? ? 2.260 ? ? hydrog1 hydrog ? ? A DG 1 N1 ? ? ? 1_555 B DC 12 N3 ? ? A DG 1 B DC 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog2 hydrog ? ? A DG 1 N2 ? ? ? 1_555 B DC 12 O2 ? ? A DG 1 B DC 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog3 hydrog ? ? A DG 1 O6 ? ? ? 1_555 B DC 12 N4 ? ? A DG 1 B DC 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog4 hydrog ? ? A DC 2 N3 ? ? ? 1_555 B DG 11 N1 ? ? A DC 2 B DG 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog5 hydrog ? ? A DC 2 N4 ? ? ? 1_555 B DG 11 O6 ? ? A DC 2 B DG 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog6 hydrog ? ? A DC 2 O2 ? ? ? 1_555 B DG 11 N2 ? ? A DC 2 B DG 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog7 hydrog ? ? A DC 3 N3 ? ? ? 1_555 B DG 10 N1 ? ? A DC 3 B DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog8 hydrog ? ? A DC 3 N4 ? ? ? 1_555 B DG 10 O6 ? ? A DC 3 B DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog9 hydrog ? ? A DC 3 O2 ? ? ? 1_555 B DG 10 N2 ? ? A DC 3 B DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog10 hydrog ? ? A DA 4 N1 ? ? ? 1_555 B DT 9 N3 ? ? A DA 4 B DT 9 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog11 hydrog ? ? A DA 4 N6 ? ? ? 1_555 B DT 9 O4 ? ? A DA 4 B DT 9 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog12 hydrog ? ? A DA 5 N1 ? ? ? 1_555 B DT 8 N3 ? ? A DA 5 B DT 8 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog13 hydrog ? ? A DA 5 N6 ? ? ? 1_555 B DT 8 O4 ? ? A DA 5 B DT 8 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog14 hydrog ? ? A DC 6 N3 ? ? ? 1_555 B DG 7 N1 ? ? A DC 6 B DG 7 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog15 hydrog ? ? A DC 6 N4 ? ? ? 1_555 B DG 7 O6 ? ? A DC 6 B DG 7 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog16 hydrog ? ? A DC 6 O2 ? ? ? 1_555 B DG 7 N2 ? ? A DC 6 B DG 7 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog17 hydrog ? ? A DG 7 N1 ? ? ? 1_555 B DC 6 N3 ? ? A DG 7 B DC 6 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog18 hydrog ? ? A DG 7 N2 ? ? ? 1_555 B DC 6 O2 ? ? A DG 7 B DC 6 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog19 hydrog ? ? A DG 7 O6 ? ? ? 1_555 B DC 6 N4 ? ? A DG 7 B DC 6 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog20 hydrog ? ? A DT 8 N3 ? ? ? 1_555 B DA 5 N1 ? ? A DT 8 B DA 5 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog21 hydrog ? ? A DT 8 O4 ? ? ? 1_555 B DA 5 N6 ? ? A DT 8 B DA 5 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog22 hydrog ? ? A DT 9 N3 ? ? ? 1_555 B DA 4 N1 ? ? A DT 9 B DA 4 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog23 hydrog ? ? A DT 9 O4 ? ? ? 1_555 B DA 4 N6 ? ? A DT 9 B DA 4 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog24 hydrog ? ? A DG 10 N1 ? ? ? 1_555 B DC 3 N3 ? ? A DG 10 B DC 3 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog25 hydrog ? ? A DG 10 N2 ? ? ? 1_555 B DC 3 O2 ? ? A DG 10 B DC 3 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog26 hydrog ? ? A DG 10 O6 ? ? ? 1_555 B DC 3 N4 ? ? A DG 10 B DC 3 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog27 hydrog ? ? A DG 11 N1 ? ? ? 1_555 B DC 2 N3 ? ? A DG 11 B DC 2 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog28 hydrog ? ? A DG 11 N2 ? ? ? 1_555 B DC 2 O2 ? ? A DG 11 B DC 2 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog29 hydrog ? ? A DG 11 O6 ? ? ? 1_555 B DC 2 N4 ? ? A DG 11 B DC 2 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog30 hydrog ? ? A DC 12 N3 ? ? ? 1_555 B DG 1 N1 ? ? A DC 12 B DG 1 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog31 hydrog ? ? A DC 12 N4 ? ? ? 1_555 B DG 1 O6 ? ? A DC 12 B DG 1 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog32 hydrog ? ? A DC 12 O2 ? ? ? 1_555 B DG 1 N2 ? ? A DC 12 B DG 1 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog33 hydrog ? ? D DG 1 N1 ? ? ? 1_555 E DC 12 N3 ? ? D DG 1 E DC 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog34 hydrog ? ? D DG 1 N2 ? ? ? 1_555 E DC 12 O2 ? ? D DG 1 E DC 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog35 hydrog ? ? D DG 1 O6 ? ? ? 1_555 E DC 12 N4 ? ? D DG 1 E DC 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog36 hydrog ? ? D DC 2 N3 ? ? ? 1_555 E DG 11 N1 ? ? D DC 2 E DG 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog37 hydrog ? ? D DC 2 N4 ? ? ? 1_555 E DG 11 O6 ? ? D DC 2 E DG 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog38 hydrog ? ? D DC 2 O2 ? ? ? 1_555 E DG 11 N2 ? ? D DC 2 E DG 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog39 hydrog ? ? D DC 3 N3 ? ? ? 1_555 E DG 10 N1 ? ? D DC 3 E DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog40 hydrog ? ? D DC 3 N4 ? ? ? 1_555 E DG 10 O6 ? ? D DC 3 E DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog41 hydrog ? ? D DC 3 O2 ? ? ? 1_555 E DG 10 N2 ? ? D DC 3 E DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog42 hydrog ? ? D DA 4 N1 ? ? ? 1_555 E DT 9 N3 ? ? D DA 4 E DT 9 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog43 hydrog ? ? D DA 4 N6 ? ? ? 1_555 E DT 9 O4 ? ? D DA 4 E DT 9 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog44 hydrog ? ? D DA 5 N1 ? ? ? 1_555 E DT 8 N3 ? ? D DA 5 E DT 8 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog45 hydrog ? ? D DA 5 N6 ? ? ? 1_555 E DT 8 O4 ? ? D DA 5 E DT 8 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog46 hydrog ? ? D DC 6 N3 ? ? ? 1_555 E DG 7 N1 ? ? D DC 6 E DG 7 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog47 hydrog ? ? D DC 6 N4 ? ? ? 1_555 E DG 7 O6 ? ? D DC 6 E DG 7 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog48 hydrog ? ? D DC 6 O2 ? ? ? 1_555 E DG 7 N2 ? ? D DC 6 E DG 7 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog49 hydrog ? ? D DG 7 N1 ? ? ? 1_555 E DC 6 N3 ? ? D DG 7 E DC 6 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog50 hydrog ? ? D DG 7 N2 ? ? ? 1_555 E DC 6 O2 ? ? D DG 7 E DC 6 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog51 hydrog ? ? D DG 7 O6 ? ? ? 1_555 E DC 6 N4 ? ? D DG 7 E DC 6 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog52 hydrog ? ? D DT 8 N3 ? ? ? 1_555 E DA 5 N1 ? ? D DT 8 E DA 5 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog53 hydrog ? ? D DT 8 O4 ? ? ? 1_555 E DA 5 N6 ? ? D DT 8 E DA 5 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog54 hydrog ? ? D DT 9 N3 ? ? ? 1_555 E DA 4 N1 ? ? D DT 9 E DA 4 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog55 hydrog ? ? D DT 9 O4 ? ? ? 1_555 E DA 4 N6 ? ? D DT 9 E DA 4 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog56 hydrog ? ? D DG 10 N1 ? ? ? 1_555 E DC 3 N3 ? ? D DG 10 E DC 3 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog57 hydrog ? ? D DG 10 N2 ? ? ? 1_555 E DC 3 O2 ? ? D DG 10 E DC 3 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog58 hydrog ? ? D DG 10 O6 ? ? ? 1_555 E DC 3 N4 ? ? D DG 10 E DC 3 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog59 hydrog ? ? D DG 11 N1 ? ? ? 1_555 E DC 2 N3 ? ? D DG 11 E DC 2 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog60 hydrog ? ? D DG 11 N2 ? ? ? 1_555 E DC 2 O2 ? ? D DG 11 E DC 2 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog61 hydrog ? ? D DG 11 O6 ? ? ? 1_555 E DC 2 N4 ? ? D DG 11 E DC 2 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog62 hydrog ? ? D DC 12 N3 ? ? ? 1_555 E DG 1 N1 ? ? D DC 12 E DG 1 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog63 hydrog ? ? D DC 12 N4 ? ? ? 1_555 E DG 1 O6 ? ? D DC 12 E DG 1 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog64 hydrog ? ? D DC 12 O2 ? ? ? 1_555 E DG 1 N2 ? ? D DC 12 E DG 1 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference metalc ? ? hydrog ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? C CYS 8 ? C CYS 139 ? 1_555 ZN ? I ZN . ? C ZN 1001 ? 1_555 SG ? C CYS 11 ? C CYS 142 ? 1_555 114.3 ? 2 SG ? C CYS 8 ? C CYS 139 ? 1_555 ZN ? I ZN . ? C ZN 1001 ? 1_555 SG ? C CYS 14 ? C CYS 145 ? 1_555 118.9 ? 3 SG ? C CYS 11 ? C CYS 142 ? 1_555 ZN ? I ZN . ? C ZN 1001 ? 1_555 SG ? C CYS 14 ? C CYS 145 ? 1_555 103.3 ? 4 SG ? C CYS 8 ? C CYS 139 ? 1_555 ZN ? I ZN . ? C ZN 1001 ? 1_555 SG ? C CYS 41 ? C CYS 172 ? 1_555 100.6 ? 5 SG ? C CYS 11 ? C CYS 142 ? 1_555 ZN ? I ZN . ? C ZN 1001 ? 1_555 SG ? C CYS 41 ? C CYS 172 ? 1_555 118.8 ? 6 SG ? C CYS 14 ? C CYS 145 ? 1_555 ZN ? I ZN . ? C ZN 1001 ? 1_555 SG ? C CYS 41 ? C CYS 172 ? 1_555 101.1 ? 7 SG ? C CYS 20 ? C CYS 151 ? 1_555 ZN ? J ZN . ? C ZN 1002 ? 1_555 SG ? C CYS 23 ? C CYS 154 ? 1_555 108.7 ? 8 SG ? C CYS 20 ? C CYS 151 ? 1_555 ZN ? J ZN . ? C ZN 1002 ? 1_555 SG ? C CYS 26 ? C CYS 157 ? 1_555 119.1 ? 9 SG ? C CYS 23 ? C CYS 154 ? 1_555 ZN ? J ZN . ? C ZN 1002 ? 1_555 SG ? C CYS 26 ? C CYS 157 ? 1_555 103.2 ? 10 SG ? C CYS 20 ? C CYS 151 ? 1_555 ZN ? J ZN . ? C ZN 1002 ? 1_555 SG ? C CYS 36 ? C CYS 167 ? 1_555 104.9 ? 11 SG ? C CYS 23 ? C CYS 154 ? 1_555 ZN ? J ZN . ? C ZN 1002 ? 1_555 SG ? C CYS 36 ? C CYS 167 ? 1_555 117.6 ? 12 SG ? C CYS 26 ? C CYS 157 ? 1_555 ZN ? J ZN . ? C ZN 1002 ? 1_555 SG ? C CYS 36 ? C CYS 167 ? 1_555 103.9 ? 13 SG ? F CYS 8 ? F CYS 139 ? 1_555 ZN ? O ZN . ? F ZN 1001 ? 1_555 SG ? F CYS 11 ? F CYS 142 ? 1_555 110.7 ? 14 SG ? F CYS 8 ? F CYS 139 ? 1_555 ZN ? O ZN . ? F ZN 1001 ? 1_555 SG ? F CYS 14 ? F CYS 145 ? 1_555 118.2 ? 15 SG ? F CYS 11 ? F CYS 142 ? 1_555 ZN ? O ZN . ? F ZN 1001 ? 1_555 SG ? F CYS 14 ? F CYS 145 ? 1_555 98.4 ? 16 SG ? F CYS 8 ? F CYS 139 ? 1_555 ZN ? O ZN . ? F ZN 1001 ? 1_555 SG ? F CYS 41 ? F CYS 172 ? 1_555 105.3 ? 17 SG ? F CYS 11 ? F CYS 142 ? 1_555 ZN ? O ZN . ? F ZN 1001 ? 1_555 SG ? F CYS 41 ? F CYS 172 ? 1_555 120.9 ? 18 SG ? F CYS 14 ? F CYS 145 ? 1_555 ZN ? O ZN . ? F ZN 1001 ? 1_555 SG ? F CYS 41 ? F CYS 172 ? 1_555 103.9 ? 19 SG ? F CYS 20 ? F CYS 151 ? 1_555 ZN ? P ZN . ? F ZN 1002 ? 1_555 SG ? F CYS 23 ? F CYS 154 ? 1_555 106.1 ? 20 SG ? F CYS 20 ? F CYS 151 ? 1_555 ZN ? P ZN . ? F ZN 1002 ? 1_555 SG ? F CYS 26 ? F CYS 157 ? 1_555 122.4 ? 21 SG ? F CYS 23 ? F CYS 154 ? 1_555 ZN ? P ZN . ? F ZN 1002 ? 1_555 SG ? F CYS 26 ? F CYS 157 ? 1_555 105.9 ? 22 SG ? F CYS 20 ? F CYS 151 ? 1_555 ZN ? P ZN . ? F ZN 1002 ? 1_555 SG ? F CYS 36 ? F CYS 167 ? 1_555 103.6 ? 23 SG ? F CYS 23 ? F CYS 154 ? 1_555 ZN ? P ZN . ? F ZN 1002 ? 1_555 SG ? F CYS 36 ? F CYS 167 ? 1_555 116.8 ? 24 SG ? F CYS 26 ? F CYS 157 ? 1_555 ZN ? P ZN . ? F ZN 1002 ? 1_555 SG ? F CYS 36 ? F CYS 167 ? 1_555 102.8 ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software C ZN 1001 ? 4 'binding site for residue ZN C 1001' AC2 Software C ZN 1002 ? 4 'binding site for residue ZN C 1002' AC3 Software F ZN 1001 ? 5 'binding site for residue ZN F 1001' AC4 Software F ZN 1002 ? 4 'binding site for residue ZN F 1002' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS C 8 ? CYS C 139 . ? 1_555 ? 2 AC1 4 CYS C 11 ? CYS C 142 . ? 1_555 ? 3 AC1 4 CYS C 14 ? CYS C 145 . ? 1_555 ? 4 AC1 4 CYS C 41 ? CYS C 172 . ? 1_555 ? 5 AC2 4 CYS C 20 ? CYS C 151 . ? 1_555 ? 6 AC2 4 CYS C 23 ? CYS C 154 . ? 1_555 ? 7 AC2 4 CYS C 26 ? CYS C 157 . ? 1_555 ? 8 AC2 4 CYS C 36 ? CYS C 167 . ? 1_555 ? 9 AC3 5 CYS F 8 ? CYS F 139 . ? 1_555 ? 10 AC3 5 GLY F 9 ? GLY F 140 . ? 1_555 ? 11 AC3 5 CYS F 11 ? CYS F 142 . ? 1_555 ? 12 AC3 5 CYS F 14 ? CYS F 145 . ? 1_555 ? 13 AC3 5 CYS F 41 ? CYS F 172 . ? 1_555 ? 14 AC4 4 CYS F 20 ? CYS F 151 . ? 1_555 ? 15 AC4 4 CYS F 23 ? CYS F 154 . ? 1_555 ? 16 AC4 4 CYS F 26 ? CYS F 157 . ? 1_555 ? 17 AC4 4 CYS F 36 ? CYS F 167 . ? 1_555 ? # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 "O3'" _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 DG _pdbx_validate_rmsd_bond.auth_seq_id_1 10 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 P _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 DG _pdbx_validate_rmsd_bond.auth_seq_id_2 11 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.529 _pdbx_validate_rmsd_bond.bond_target_value 1.607 _pdbx_validate_rmsd_bond.bond_deviation -0.078 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.012 _pdbx_validate_rmsd_bond.linker_flag Y # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 "C3'" A DA 5 ? ? "C2'" A DA 5 ? ? "C1'" A DA 5 ? ? 96.90 102.40 -5.50 0.80 N 2 1 NE F ARG 138 ? ? CZ F ARG 138 ? ? NH2 F ARG 138 ? ? 123.74 120.30 3.44 0.50 N # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'Structural Genomics Consortium' _pdbx_SG_project.initial_of_center SGC # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined -0.6601 -0.4716 6.9319 0.2808 0.1016 0.1448 -0.0488 0.0080 0.0202 3.9790 4.5282 1.7908 2.4752 -1.3270 0.2936 0.3049 -0.4221 0.1172 -0.3141 -0.1359 0.1779 0.8907 -0.0913 -0.1564 'X-RAY DIFFRACTION' 2 ? refined 0.3908 -0.8380 5.8869 0.1163 0.1513 0.1121 -0.0649 0.0030 0.0390 2.0442 7.2435 2.5377 1.3840 -0.4371 0.3748 0.0707 -0.1255 0.0548 -0.1488 -0.1526 -0.0463 0.0904 0.1473 -0.0758 'X-RAY DIFFRACTION' 3 ? refined 1.2048 0.1380 -6.9295 0.0371 0.0665 0.0801 0.0235 -0.0048 0.0081 4.0198 3.5495 7.5413 -0.5037 -0.2204 0.7581 0.2432 -0.1483 -0.0949 0.3657 -0.2139 -0.0804 -0.0952 0.3272 0.0167 'X-RAY DIFFRACTION' 4 ? refined -3.9980 19.6941 -29.8204 0.1906 0.1127 0.1053 0.0466 0.0699 -0.0018 3.8986 6.1102 1.2393 -3.0750 2.0027 -0.8831 0.1337 -0.1622 0.0286 0.2436 -0.0952 0.2883 -0.4505 0.0439 0.0655 'X-RAY DIFFRACTION' 5 ? refined -2.8566 19.9392 -28.8634 0.1278 0.1427 0.1051 0.0350 0.0344 0.0324 2.2442 6.8196 2.0191 -2.6904 0.5648 -0.1055 0.0945 -0.0559 -0.0386 0.1785 0.0805 0.0410 -0.1500 -0.1827 -0.0559 'X-RAY DIFFRACTION' 6 ? refined -2.2439 19.0941 -15.8201 0.0644 0.0665 0.1031 0.0116 0.0637 0.0139 3.5640 3.3205 7.1939 0.8636 0.1110 0.7036 0.2631 -0.0846 -0.1784 -0.2489 0.3941 -0.0029 0.0611 -0.4111 0.0089 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 1 A 12 ? ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 B 1 B 12 ? ? ? ? ? ? 'X-RAY DIFFRACTION' 3 3 C 134 C 1002 ? ? ? ? ? ? 'X-RAY DIFFRACTION' 4 4 D 1 D 12 ? ? ? ? ? ? 'X-RAY DIFFRACTION' 5 5 E 1 E 12 ? ? ? ? ? ? 'X-RAY DIFFRACTION' 6 6 F 134 F 1002 ? ? ? ? ? ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 C GLY 132 ? C GLY 1 2 1 Y 1 C LYS 133 ? C LYS 2 3 1 Y 1 C GLY 180 ? C GLY 49 4 1 Y 1 F GLY 132 ? F GLY 1 5 1 Y 1 F LYS 133 ? F LYS 2 6 1 Y 1 F LYS 178 ? F LYS 47 7 1 Y 1 F PRO 179 ? F PRO 48 8 1 Y 1 F GLY 180 ? F GLY 49 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ARG N N N N 1 ARG CA C N S 2 ARG C C N N 3 ARG O O N N 4 ARG CB C N N 5 ARG CG C N N 6 ARG CD C N N 7 ARG NE N N N 8 ARG CZ C N N 9 ARG NH1 N N N 10 ARG NH2 N N N 11 ARG OXT O N N 12 ARG H H N N 13 ARG H2 H N N 14 ARG HA H N N 15 ARG HB2 H N N 16 ARG HB3 H N N 17 ARG HG2 H N N 18 ARG HG3 H N N 19 ARG HD2 H N N 20 ARG HD3 H N N 21 ARG HE H N N 22 ARG HH11 H N N 23 ARG HH12 H N N 24 ARG HH21 H N N 25 ARG HH22 H N N 26 ARG HXT H N N 27 ASN N N N N 28 ASN CA C N S 29 ASN C C N N 30 ASN O O N N 31 ASN CB C N N 32 ASN CG C N N 33 ASN OD1 O N N 34 ASN ND2 N N N 35 ASN OXT O N N 36 ASN H H N N 37 ASN H2 H N N 38 ASN HA H N N 39 ASN HB2 H N N 40 ASN HB3 H N N 41 ASN HD21 H N N 42 ASN HD22 H N N 43 ASN HXT H N N 44 CYS N N N N 45 CYS CA C N R 46 CYS C C N N 47 CYS O O N N 48 CYS CB C N N 49 CYS SG S N N 50 CYS OXT O N N 51 CYS H H N N 52 CYS H2 H N N 53 CYS HA H N N 54 CYS HB2 H N N 55 CYS HB3 H N N 56 CYS HG H N N 57 CYS HXT H N N 58 DA OP3 O N N 59 DA P P N N 60 DA OP1 O N N 61 DA OP2 O N N 62 DA "O5'" O N N 63 DA "C5'" C N N 64 DA "C4'" C N R 65 DA "O4'" O N N 66 DA "C3'" C N S 67 DA "O3'" O N N 68 DA "C2'" C N N 69 DA "C1'" C N R 70 DA N9 N Y N 71 DA C8 C Y N 72 DA N7 N Y N 73 DA C5 C Y N 74 DA C6 C Y N 75 DA N6 N N N 76 DA N1 N Y N 77 DA C2 C Y N 78 DA N3 N Y N 79 DA C4 C Y N 80 DA HOP3 H N N 81 DA HOP2 H N N 82 DA "H5'" H N N 83 DA "H5''" H N N 84 DA "H4'" H N N 85 DA "H3'" H N N 86 DA "HO3'" H N N 87 DA "H2'" H N N 88 DA "H2''" H N N 89 DA "H1'" H N N 90 DA H8 H N N 91 DA H61 H N N 92 DA H62 H N N 93 DA H2 H N N 94 DC OP3 O N N 95 DC P P N N 96 DC OP1 O N N 97 DC OP2 O N N 98 DC "O5'" O N N 99 DC "C5'" C N N 100 DC "C4'" C N R 101 DC "O4'" O N N 102 DC "C3'" C N S 103 DC "O3'" O N N 104 DC "C2'" C N N 105 DC "C1'" C N R 106 DC N1 N N N 107 DC C2 C N N 108 DC O2 O N N 109 DC N3 N N N 110 DC C4 C N N 111 DC N4 N N N 112 DC C5 C N N 113 DC C6 C N N 114 DC HOP3 H N N 115 DC HOP2 H N N 116 DC "H5'" H N N 117 DC "H5''" H N N 118 DC "H4'" H N N 119 DC "H3'" H N N 120 DC "HO3'" H N N 121 DC "H2'" H N N 122 DC "H2''" H N N 123 DC "H1'" H N N 124 DC H41 H N N 125 DC H42 H N N 126 DC H5 H N N 127 DC H6 H N N 128 DG OP3 O N N 129 DG P P N N 130 DG OP1 O N N 131 DG OP2 O N N 132 DG "O5'" O N N 133 DG "C5'" C N N 134 DG "C4'" C N R 135 DG "O4'" O N N 136 DG "C3'" C N S 137 DG "O3'" O N N 138 DG "C2'" C N N 139 DG "C1'" C N R 140 DG N9 N Y N 141 DG C8 C Y N 142 DG N7 N Y N 143 DG C5 C Y N 144 DG C6 C N N 145 DG O6 O N N 146 DG N1 N N N 147 DG C2 C N N 148 DG N2 N N N 149 DG N3 N N N 150 DG C4 C Y N 151 DG HOP3 H N N 152 DG HOP2 H N N 153 DG "H5'" H N N 154 DG "H5''" H N N 155 DG "H4'" H N N 156 DG "H3'" H N N 157 DG "HO3'" H N N 158 DG "H2'" H N N 159 DG "H2''" H N N 160 DG "H1'" H N N 161 DG H8 H N N 162 DG H1 H N N 163 DG H21 H N N 164 DG H22 H N N 165 DT OP3 O N N 166 DT P P N N 167 DT OP1 O N N 168 DT OP2 O N N 169 DT "O5'" O N N 170 DT "C5'" C N N 171 DT "C4'" C N R 172 DT "O4'" O N N 173 DT "C3'" C N S 174 DT "O3'" O N N 175 DT "C2'" C N N 176 DT "C1'" C N R 177 DT N1 N N N 178 DT C2 C N N 179 DT O2 O N N 180 DT N3 N N N 181 DT C4 C N N 182 DT O4 O N N 183 DT C5 C N N 184 DT C7 C N N 185 DT C6 C N N 186 DT HOP3 H N N 187 DT HOP2 H N N 188 DT "H5'" H N N 189 DT "H5''" H N N 190 DT "H4'" H N N 191 DT "H3'" H N N 192 DT "HO3'" H N N 193 DT "H2'" H N N 194 DT "H2''" H N N 195 DT "H1'" H N N 196 DT H3 H N N 197 DT H71 H N N 198 DT H72 H N N 199 DT H73 H N N 200 DT H6 H N N 201 GLN N N N N 202 GLN CA C N S 203 GLN C C N N 204 GLN O O N N 205 GLN CB C N N 206 GLN CG C N N 207 GLN CD C N N 208 GLN OE1 O N N 209 GLN NE2 N N N 210 GLN OXT O N N 211 GLN H H N N 212 GLN H2 H N N 213 GLN HA H N N 214 GLN HB2 H N N 215 GLN HB3 H N N 216 GLN HG2 H N N 217 GLN HG3 H N N 218 GLN HE21 H N N 219 GLN HE22 H N N 220 GLN HXT H N N 221 GLU N N N N 222 GLU CA C N S 223 GLU C C N N 224 GLU O O N N 225 GLU CB C N N 226 GLU CG C N N 227 GLU CD C N N 228 GLU OE1 O N N 229 GLU OE2 O N N 230 GLU OXT O N N 231 GLU H H N N 232 GLU H2 H N N 233 GLU HA H N N 234 GLU HB2 H N N 235 GLU HB3 H N N 236 GLU HG2 H N N 237 GLU HG3 H N N 238 GLU HE2 H N N 239 GLU HXT H N N 240 GLY N N N N 241 GLY CA C N N 242 GLY C C N N 243 GLY O O N N 244 GLY OXT O N N 245 GLY H H N N 246 GLY H2 H N N 247 GLY HA2 H N N 248 GLY HA3 H N N 249 GLY HXT H N N 250 HIS N N N N 251 HIS CA C N S 252 HIS C C N N 253 HIS O O N N 254 HIS CB C N N 255 HIS CG C Y N 256 HIS ND1 N Y N 257 HIS CD2 C Y N 258 HIS CE1 C Y N 259 HIS NE2 N Y N 260 HIS OXT O N N 261 HIS H H N N 262 HIS H2 H N N 263 HIS HA H N N 264 HIS HB2 H N N 265 HIS HB3 H N N 266 HIS HD1 H N N 267 HIS HD2 H N N 268 HIS HE1 H N N 269 HIS HE2 H N N 270 HIS HXT H N N 271 HOH O O N N 272 HOH H1 H N N 273 HOH H2 H N N 274 ILE N N N N 275 ILE CA C N S 276 ILE C C N N 277 ILE O O N N 278 ILE CB C N S 279 ILE CG1 C N N 280 ILE CG2 C N N 281 ILE CD1 C N N 282 ILE OXT O N N 283 ILE H H N N 284 ILE H2 H N N 285 ILE HA H N N 286 ILE HB H N N 287 ILE HG12 H N N 288 ILE HG13 H N N 289 ILE HG21 H N N 290 ILE HG22 H N N 291 ILE HG23 H N N 292 ILE HD11 H N N 293 ILE HD12 H N N 294 ILE HD13 H N N 295 ILE HXT H N N 296 LEU N N N N 297 LEU CA C N S 298 LEU C C N N 299 LEU O O N N 300 LEU CB C N N 301 LEU CG C N N 302 LEU CD1 C N N 303 LEU CD2 C N N 304 LEU OXT O N N 305 LEU H H N N 306 LEU H2 H N N 307 LEU HA H N N 308 LEU HB2 H N N 309 LEU HB3 H N N 310 LEU HG H N N 311 LEU HD11 H N N 312 LEU HD12 H N N 313 LEU HD13 H N N 314 LEU HD21 H N N 315 LEU HD22 H N N 316 LEU HD23 H N N 317 LEU HXT H N N 318 LYS N N N N 319 LYS CA C N S 320 LYS C C N N 321 LYS O O N N 322 LYS CB C N N 323 LYS CG C N N 324 LYS CD C N N 325 LYS CE C N N 326 LYS NZ N N N 327 LYS OXT O N N 328 LYS H H N N 329 LYS H2 H N N 330 LYS HA H N N 331 LYS HB2 H N N 332 LYS HB3 H N N 333 LYS HG2 H N N 334 LYS HG3 H N N 335 LYS HD2 H N N 336 LYS HD3 H N N 337 LYS HE2 H N N 338 LYS HE3 H N N 339 LYS HZ1 H N N 340 LYS HZ2 H N N 341 LYS HZ3 H N N 342 LYS HXT H N N 343 PHE N N N N 344 PHE CA C N S 345 PHE C C N N 346 PHE O O N N 347 PHE CB C N N 348 PHE CG C Y N 349 PHE CD1 C Y N 350 PHE CD2 C Y N 351 PHE CE1 C Y N 352 PHE CE2 C Y N 353 PHE CZ C Y N 354 PHE OXT O N N 355 PHE H H N N 356 PHE H2 H N N 357 PHE HA H N N 358 PHE HB2 H N N 359 PHE HB3 H N N 360 PHE HD1 H N N 361 PHE HD2 H N N 362 PHE HE1 H N N 363 PHE HE2 H N N 364 PHE HZ H N N 365 PHE HXT H N N 366 PRO N N N N 367 PRO CA C N S 368 PRO C C N N 369 PRO O O N N 370 PRO CB C N N 371 PRO CG C N N 372 PRO CD C N N 373 PRO OXT O N N 374 PRO H H N N 375 PRO HA H N N 376 PRO HB2 H N N 377 PRO HB3 H N N 378 PRO HG2 H N N 379 PRO HG3 H N N 380 PRO HD2 H N N 381 PRO HD3 H N N 382 PRO HXT H N N 383 SER N N N N 384 SER CA C N S 385 SER C C N N 386 SER O O N N 387 SER CB C N N 388 SER OG O N N 389 SER OXT O N N 390 SER H H N N 391 SER H2 H N N 392 SER HA H N N 393 SER HB2 H N N 394 SER HB3 H N N 395 SER HG H N N 396 SER HXT H N N 397 THR N N N N 398 THR CA C N S 399 THR C C N N 400 THR O O N N 401 THR CB C N R 402 THR OG1 O N N 403 THR CG2 C N N 404 THR OXT O N N 405 THR H H N N 406 THR H2 H N N 407 THR HA H N N 408 THR HB H N N 409 THR HG1 H N N 410 THR HG21 H N N 411 THR HG22 H N N 412 THR HG23 H N N 413 THR HXT H N N 414 VAL N N N N 415 VAL CA C N S 416 VAL C C N N 417 VAL O O N N 418 VAL CB C N N 419 VAL CG1 C N N 420 VAL CG2 C N N 421 VAL OXT O N N 422 VAL H H N N 423 VAL H2 H N N 424 VAL HA H N N 425 VAL HB H N N 426 VAL HG11 H N N 427 VAL HG12 H N N 428 VAL HG13 H N N 429 VAL HG21 H N N 430 VAL HG22 H N N 431 VAL HG23 H N N 432 VAL HXT H N N 433 ZN ZN ZN N N 434 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ARG N CA sing N N 1 ARG N H sing N N 2 ARG N H2 sing N N 3 ARG CA C sing N N 4 ARG CA CB sing N N 5 ARG CA HA sing N N 6 ARG C O doub N N 7 ARG C OXT sing N N 8 ARG CB CG sing N N 9 ARG CB HB2 sing N N 10 ARG CB HB3 sing N N 11 ARG CG CD sing N N 12 ARG CG HG2 sing N N 13 ARG CG HG3 sing N N 14 ARG CD NE sing N N 15 ARG CD HD2 sing N N 16 ARG CD HD3 sing N N 17 ARG NE CZ sing N N 18 ARG NE HE sing N N 19 ARG CZ NH1 sing N N 20 ARG CZ NH2 doub N N 21 ARG NH1 HH11 sing N N 22 ARG NH1 HH12 sing N N 23 ARG NH2 HH21 sing N N 24 ARG NH2 HH22 sing N N 25 ARG OXT HXT sing N N 26 ASN N CA sing N N 27 ASN N H sing N N 28 ASN N H2 sing N N 29 ASN CA C sing N N 30 ASN CA CB sing N N 31 ASN CA HA sing N N 32 ASN C O doub N N 33 ASN C OXT sing N N 34 ASN CB CG sing N N 35 ASN CB HB2 sing N N 36 ASN CB HB3 sing N N 37 ASN CG OD1 doub N N 38 ASN CG ND2 sing N N 39 ASN ND2 HD21 sing N N 40 ASN ND2 HD22 sing N N 41 ASN OXT HXT sing N N 42 CYS N CA sing N N 43 CYS N H sing N N 44 CYS N H2 sing N N 45 CYS CA C sing N N 46 CYS CA CB sing N N 47 CYS CA HA sing N N 48 CYS C O doub N N 49 CYS C OXT sing N N 50 CYS CB SG sing N N 51 CYS CB HB2 sing N N 52 CYS CB HB3 sing N N 53 CYS SG HG sing N N 54 CYS OXT HXT sing N N 55 DA OP3 P sing N N 56 DA OP3 HOP3 sing N N 57 DA P OP1 doub N N 58 DA P OP2 sing N N 59 DA P "O5'" sing N N 60 DA OP2 HOP2 sing N N 61 DA "O5'" "C5'" sing N N 62 DA "C5'" "C4'" sing N N 63 DA "C5'" "H5'" sing N N 64 DA "C5'" "H5''" sing N N 65 DA "C4'" "O4'" sing N N 66 DA "C4'" "C3'" sing N N 67 DA "C4'" "H4'" sing N N 68 DA "O4'" "C1'" sing N N 69 DA "C3'" "O3'" sing N N 70 DA "C3'" "C2'" sing N N 71 DA "C3'" "H3'" sing N N 72 DA "O3'" "HO3'" sing N N 73 DA "C2'" "C1'" sing N N 74 DA "C2'" "H2'" sing N N 75 DA "C2'" "H2''" sing N N 76 DA "C1'" N9 sing N N 77 DA "C1'" "H1'" sing N N 78 DA N9 C8 sing Y N 79 DA N9 C4 sing Y N 80 DA C8 N7 doub Y N 81 DA C8 H8 sing N N 82 DA N7 C5 sing Y N 83 DA C5 C6 sing Y N 84 DA C5 C4 doub Y N 85 DA C6 N6 sing N N 86 DA C6 N1 doub Y N 87 DA N6 H61 sing N N 88 DA N6 H62 sing N N 89 DA N1 C2 sing Y N 90 DA C2 N3 doub Y N 91 DA C2 H2 sing N N 92 DA N3 C4 sing Y N 93 DC OP3 P sing N N 94 DC OP3 HOP3 sing N N 95 DC P OP1 doub N N 96 DC P OP2 sing N N 97 DC P "O5'" sing N N 98 DC OP2 HOP2 sing N N 99 DC "O5'" "C5'" sing N N 100 DC "C5'" "C4'" sing N N 101 DC "C5'" "H5'" sing N N 102 DC "C5'" "H5''" sing N N 103 DC "C4'" "O4'" sing N N 104 DC "C4'" "C3'" sing N N 105 DC "C4'" "H4'" sing N N 106 DC "O4'" "C1'" sing N N 107 DC "C3'" "O3'" sing N N 108 DC "C3'" "C2'" sing N N 109 DC "C3'" "H3'" sing N N 110 DC "O3'" "HO3'" sing N N 111 DC "C2'" "C1'" sing N N 112 DC "C2'" "H2'" sing N N 113 DC "C2'" "H2''" sing N N 114 DC "C1'" N1 sing N N 115 DC "C1'" "H1'" sing N N 116 DC N1 C2 sing N N 117 DC N1 C6 sing N N 118 DC C2 O2 doub N N 119 DC C2 N3 sing N N 120 DC N3 C4 doub N N 121 DC C4 N4 sing N N 122 DC C4 C5 sing N N 123 DC N4 H41 sing N N 124 DC N4 H42 sing N N 125 DC C5 C6 doub N N 126 DC C5 H5 sing N N 127 DC C6 H6 sing N N 128 DG OP3 P sing N N 129 DG OP3 HOP3 sing N N 130 DG P OP1 doub N N 131 DG P OP2 sing N N 132 DG P "O5'" sing N N 133 DG OP2 HOP2 sing N N 134 DG "O5'" "C5'" sing N N 135 DG "C5'" "C4'" sing N N 136 DG "C5'" "H5'" sing N N 137 DG "C5'" "H5''" sing N N 138 DG "C4'" "O4'" sing N N 139 DG "C4'" "C3'" sing N N 140 DG "C4'" "H4'" sing N N 141 DG "O4'" "C1'" sing N N 142 DG "C3'" "O3'" sing N N 143 DG "C3'" "C2'" sing N N 144 DG "C3'" "H3'" sing N N 145 DG "O3'" "HO3'" sing N N 146 DG "C2'" "C1'" sing N N 147 DG "C2'" "H2'" sing N N 148 DG "C2'" "H2''" sing N N 149 DG "C1'" N9 sing N N 150 DG "C1'" "H1'" sing N N 151 DG N9 C8 sing Y N 152 DG N9 C4 sing Y N 153 DG C8 N7 doub Y N 154 DG C8 H8 sing N N 155 DG N7 C5 sing Y N 156 DG C5 C6 sing N N 157 DG C5 C4 doub Y N 158 DG C6 O6 doub N N 159 DG C6 N1 sing N N 160 DG N1 C2 sing N N 161 DG N1 H1 sing N N 162 DG C2 N2 sing N N 163 DG C2 N3 doub N N 164 DG N2 H21 sing N N 165 DG N2 H22 sing N N 166 DG N3 C4 sing N N 167 DT OP3 P sing N N 168 DT OP3 HOP3 sing N N 169 DT P OP1 doub N N 170 DT P OP2 sing N N 171 DT P "O5'" sing N N 172 DT OP2 HOP2 sing N N 173 DT "O5'" "C5'" sing N N 174 DT "C5'" "C4'" sing N N 175 DT "C5'" "H5'" sing N N 176 DT "C5'" "H5''" sing N N 177 DT "C4'" "O4'" sing N N 178 DT "C4'" "C3'" sing N N 179 DT "C4'" "H4'" sing N N 180 DT "O4'" "C1'" sing N N 181 DT "C3'" "O3'" sing N N 182 DT "C3'" "C2'" sing N N 183 DT "C3'" "H3'" sing N N 184 DT "O3'" "HO3'" sing N N 185 DT "C2'" "C1'" sing N N 186 DT "C2'" "H2'" sing N N 187 DT "C2'" "H2''" sing N N 188 DT "C1'" N1 sing N N 189 DT "C1'" "H1'" sing N N 190 DT N1 C2 sing N N 191 DT N1 C6 sing N N 192 DT C2 O2 doub N N 193 DT C2 N3 sing N N 194 DT N3 C4 sing N N 195 DT N3 H3 sing N N 196 DT C4 O4 doub N N 197 DT C4 C5 sing N N 198 DT C5 C7 sing N N 199 DT C5 C6 doub N N 200 DT C7 H71 sing N N 201 DT C7 H72 sing N N 202 DT C7 H73 sing N N 203 DT C6 H6 sing N N 204 GLN N CA sing N N 205 GLN N H sing N N 206 GLN N H2 sing N N 207 GLN CA C sing N N 208 GLN CA CB sing N N 209 GLN CA HA sing N N 210 GLN C O doub N N 211 GLN C OXT sing N N 212 GLN CB CG sing N N 213 GLN CB HB2 sing N N 214 GLN CB HB3 sing N N 215 GLN CG CD sing N N 216 GLN CG HG2 sing N N 217 GLN CG HG3 sing N N 218 GLN CD OE1 doub N N 219 GLN CD NE2 sing N N 220 GLN NE2 HE21 sing N N 221 GLN NE2 HE22 sing N N 222 GLN OXT HXT sing N N 223 GLU N CA sing N N 224 GLU N H sing N N 225 GLU N H2 sing N N 226 GLU CA C sing N N 227 GLU CA CB sing N N 228 GLU CA HA sing N N 229 GLU C O doub N N 230 GLU C OXT sing N N 231 GLU CB CG sing N N 232 GLU CB HB2 sing N N 233 GLU CB HB3 sing N N 234 GLU CG CD sing N N 235 GLU CG HG2 sing N N 236 GLU CG HG3 sing N N 237 GLU CD OE1 doub N N 238 GLU CD OE2 sing N N 239 GLU OE2 HE2 sing N N 240 GLU OXT HXT sing N N 241 GLY N CA sing N N 242 GLY N H sing N N 243 GLY N H2 sing N N 244 GLY CA C sing N N 245 GLY CA HA2 sing N N 246 GLY CA HA3 sing N N 247 GLY C O doub N N 248 GLY C OXT sing N N 249 GLY OXT HXT sing N N 250 HIS N CA sing N N 251 HIS N H sing N N 252 HIS N H2 sing N N 253 HIS CA C sing N N 254 HIS CA CB sing N N 255 HIS CA HA sing N N 256 HIS C O doub N N 257 HIS C OXT sing N N 258 HIS CB CG sing N N 259 HIS CB HB2 sing N N 260 HIS CB HB3 sing N N 261 HIS CG ND1 sing Y N 262 HIS CG CD2 doub Y N 263 HIS ND1 CE1 doub Y N 264 HIS ND1 HD1 sing N N 265 HIS CD2 NE2 sing Y N 266 HIS CD2 HD2 sing N N 267 HIS CE1 NE2 sing Y N 268 HIS CE1 HE1 sing N N 269 HIS NE2 HE2 sing N N 270 HIS OXT HXT sing N N 271 HOH O H1 sing N N 272 HOH O H2 sing N N 273 ILE N CA sing N N 274 ILE N H sing N N 275 ILE N H2 sing N N 276 ILE CA C sing N N 277 ILE CA CB sing N N 278 ILE CA HA sing N N 279 ILE C O doub N N 280 ILE C OXT sing N N 281 ILE CB CG1 sing N N 282 ILE CB CG2 sing N N 283 ILE CB HB sing N N 284 ILE CG1 CD1 sing N N 285 ILE CG1 HG12 sing N N 286 ILE CG1 HG13 sing N N 287 ILE CG2 HG21 sing N N 288 ILE CG2 HG22 sing N N 289 ILE CG2 HG23 sing N N 290 ILE CD1 HD11 sing N N 291 ILE CD1 HD12 sing N N 292 ILE CD1 HD13 sing N N 293 ILE OXT HXT sing N N 294 LEU N CA sing N N 295 LEU N H sing N N 296 LEU N H2 sing N N 297 LEU CA C sing N N 298 LEU CA CB sing N N 299 LEU CA HA sing N N 300 LEU C O doub N N 301 LEU C OXT sing N N 302 LEU CB CG sing N N 303 LEU CB HB2 sing N N 304 LEU CB HB3 sing N N 305 LEU CG CD1 sing N N 306 LEU CG CD2 sing N N 307 LEU CG HG sing N N 308 LEU CD1 HD11 sing N N 309 LEU CD1 HD12 sing N N 310 LEU CD1 HD13 sing N N 311 LEU CD2 HD21 sing N N 312 LEU CD2 HD22 sing N N 313 LEU CD2 HD23 sing N N 314 LEU OXT HXT sing N N 315 LYS N CA sing N N 316 LYS N H sing N N 317 LYS N H2 sing N N 318 LYS CA C sing N N 319 LYS CA CB sing N N 320 LYS CA HA sing N N 321 LYS C O doub N N 322 LYS C OXT sing N N 323 LYS CB CG sing N N 324 LYS CB HB2 sing N N 325 LYS CB HB3 sing N N 326 LYS CG CD sing N N 327 LYS CG HG2 sing N N 328 LYS CG HG3 sing N N 329 LYS CD CE sing N N 330 LYS CD HD2 sing N N 331 LYS CD HD3 sing N N 332 LYS CE NZ sing N N 333 LYS CE HE2 sing N N 334 LYS CE HE3 sing N N 335 LYS NZ HZ1 sing N N 336 LYS NZ HZ2 sing N N 337 LYS NZ HZ3 sing N N 338 LYS OXT HXT sing N N 339 PHE N CA sing N N 340 PHE N H sing N N 341 PHE N H2 sing N N 342 PHE CA C sing N N 343 PHE CA CB sing N N 344 PHE CA HA sing N N 345 PHE C O doub N N 346 PHE C OXT sing N N 347 PHE CB CG sing N N 348 PHE CB HB2 sing N N 349 PHE CB HB3 sing N N 350 PHE CG CD1 doub Y N 351 PHE CG CD2 sing Y N 352 PHE CD1 CE1 sing Y N 353 PHE CD1 HD1 sing N N 354 PHE CD2 CE2 doub Y N 355 PHE CD2 HD2 sing N N 356 PHE CE1 CZ doub Y N 357 PHE CE1 HE1 sing N N 358 PHE CE2 CZ sing Y N 359 PHE CE2 HE2 sing N N 360 PHE CZ HZ sing N N 361 PHE OXT HXT sing N N 362 PRO N CA sing N N 363 PRO N CD sing N N 364 PRO N H sing N N 365 PRO CA C sing N N 366 PRO CA CB sing N N 367 PRO CA HA sing N N 368 PRO C O doub N N 369 PRO C OXT sing N N 370 PRO CB CG sing N N 371 PRO CB HB2 sing N N 372 PRO CB HB3 sing N N 373 PRO CG CD sing N N 374 PRO CG HG2 sing N N 375 PRO CG HG3 sing N N 376 PRO CD HD2 sing N N 377 PRO CD HD3 sing N N 378 PRO OXT HXT sing N N 379 SER N CA sing N N 380 SER N H sing N N 381 SER N H2 sing N N 382 SER CA C sing N N 383 SER CA CB sing N N 384 SER CA HA sing N N 385 SER C O doub N N 386 SER C OXT sing N N 387 SER CB OG sing N N 388 SER CB HB2 sing N N 389 SER CB HB3 sing N N 390 SER OG HG sing N N 391 SER OXT HXT sing N N 392 THR N CA sing N N 393 THR N H sing N N 394 THR N H2 sing N N 395 THR CA C sing N N 396 THR CA CB sing N N 397 THR CA HA sing N N 398 THR C O doub N N 399 THR C OXT sing N N 400 THR CB OG1 sing N N 401 THR CB CG2 sing N N 402 THR CB HB sing N N 403 THR OG1 HG1 sing N N 404 THR CG2 HG21 sing N N 405 THR CG2 HG22 sing N N 406 THR CG2 HG23 sing N N 407 THR OXT HXT sing N N 408 VAL N CA sing N N 409 VAL N H sing N N 410 VAL N H2 sing N N 411 VAL CA C sing N N 412 VAL CA CB sing N N 413 VAL CA HA sing N N 414 VAL C O doub N N 415 VAL C OXT sing N N 416 VAL CB CG1 sing N N 417 VAL CB CG2 sing N N 418 VAL CB HB sing N N 419 VAL CG1 HG11 sing N N 420 VAL CG1 HG12 sing N N 421 VAL CG1 HG13 sing N N 422 VAL CG2 HG21 sing N N 423 VAL CG2 HG22 sing N N 424 VAL CG2 HG23 sing N N 425 VAL OXT HXT sing N N 426 # _ndb_struct_conf_na.entry_id 5VC9 _ndb_struct_conf_na.feature 'b-form double helix' # loop_ _ndb_struct_na_base_pair.model_number _ndb_struct_na_base_pair.i_label_asym_id _ndb_struct_na_base_pair.i_label_comp_id _ndb_struct_na_base_pair.i_label_seq_id _ndb_struct_na_base_pair.i_symmetry _ndb_struct_na_base_pair.j_label_asym_id _ndb_struct_na_base_pair.j_label_comp_id _ndb_struct_na_base_pair.j_label_seq_id _ndb_struct_na_base_pair.j_symmetry _ndb_struct_na_base_pair.shear _ndb_struct_na_base_pair.stretch _ndb_struct_na_base_pair.stagger _ndb_struct_na_base_pair.buckle _ndb_struct_na_base_pair.propeller _ndb_struct_na_base_pair.opening _ndb_struct_na_base_pair.pair_number _ndb_struct_na_base_pair.pair_name _ndb_struct_na_base_pair.i_auth_asym_id _ndb_struct_na_base_pair.i_auth_seq_id _ndb_struct_na_base_pair.i_PDB_ins_code _ndb_struct_na_base_pair.j_auth_asym_id _ndb_struct_na_base_pair.j_auth_seq_id _ndb_struct_na_base_pair.j_PDB_ins_code _ndb_struct_na_base_pair.hbond_type_28 _ndb_struct_na_base_pair.hbond_type_12 1 A DG 1 1_555 B DC 12 1_555 -0.055 -0.074 -0.038 2.741 -6.641 -0.623 1 A_DG1:DC12_B A 1 ? B 12 ? 19 1 1 A DC 2 1_555 B DG 11 1_555 0.041 -0.130 0.111 -6.143 -11.928 0.912 2 A_DC2:DG11_B A 2 ? B 11 ? 19 1 1 A DC 3 1_555 B DG 10 1_555 0.331 -0.243 0.160 -3.934 -5.958 -2.992 3 A_DC3:DG10_B A 3 ? B 10 ? 19 1 1 A DA 4 1_555 B DT 9 1_555 -0.204 -0.199 -0.073 -6.360 -6.589 0.824 4 A_DA4:DT9_B A 4 ? B 9 ? 20 1 1 A DA 5 1_555 B DT 8 1_555 0.058 -0.050 0.017 2.807 -8.523 3.481 5 A_DA5:DT8_B A 5 ? B 8 ? 20 1 1 A DC 6 1_555 B DG 7 1_555 -0.048 -0.135 -0.005 -1.439 -8.744 -3.498 6 A_DC6:DG7_B A 6 ? B 7 ? 19 1 1 A DG 7 1_555 B DC 6 1_555 0.066 -0.159 0.130 -2.224 -0.428 0.309 7 A_DG7:DC6_B A 7 ? B 6 ? 19 1 1 A DT 8 1_555 B DA 5 1_555 -0.388 -0.114 0.321 1.906 -2.155 -0.716 8 A_DT8:DA5_B A 8 ? B 5 ? 20 1 1 A DT 9 1_555 B DA 4 1_555 0.124 -0.055 -0.198 9.924 -11.242 2.167 9 A_DT9:DA4_B A 9 ? B 4 ? 20 1 1 A DG 10 1_555 B DC 3 1_555 -0.798 -0.029 0.229 4.158 -10.316 0.076 10 A_DG10:DC3_B A 10 ? B 3 ? 19 1 1 A DG 11 1_555 B DC 2 1_555 0.032 0.055 0.155 7.102 -10.723 -3.334 11 A_DG11:DC2_B A 11 ? B 2 ? 19 1 1 A DC 12 1_555 B DG 1 1_555 0.123 -0.064 -0.324 3.572 -8.307 2.757 12 A_DC12:DG1_B A 12 ? B 1 ? 19 1 1 D DG 1 1_555 E DC 12 1_555 -0.125 -0.118 -0.348 1.084 -4.882 1.103 13 D_DG1:DC12_E D 1 ? E 12 ? 19 1 1 D DC 2 1_555 E DG 11 1_555 0.170 0.033 -0.084 -2.811 -11.463 1.941 14 D_DC2:DG11_E D 2 ? E 11 ? 19 1 1 D DC 3 1_555 E DG 10 1_555 0.063 -0.235 0.116 -3.995 -9.673 -4.412 15 D_DC3:DG10_E D 3 ? E 10 ? 19 1 1 D DA 4 1_555 E DT 9 1_555 -0.384 -0.203 -0.131 -5.343 -3.583 0.747 16 D_DA4:DT9_E D 4 ? E 9 ? 20 1 1 D DA 5 1_555 E DT 8 1_555 0.124 -0.088 -0.051 0.803 -7.052 6.576 17 D_DA5:DT8_E D 5 ? E 8 ? 20 1 1 D DC 6 1_555 E DG 7 1_555 0.028 -0.180 -0.058 -1.858 -8.833 -3.045 18 D_DC6:DG7_E D 6 ? E 7 ? 19 1 1 D DG 7 1_555 E DC 6 1_555 -0.027 -0.201 0.117 -5.211 0.445 -1.347 19 D_DG7:DC6_E D 7 ? E 6 ? 19 1 1 D DT 8 1_555 E DA 5 1_555 0.122 -0.177 0.270 2.994 -6.005 -0.009 20 D_DT8:DA5_E D 8 ? E 5 ? 20 1 1 D DT 9 1_555 E DA 4 1_555 -0.460 0.044 -0.194 9.619 -11.458 -1.415 21 D_DT9:DA4_E D 9 ? E 4 ? 20 1 1 D DG 10 1_555 E DC 3 1_555 -0.392 -0.141 0.303 5.034 -9.097 -1.853 22 D_DG10:DC3_E D 10 ? E 3 ? 19 1 1 D DG 11 1_555 E DC 2 1_555 -0.092 -0.128 0.307 10.026 -7.467 -3.950 23 D_DG11:DC2_E D 11 ? E 2 ? 19 1 1 D DC 12 1_555 E DG 1 1_555 0.297 -0.148 -0.192 0.505 -6.033 1.232 24 D_DC12:DG1_E D 12 ? E 1 ? 19 1 # loop_ _ndb_struct_na_base_pair_step.model_number _ndb_struct_na_base_pair_step.i_label_asym_id_1 _ndb_struct_na_base_pair_step.i_label_comp_id_1 _ndb_struct_na_base_pair_step.i_label_seq_id_1 _ndb_struct_na_base_pair_step.i_symmetry_1 _ndb_struct_na_base_pair_step.j_label_asym_id_1 _ndb_struct_na_base_pair_step.j_label_comp_id_1 _ndb_struct_na_base_pair_step.j_label_seq_id_1 _ndb_struct_na_base_pair_step.j_symmetry_1 _ndb_struct_na_base_pair_step.i_label_asym_id_2 _ndb_struct_na_base_pair_step.i_label_comp_id_2 _ndb_struct_na_base_pair_step.i_label_seq_id_2 _ndb_struct_na_base_pair_step.i_symmetry_2 _ndb_struct_na_base_pair_step.j_label_asym_id_2 _ndb_struct_na_base_pair_step.j_label_comp_id_2 _ndb_struct_na_base_pair_step.j_label_seq_id_2 _ndb_struct_na_base_pair_step.j_symmetry_2 _ndb_struct_na_base_pair_step.shift _ndb_struct_na_base_pair_step.slide _ndb_struct_na_base_pair_step.rise _ndb_struct_na_base_pair_step.tilt _ndb_struct_na_base_pair_step.roll _ndb_struct_na_base_pair_step.twist _ndb_struct_na_base_pair_step.x_displacement _ndb_struct_na_base_pair_step.y_displacement _ndb_struct_na_base_pair_step.helical_rise _ndb_struct_na_base_pair_step.inclination _ndb_struct_na_base_pair_step.tip _ndb_struct_na_base_pair_step.helical_twist _ndb_struct_na_base_pair_step.step_number _ndb_struct_na_base_pair_step.step_name _ndb_struct_na_base_pair_step.i_auth_asym_id_1 _ndb_struct_na_base_pair_step.i_auth_seq_id_1 _ndb_struct_na_base_pair_step.i_PDB_ins_code_1 _ndb_struct_na_base_pair_step.j_auth_asym_id_1 _ndb_struct_na_base_pair_step.j_auth_seq_id_1 _ndb_struct_na_base_pair_step.j_PDB_ins_code_1 _ndb_struct_na_base_pair_step.i_auth_asym_id_2 _ndb_struct_na_base_pair_step.i_auth_seq_id_2 _ndb_struct_na_base_pair_step.i_PDB_ins_code_2 _ndb_struct_na_base_pair_step.j_auth_asym_id_2 _ndb_struct_na_base_pair_step.j_auth_seq_id_2 _ndb_struct_na_base_pair_step.j_PDB_ins_code_2 1 A DG 1 1_555 B DC 12 1_555 A DC 2 1_555 B DG 11 1_555 -0.620 -0.486 3.426 -1.531 -3.317 34.508 -0.276 0.792 3.480 -5.572 2.571 34.695 1 AA_DG1DC2:DG11DC12_BB A 1 ? B 12 ? A 2 ? B 11 ? 1 A DC 2 1_555 B DG 11 1_555 A DC 3 1_555 B DG 10 1_555 -0.094 0.342 3.291 0.821 8.807 31.957 -0.915 0.307 3.264 15.625 -1.457 33.128 2 AA_DC2DC3:DG10DG11_BB A 2 ? B 11 ? A 3 ? B 10 ? 1 A DC 3 1_555 B DG 10 1_555 A DA 4 1_555 B DT 9 1_555 0.027 1.636 3.338 0.573 -0.637 43.887 2.251 0.019 3.316 -0.853 -0.766 43.895 3 AA_DC3DA4:DT9DG10_BB A 3 ? B 10 ? A 4 ? B 9 ? 1 A DA 4 1_555 B DT 9 1_555 A DA 5 1_555 B DT 8 1_555 0.491 0.322 3.196 -2.795 8.755 27.228 -1.294 -1.611 3.084 17.961 5.734 28.710 4 AA_DA4DA5:DT8DT9_BB A 4 ? B 9 ? A 5 ? B 8 ? 1 A DA 5 1_555 B DT 8 1_555 A DC 6 1_555 B DG 7 1_555 -1.433 0.126 3.329 -3.404 -2.129 38.771 0.456 1.722 3.427 -3.196 5.110 38.971 5 AA_DA5DC6:DG7DT8_BB A 5 ? B 8 ? A 6 ? B 7 ? 1 A DC 6 1_555 B DG 7 1_555 A DG 7 1_555 B DC 6 1_555 -0.058 -0.032 3.378 -3.799 1.989 38.144 -0.306 -0.402 3.363 3.032 5.790 38.376 6 AA_DC6DG7:DC6DG7_BB A 6 ? B 7 ? A 7 ? B 6 ? 1 A DG 7 1_555 B DC 6 1_555 A DT 8 1_555 B DA 5 1_555 -0.381 -0.508 3.246 -1.103 0.009 27.834 -1.058 0.529 3.258 0.019 2.293 27.855 7 AA_DG7DT8:DA5DC6_BB A 7 ? B 6 ? A 8 ? B 5 ? 1 A DT 8 1_555 B DA 5 1_555 A DT 9 1_555 B DA 4 1_555 -0.198 0.322 3.088 5.117 4.543 32.428 -0.160 1.163 3.038 8.023 -9.038 33.123 8 AA_DT8DT9:DA4DA5_BB A 8 ? B 5 ? A 9 ? B 4 ? 1 A DT 9 1_555 B DA 4 1_555 A DG 10 1_555 B DC 3 1_555 0.124 2.418 3.359 0.277 -5.148 46.248 3.490 -0.133 3.088 -6.531 -0.351 46.519 9 AA_DT9DG10:DC3DA4_BB A 9 ? B 4 ? A 10 ? B 3 ? 1 A DG 10 1_555 B DC 3 1_555 A DG 11 1_555 B DC 2 1_555 0.339 0.607 3.278 -1.678 9.137 32.543 -0.471 -0.860 3.302 15.904 2.921 33.808 10 AA_DG10DG11:DC2DC3_BB A 10 ? B 3 ? A 11 ? B 2 ? 1 A DG 11 1_555 B DC 2 1_555 A DC 12 1_555 B DG 1 1_555 1.253 -0.402 3.255 5.447 -2.817 34.627 -0.232 -1.238 3.427 -4.688 -9.063 35.149 11 AA_DG11DC12:DG1DC2_BB A 11 ? B 2 ? A 12 ? B 1 ? 1 D DG 1 1_555 E DC 12 1_555 D DC 2 1_555 E DG 11 1_555 -0.821 -0.428 3.347 -2.995 -1.568 35.365 -0.463 0.892 3.418 -2.574 4.916 35.521 12 DD_DG1DC2:DG11DC12_EE D 1 ? E 12 ? D 2 ? E 11 ? 1 D DC 2 1_555 E DG 11 1_555 D DC 3 1_555 E DG 10 1_555 -0.449 0.317 3.379 -1.228 5.197 32.661 -0.359 0.573 3.402 9.164 2.166 33.083 13 DD_DC2DC3:DG10DG11_EE D 2 ? E 11 ? D 3 ? E 10 ? 1 D DC 3 1_555 E DG 10 1_555 D DA 4 1_555 E DT 9 1_555 0.768 1.229 3.249 3.450 2.256 40.346 1.519 -0.718 3.362 3.261 -4.986 40.547 14 DD_DC3DA4:DT9DG10_EE D 3 ? E 10 ? D 4 ? E 9 ? 1 D DA 4 1_555 E DT 9 1_555 D DA 5 1_555 E DT 8 1_555 0.590 0.397 3.276 -2.034 10.057 28.121 -1.353 -1.573 3.176 19.880 4.021 29.899 15 DD_DA4DA5:DT8DT9_EE D 4 ? E 9 ? D 5 ? E 8 ? 1 D DA 5 1_555 E DT 8 1_555 D DC 6 1_555 E DG 7 1_555 -1.551 0.108 3.338 -2.191 -3.973 38.737 0.658 2.050 3.391 -5.965 3.289 38.992 16 DD_DA5DC6:DG7DT8_EE D 5 ? E 8 ? D 6 ? E 7 ? 1 D DC 6 1_555 E DG 7 1_555 D DG 7 1_555 E DC 6 1_555 -0.022 -0.068 3.396 -4.129 3.697 37.970 -0.584 -0.502 3.359 5.644 6.305 38.358 17 DD_DC6DG7:DC6DG7_EE D 6 ? E 7 ? D 7 ? E 6 ? 1 D DG 7 1_555 E DC 6 1_555 D DT 8 1_555 E DA 5 1_555 -0.252 -0.511 3.136 -1.341 1.359 31.469 -1.183 0.226 3.119 2.502 2.470 31.526 18 DD_DG7DT8:DA5DC6_EE D 7 ? E 6 ? D 8 ? E 5 ? 1 D DT 8 1_555 E DA 5 1_555 D DT 9 1_555 E DA 4 1_555 -0.212 0.177 3.205 4.657 5.963 27.051 -1.014 1.513 3.093 12.442 -9.717 28.070 19 DD_DT8DT9:DA4DA5_EE D 8 ? E 5 ? D 9 ? E 4 ? 1 D DT 9 1_555 E DA 4 1_555 D DG 10 1_555 E DC 3 1_555 -0.029 2.183 3.385 -1.869 -3.119 49.066 2.860 -0.107 3.248 -3.750 2.247 49.192 20 DD_DT9DG10:DC3DA4_EE D 9 ? E 4 ? D 10 ? E 3 ? 1 D DG 10 1_555 E DC 3 1_555 D DG 11 1_555 E DC 2 1_555 0.229 0.376 3.209 -2.249 3.933 30.386 -0.051 -0.867 3.206 7.451 4.260 30.714 21 DD_DG10DG11:DC2DC3_EE D 10 ? E 3 ? D 11 ? E 2 ? 1 D DG 11 1_555 E DC 2 1_555 D DC 12 1_555 E DG 1 1_555 1.110 -0.565 3.434 5.610 -0.153 36.539 -0.870 -0.938 3.562 -0.242 -8.883 36.953 22 DD_DG11DC12:DG1DC2_EE D 11 ? E 2 ? D 12 ? E 1 ? # _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type other _pdbx_initial_refinement_model.source_name ? _pdbx_initial_refinement_model.details 'unpublished model of related protein-DNA complex' # _atom_sites.entry_id 5VC9 _atom_sites.fract_transf_matrix[1][1] 0.033352 _atom_sites.fract_transf_matrix[1][2] -0.013590 _atom_sites.fract_transf_matrix[1][3] 0.002505 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.026802 _atom_sites.fract_transf_matrix[2][3] -0.009281 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.018357 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O P S X ZN # loop_