data_5VQP # _entry.id 5VQP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5VQP pdb_00005vqp 10.2210/pdb5vqp/pdb WWPDB D_1000227858 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-11-15 2 'Structure model' 1 1 2017-11-22 3 'Structure model' 1 2 2018-02-14 4 'Structure model' 1 3 2019-12-11 5 'Structure model' 2 0 2020-07-29 6 'Structure model' 2 1 2023-10-04 7 'Structure model' 2 2 2024-12-25 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 5 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Author supporting evidence' 4 5 'Structure model' 'Atomic model' 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Derived calculations' 7 5 'Structure model' 'Structure summary' 8 6 'Structure model' 'Data collection' 9 6 'Structure model' 'Database references' 10 6 'Structure model' 'Derived calculations' 11 6 'Structure model' 'Refinement description' 12 6 'Structure model' 'Structure summary' 13 7 'Structure model' Advisory 14 7 'Structure model' 'Derived calculations' 15 7 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' citation 3 4 'Structure model' pdbx_audit_support 4 5 'Structure model' atom_site 5 5 'Structure model' chem_comp 6 5 'Structure model' entity 7 5 'Structure model' pdbx_branch_scheme 8 5 'Structure model' pdbx_chem_comp_identifier 9 5 'Structure model' pdbx_entity_branch 10 5 'Structure model' pdbx_entity_branch_descriptor 11 5 'Structure model' pdbx_entity_branch_link 12 5 'Structure model' pdbx_entity_branch_list 13 5 'Structure model' pdbx_entity_nonpoly 14 5 'Structure model' pdbx_nonpoly_scheme 15 5 'Structure model' pdbx_struct_assembly_gen 16 5 'Structure model' struct_asym 17 5 'Structure model' struct_conn 18 5 'Structure model' struct_site 19 5 'Structure model' struct_site_gen 20 6 'Structure model' chem_comp 21 6 'Structure model' chem_comp_atom 22 6 'Structure model' chem_comp_bond 23 6 'Structure model' database_2 24 6 'Structure model' pdbx_initial_refinement_model 25 6 'Structure model' struct_conn 26 7 'Structure model' pdbx_entry_details 27 7 'Structure model' pdbx_modification_feature 28 7 'Structure model' pdbx_validate_close_contact 29 7 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.pdbx_database_id_PubMed' 3 2 'Structure model' '_citation.title' 4 3 'Structure model' '_citation.journal_volume' 5 3 'Structure model' '_citation.page_first' 6 3 'Structure model' '_citation.page_last' 7 3 'Structure model' '_citation.title' 8 3 'Structure model' '_citation.year' 9 4 'Structure model' '_pdbx_audit_support.funding_organization' 10 5 'Structure model' '_atom_site.auth_asym_id' 11 5 'Structure model' '_atom_site.auth_seq_id' 12 5 'Structure model' '_atom_site.label_asym_id' 13 5 'Structure model' '_atom_site.label_entity_id' 14 5 'Structure model' '_chem_comp.name' 15 5 'Structure model' '_chem_comp.type' 16 5 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 17 5 'Structure model' '_struct_conn.pdbx_dist_value' 18 5 'Structure model' '_struct_conn.pdbx_role' 19 5 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 20 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 21 5 'Structure model' '_struct_conn.ptnr1_label_asym_id' 22 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 23 5 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 24 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 25 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' 26 5 'Structure model' '_struct_conn.ptnr2_label_seq_id' 27 5 'Structure model' '_struct_conn.ptnr2_symmetry' 28 6 'Structure model' '_chem_comp.pdbx_synonyms' 29 6 'Structure model' '_database_2.pdbx_DOI' 30 6 'Structure model' '_database_2.pdbx_database_accession' 31 6 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5VQP _pdbx_database_status.recvd_initial_deposition_date 2017-05-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Zhao, B.' 1 0000-0002-2163-6484 'Xu, S.' 2 ? 'Dong, X.' 3 ? 'Lu, C.' 4 ? 'Springer, T.A.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Biol. Chem.' _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 293 _citation.language ? _citation.page_first 1579 _citation.page_last 1589 _citation.title 'Prodomain-growth factor swapping in the structure of pro-TGF-beta 1.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1074/jbc.M117.809657 _citation.pdbx_database_id_PubMed 29109152 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhao, B.' 1 ? primary 'Xu, S.' 2 ? primary 'Dong, X.' 3 ? primary 'Lu, C.' 4 ? primary 'Springer, T.A.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Transforming growth factor beta-1' 41489.371 1 ? C4S,N107Q,N147Q ? ? 2 branched man 'beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 586.542 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name TGF-beta-1 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPLSTSKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKE VTRVLMVETHNEIYDKFKQSTHSIYMFFQTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSQNSWRYLSNRLL APSDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATIHGMNRPFLLLMATPLER AQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHN PGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS ; _entity_poly.pdbx_seq_one_letter_code_can ;GPLSTSKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKE VTRVLMVETHNEIYDKFKQSTHSIYMFFQTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSQNSWRYLSNRLL APSDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATIHGMNRPFLLLMATPLER AQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHN PGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 LEU n 1 4 SER n 1 5 THR n 1 6 SER n 1 7 LYS n 1 8 THR n 1 9 ILE n 1 10 ASP n 1 11 MET n 1 12 GLU n 1 13 LEU n 1 14 VAL n 1 15 LYS n 1 16 ARG n 1 17 LYS n 1 18 ARG n 1 19 ILE n 1 20 GLU n 1 21 ALA n 1 22 ILE n 1 23 ARG n 1 24 GLY n 1 25 GLN n 1 26 ILE n 1 27 LEU n 1 28 SER n 1 29 LYS n 1 30 LEU n 1 31 ARG n 1 32 LEU n 1 33 ALA n 1 34 SER n 1 35 PRO n 1 36 PRO n 1 37 SER n 1 38 GLN n 1 39 GLY n 1 40 GLU n 1 41 VAL n 1 42 PRO n 1 43 PRO n 1 44 GLY n 1 45 PRO n 1 46 LEU n 1 47 PRO n 1 48 GLU n 1 49 ALA n 1 50 VAL n 1 51 LEU n 1 52 ALA n 1 53 LEU n 1 54 TYR n 1 55 ASN n 1 56 SER n 1 57 THR n 1 58 ARG n 1 59 ASP n 1 60 ARG n 1 61 VAL n 1 62 ALA n 1 63 GLY n 1 64 GLU n 1 65 SER n 1 66 ALA n 1 67 GLU n 1 68 PRO n 1 69 GLU n 1 70 PRO n 1 71 GLU n 1 72 PRO n 1 73 GLU n 1 74 ALA n 1 75 ASP n 1 76 TYR n 1 77 TYR n 1 78 ALA n 1 79 LYS n 1 80 GLU n 1 81 VAL n 1 82 THR n 1 83 ARG n 1 84 VAL n 1 85 LEU n 1 86 MET n 1 87 VAL n 1 88 GLU n 1 89 THR n 1 90 HIS n 1 91 ASN n 1 92 GLU n 1 93 ILE n 1 94 TYR n 1 95 ASP n 1 96 LYS n 1 97 PHE n 1 98 LYS n 1 99 GLN n 1 100 SER n 1 101 THR n 1 102 HIS n 1 103 SER n 1 104 ILE n 1 105 TYR n 1 106 MET n 1 107 PHE n 1 108 PHE n 1 109 GLN n 1 110 THR n 1 111 SER n 1 112 GLU n 1 113 LEU n 1 114 ARG n 1 115 GLU n 1 116 ALA n 1 117 VAL n 1 118 PRO n 1 119 GLU n 1 120 PRO n 1 121 VAL n 1 122 LEU n 1 123 LEU n 1 124 SER n 1 125 ARG n 1 126 ALA n 1 127 GLU n 1 128 LEU n 1 129 ARG n 1 130 LEU n 1 131 LEU n 1 132 ARG n 1 133 LEU n 1 134 LYS n 1 135 LEU n 1 136 LYS n 1 137 VAL n 1 138 GLU n 1 139 GLN n 1 140 HIS n 1 141 VAL n 1 142 GLU n 1 143 LEU n 1 144 TYR n 1 145 GLN n 1 146 LYS n 1 147 TYR n 1 148 SER n 1 149 GLN n 1 150 ASN n 1 151 SER n 1 152 TRP n 1 153 ARG n 1 154 TYR n 1 155 LEU n 1 156 SER n 1 157 ASN n 1 158 ARG n 1 159 LEU n 1 160 LEU n 1 161 ALA n 1 162 PRO n 1 163 SER n 1 164 ASP n 1 165 SER n 1 166 PRO n 1 167 GLU n 1 168 TRP n 1 169 LEU n 1 170 SER n 1 171 PHE n 1 172 ASP n 1 173 VAL n 1 174 THR n 1 175 GLY n 1 176 VAL n 1 177 VAL n 1 178 ARG n 1 179 GLN n 1 180 TRP n 1 181 LEU n 1 182 SER n 1 183 ARG n 1 184 GLY n 1 185 GLY n 1 186 GLU n 1 187 ILE n 1 188 GLU n 1 189 GLY n 1 190 PHE n 1 191 ARG n 1 192 LEU n 1 193 SER n 1 194 ALA n 1 195 HIS n 1 196 CYS n 1 197 SER n 1 198 CYS n 1 199 ASP n 1 200 SER n 1 201 ARG n 1 202 ASP n 1 203 ASN n 1 204 THR n 1 205 LEU n 1 206 GLN n 1 207 VAL n 1 208 ASP n 1 209 ILE n 1 210 ASN n 1 211 GLY n 1 212 PHE n 1 213 THR n 1 214 THR n 1 215 GLY n 1 216 ARG n 1 217 ARG n 1 218 GLY n 1 219 ASP n 1 220 LEU n 1 221 ALA n 1 222 THR n 1 223 ILE n 1 224 HIS n 1 225 GLY n 1 226 MET n 1 227 ASN n 1 228 ARG n 1 229 PRO n 1 230 PHE n 1 231 LEU n 1 232 LEU n 1 233 LEU n 1 234 MET n 1 235 ALA n 1 236 THR n 1 237 PRO n 1 238 LEU n 1 239 GLU n 1 240 ARG n 1 241 ALA n 1 242 GLN n 1 243 HIS n 1 244 LEU n 1 245 GLN n 1 246 SER n 1 247 SER n 1 248 ARG n 1 249 HIS n 1 250 ARG n 1 251 ARG n 1 252 ALA n 1 253 LEU n 1 254 ASP n 1 255 THR n 1 256 ASN n 1 257 TYR n 1 258 CYS n 1 259 PHE n 1 260 SER n 1 261 SER n 1 262 THR n 1 263 GLU n 1 264 LYS n 1 265 ASN n 1 266 CYS n 1 267 CYS n 1 268 VAL n 1 269 ARG n 1 270 GLN n 1 271 LEU n 1 272 TYR n 1 273 ILE n 1 274 ASP n 1 275 PHE n 1 276 ARG n 1 277 LYS n 1 278 ASP n 1 279 LEU n 1 280 GLY n 1 281 TRP n 1 282 LYS n 1 283 TRP n 1 284 ILE n 1 285 HIS n 1 286 GLU n 1 287 PRO n 1 288 LYS n 1 289 GLY n 1 290 TYR n 1 291 HIS n 1 292 ALA n 1 293 ASN n 1 294 PHE n 1 295 CYS n 1 296 LEU n 1 297 GLY n 1 298 PRO n 1 299 CYS n 1 300 PRO n 1 301 TYR n 1 302 ILE n 1 303 TRP n 1 304 SER n 1 305 LEU n 1 306 ASP n 1 307 THR n 1 308 GLN n 1 309 TYR n 1 310 SER n 1 311 LYS n 1 312 VAL n 1 313 LEU n 1 314 ALA n 1 315 LEU n 1 316 TYR n 1 317 ASN n 1 318 GLN n 1 319 HIS n 1 320 ASN n 1 321 PRO n 1 322 GLY n 1 323 ALA n 1 324 SER n 1 325 ALA n 1 326 ALA n 1 327 PRO n 1 328 CYS n 1 329 CYS n 1 330 VAL n 1 331 PRO n 1 332 GLN n 1 333 ALA n 1 334 LEU n 1 335 GLU n 1 336 PRO n 1 337 LEU n 1 338 PRO n 1 339 ILE n 1 340 VAL n 1 341 TYR n 1 342 TYR n 1 343 VAL n 1 344 GLY n 1 345 ARG n 1 346 LYS n 1 347 PRO n 1 348 LYS n 1 349 VAL n 1 350 GLU n 1 351 GLN n 1 352 LEU n 1 353 SER n 1 354 ASN n 1 355 MET n 1 356 ILE n 1 357 VAL n 1 358 ARG n 1 359 SER n 1 360 CYS n 1 361 LYS n 1 362 CYS n 1 363 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 363 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'TGFB1, TGFB' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Cricetulus griseus' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 10029 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line 'CHO-lec 3.2.8.1' _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 DManpb1-4DGlcpNAcb1-4DGlcpNAcb1- 'Glycam Condensed Sequence' GMML 1.0 2 2 'WURCS=2.0/2,3,2/[a2122h-1b_1-5_2*NCC/3=O][a1122h-1b_1-5]/1-1-2/a4-b1_b4-c1' WURCS PDB2Glycan 1.1.0 3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-Manp]{}}}}' LINUCS PDB-CARE ? # loop_ _pdbx_entity_branch_link.link_id _pdbx_entity_branch_link.entity_id _pdbx_entity_branch_link.entity_branch_list_num_1 _pdbx_entity_branch_link.comp_id_1 _pdbx_entity_branch_link.atom_id_1 _pdbx_entity_branch_link.leaving_atom_id_1 _pdbx_entity_branch_link.entity_branch_list_num_2 _pdbx_entity_branch_link.comp_id_2 _pdbx_entity_branch_link.atom_id_2 _pdbx_entity_branch_link.leaving_atom_id_2 _pdbx_entity_branch_link.value_order _pdbx_entity_branch_link.details 1 2 2 NAG C1 O1 1 NAG O4 HO4 sing ? 2 2 3 BMA C1 O1 2 NAG O4 HO4 sing ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BMA 'D-saccharide, beta linking' . beta-D-mannopyranose 'beta-D-mannose; D-mannose; mannose' 'C6 H12 O6' 180.156 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE ; 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier BMA 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DManpb BMA 'COMMON NAME' GMML 1.0 b-D-mannopyranose BMA 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-Manp BMA 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Man NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 ? ? ? A . n A 1 2 PRO 2 0 ? ? ? A . n A 1 3 LEU 3 1 ? ? ? A . n A 1 4 SER 4 2 ? ? ? A . n A 1 5 THR 5 3 3 THR THR A . n A 1 6 SER 6 4 4 SER SER A . n A 1 7 LYS 7 5 5 LYS LYS A . n A 1 8 THR 8 6 6 THR THR A . n A 1 9 ILE 9 7 7 ILE ILE A . n A 1 10 ASP 10 8 8 ASP ASP A . n A 1 11 MET 11 9 9 MET MET A . n A 1 12 GLU 12 10 10 GLU GLU A . n A 1 13 LEU 13 11 11 LEU LEU A . n A 1 14 VAL 14 12 12 VAL VAL A . n A 1 15 LYS 15 13 13 LYS LYS A . n A 1 16 ARG 16 14 14 ARG ARG A . n A 1 17 LYS 17 15 15 LYS LYS A . n A 1 18 ARG 18 16 16 ARG ARG A . n A 1 19 ILE 19 17 17 ILE ILE A . n A 1 20 GLU 20 18 18 GLU GLU A . n A 1 21 ALA 21 19 19 ALA ALA A . n A 1 22 ILE 22 20 20 ILE ILE A . n A 1 23 ARG 23 21 21 ARG ARG A . n A 1 24 GLY 24 22 22 GLY GLY A . n A 1 25 GLN 25 23 23 GLN GLN A . n A 1 26 ILE 26 24 24 ILE ILE A . n A 1 27 LEU 27 25 25 LEU LEU A . n A 1 28 SER 28 26 26 SER SER A . n A 1 29 LYS 29 27 27 LYS LYS A . n A 1 30 LEU 30 28 28 LEU LEU A . n A 1 31 ARG 31 29 29 ARG ARG A . n A 1 32 LEU 32 30 30 LEU LEU A . n A 1 33 ALA 33 31 31 ALA ALA A . n A 1 34 SER 34 32 32 SER SER A . n A 1 35 PRO 35 33 33 PRO PRO A . n A 1 36 PRO 36 34 34 PRO PRO A . n A 1 37 SER 37 35 35 SER SER A . n A 1 38 GLN 38 36 36 GLN GLN A . n A 1 39 GLY 39 37 37 GLY GLY A . n A 1 40 GLU 40 38 38 GLU GLU A . n A 1 41 VAL 41 39 39 VAL VAL A . n A 1 42 PRO 42 40 ? ? ? A . n A 1 43 PRO 43 41 ? ? ? A . n A 1 44 GLY 44 42 42 GLY GLY A . n A 1 45 PRO 45 43 43 PRO PRO A . n A 1 46 LEU 46 44 44 LEU LEU A . n A 1 47 PRO 47 45 45 PRO PRO A . n A 1 48 GLU 48 46 46 GLU GLU A . n A 1 49 ALA 49 47 47 ALA ALA A . n A 1 50 VAL 50 48 48 VAL VAL A . n A 1 51 LEU 51 49 49 LEU LEU A . n A 1 52 ALA 52 50 50 ALA ALA A . n A 1 53 LEU 53 51 51 LEU LEU A . n A 1 54 TYR 54 52 52 TYR TYR A . n A 1 55 ASN 55 53 53 ASN ASN A . n A 1 56 SER 56 54 54 SER SER A . n A 1 57 THR 57 55 55 THR THR A . n A 1 58 ARG 58 56 56 ARG ARG A . n A 1 59 ASP 59 57 57 ASP ASP A . n A 1 60 ARG 60 58 58 ARG ARG A . n A 1 61 VAL 61 59 59 VAL VAL A . n A 1 62 ALA 62 60 60 ALA ALA A . n A 1 63 GLY 63 61 61 GLY GLY A . n A 1 64 GLU 64 62 ? ? ? A . n A 1 65 SER 65 63 ? ? ? A . n A 1 66 ALA 66 64 ? ? ? A . n A 1 67 GLU 67 65 ? ? ? A . n A 1 68 PRO 68 66 ? ? ? A . n A 1 69 GLU 69 67 ? ? ? A . n A 1 70 PRO 70 68 ? ? ? A . n A 1 71 GLU 71 69 ? ? ? A . n A 1 72 PRO 72 70 ? ? ? A . n A 1 73 GLU 73 71 ? ? ? A . n A 1 74 ALA 74 72 72 ALA ALA A . n A 1 75 ASP 75 73 73 ASP ASP A . n A 1 76 TYR 76 74 74 TYR TYR A . n A 1 77 TYR 77 75 75 TYR TYR A . n A 1 78 ALA 78 76 76 ALA ALA A . n A 1 79 LYS 79 77 77 LYS LYS A . n A 1 80 GLU 80 78 78 GLU GLU A . n A 1 81 VAL 81 79 79 VAL VAL A . n A 1 82 THR 82 80 80 THR THR A . n A 1 83 ARG 83 81 81 ARG ARG A . n A 1 84 VAL 84 82 82 VAL VAL A . n A 1 85 LEU 85 83 83 LEU LEU A . n A 1 86 MET 86 84 84 MET MET A . n A 1 87 VAL 87 85 85 VAL VAL A . n A 1 88 GLU 88 86 86 GLU GLU A . n A 1 89 THR 89 87 87 THR THR A . n A 1 90 HIS 90 88 88 HIS HIS A . n A 1 91 ASN 91 89 89 ASN ASN A . n A 1 92 GLU 92 90 90 GLU GLU A . n A 1 93 ILE 93 91 91 ILE ILE A . n A 1 94 TYR 94 92 92 TYR TYR A . n A 1 95 ASP 95 93 93 ASP ASP A . n A 1 96 LYS 96 94 94 LYS LYS A . n A 1 97 PHE 97 95 95 PHE PHE A . n A 1 98 LYS 98 96 96 LYS LYS A . n A 1 99 GLN 99 97 97 GLN GLN A . n A 1 100 SER 100 98 98 SER SER A . n A 1 101 THR 101 99 99 THR THR A . n A 1 102 HIS 102 100 100 HIS HIS A . n A 1 103 SER 103 101 101 SER SER A . n A 1 104 ILE 104 102 102 ILE ILE A . n A 1 105 TYR 105 103 103 TYR TYR A . n A 1 106 MET 106 104 104 MET MET A . n A 1 107 PHE 107 105 105 PHE PHE A . n A 1 108 PHE 108 106 106 PHE PHE A . n A 1 109 GLN 109 107 107 GLN GLN A . n A 1 110 THR 110 108 108 THR THR A . n A 1 111 SER 111 109 109 SER SER A . n A 1 112 GLU 112 110 110 GLU GLU A . n A 1 113 LEU 113 111 111 LEU LEU A . n A 1 114 ARG 114 112 112 ARG ARG A . n A 1 115 GLU 115 113 113 GLU GLU A . n A 1 116 ALA 116 114 114 ALA ALA A . n A 1 117 VAL 117 115 115 VAL VAL A . n A 1 118 PRO 118 116 116 PRO PRO A . n A 1 119 GLU 119 117 117 GLU GLU A . n A 1 120 PRO 120 118 118 PRO PRO A . n A 1 121 VAL 121 119 119 VAL VAL A . n A 1 122 LEU 122 120 120 LEU LEU A . n A 1 123 LEU 123 121 121 LEU LEU A . n A 1 124 SER 124 122 122 SER SER A . n A 1 125 ARG 125 123 123 ARG ARG A . n A 1 126 ALA 126 124 124 ALA ALA A . n A 1 127 GLU 127 125 125 GLU GLU A . n A 1 128 LEU 128 126 126 LEU LEU A . n A 1 129 ARG 129 127 127 ARG ARG A . n A 1 130 LEU 130 128 128 LEU LEU A . n A 1 131 LEU 131 129 129 LEU LEU A . n A 1 132 ARG 132 130 130 ARG ARG A . n A 1 133 LEU 133 131 131 LEU LEU A . n A 1 134 LYS 134 132 132 LYS LYS A . n A 1 135 LEU 135 133 133 LEU LEU A . n A 1 136 LYS 136 134 134 LYS LYS A . n A 1 137 VAL 137 135 135 VAL VAL A . n A 1 138 GLU 138 136 136 GLU GLU A . n A 1 139 GLN 139 137 137 GLN GLN A . n A 1 140 HIS 140 138 138 HIS HIS A . n A 1 141 VAL 141 139 139 VAL VAL A . n A 1 142 GLU 142 140 140 GLU GLU A . n A 1 143 LEU 143 141 141 LEU LEU A . n A 1 144 TYR 144 142 142 TYR TYR A . n A 1 145 GLN 145 143 143 GLN GLN A . n A 1 146 LYS 146 144 144 LYS LYS A . n A 1 147 TYR 147 145 145 TYR TYR A . n A 1 148 SER 148 146 146 SER SER A . n A 1 149 GLN 149 147 147 GLN GLN A . n A 1 150 ASN 150 148 148 ASN ASN A . n A 1 151 SER 151 149 149 SER SER A . n A 1 152 TRP 152 150 150 TRP TRP A . n A 1 153 ARG 153 151 151 ARG ARG A . n A 1 154 TYR 154 152 152 TYR TYR A . n A 1 155 LEU 155 153 153 LEU LEU A . n A 1 156 SER 156 154 154 SER SER A . n A 1 157 ASN 157 155 155 ASN ASN A . n A 1 158 ARG 158 156 156 ARG ARG A . n A 1 159 LEU 159 157 157 LEU LEU A . n A 1 160 LEU 160 158 158 LEU LEU A . n A 1 161 ALA 161 159 159 ALA ALA A . n A 1 162 PRO 162 160 160 PRO PRO A . n A 1 163 SER 163 161 161 SER SER A . n A 1 164 ASP 164 162 162 ASP ASP A . n A 1 165 SER 165 163 163 SER SER A . n A 1 166 PRO 166 164 164 PRO PRO A . n A 1 167 GLU 167 165 165 GLU GLU A . n A 1 168 TRP 168 166 166 TRP TRP A . n A 1 169 LEU 169 167 167 LEU LEU A . n A 1 170 SER 170 168 168 SER SER A . n A 1 171 PHE 171 169 169 PHE PHE A . n A 1 172 ASP 172 170 170 ASP ASP A . n A 1 173 VAL 173 171 171 VAL VAL A . n A 1 174 THR 174 172 172 THR THR A . n A 1 175 GLY 175 173 173 GLY GLY A . n A 1 176 VAL 176 174 174 VAL VAL A . n A 1 177 VAL 177 175 175 VAL VAL A . n A 1 178 ARG 178 176 176 ARG ARG A . n A 1 179 GLN 179 177 177 GLN GLN A . n A 1 180 TRP 180 178 178 TRP TRP A . n A 1 181 LEU 181 179 179 LEU LEU A . n A 1 182 SER 182 180 180 SER SER A . n A 1 183 ARG 183 181 181 ARG ARG A . n A 1 184 GLY 184 182 182 GLY GLY A . n A 1 185 GLY 185 183 183 GLY GLY A . n A 1 186 GLU 186 184 184 GLU GLU A . n A 1 187 ILE 187 185 185 ILE ILE A . n A 1 188 GLU 188 186 186 GLU GLU A . n A 1 189 GLY 189 187 187 GLY GLY A . n A 1 190 PHE 190 188 188 PHE PHE A . n A 1 191 ARG 191 189 189 ARG ARG A . n A 1 192 LEU 192 190 190 LEU LEU A . n A 1 193 SER 193 191 191 SER SER A . n A 1 194 ALA 194 192 192 ALA ALA A . n A 1 195 HIS 195 193 193 HIS HIS A . n A 1 196 CYS 196 194 194 CYS CYS A . n A 1 197 SER 197 195 195 SER SER A . n A 1 198 CYS 198 196 196 CYS CYS A . n A 1 199 ASP 199 197 197 ASP ASP A . n A 1 200 SER 200 198 198 SER SER A . n A 1 201 ARG 201 199 199 ARG ARG A . n A 1 202 ASP 202 200 200 ASP ASP A . n A 1 203 ASN 203 201 201 ASN ASN A . n A 1 204 THR 204 202 202 THR THR A . n A 1 205 LEU 205 203 203 LEU LEU A . n A 1 206 GLN 206 204 204 GLN GLN A . n A 1 207 VAL 207 205 205 VAL VAL A . n A 1 208 ASP 208 206 206 ASP ASP A . n A 1 209 ILE 209 207 207 ILE ILE A . n A 1 210 ASN 210 208 208 ASN ASN A . n A 1 211 GLY 211 209 209 GLY GLY A . n A 1 212 PHE 212 210 210 PHE PHE A . n A 1 213 THR 213 211 211 THR THR A . n A 1 214 THR 214 212 212 THR THR A . n A 1 215 GLY 215 213 213 GLY GLY A . n A 1 216 ARG 216 214 214 ARG ARG A . n A 1 217 ARG 217 215 215 ARG ARG A . n A 1 218 GLY 218 216 216 GLY GLY A . n A 1 219 ASP 219 217 217 ASP ASP A . n A 1 220 LEU 220 218 218 LEU LEU A . n A 1 221 ALA 221 219 219 ALA ALA A . n A 1 222 THR 222 220 220 THR THR A . n A 1 223 ILE 223 221 221 ILE ILE A . n A 1 224 HIS 224 222 222 HIS HIS A . n A 1 225 GLY 225 223 223 GLY GLY A . n A 1 226 MET 226 224 224 MET MET A . n A 1 227 ASN 227 225 225 ASN ASN A . n A 1 228 ARG 228 226 226 ARG ARG A . n A 1 229 PRO 229 227 227 PRO PRO A . n A 1 230 PHE 230 228 228 PHE PHE A . n A 1 231 LEU 231 229 229 LEU LEU A . n A 1 232 LEU 232 230 230 LEU LEU A . n A 1 233 LEU 233 231 231 LEU LEU A . n A 1 234 MET 234 232 232 MET MET A . n A 1 235 ALA 235 233 233 ALA ALA A . n A 1 236 THR 236 234 234 THR THR A . n A 1 237 PRO 237 235 235 PRO PRO A . n A 1 238 LEU 238 236 236 LEU LEU A . n A 1 239 GLU 239 237 237 GLU GLU A . n A 1 240 ARG 240 238 238 ARG ARG A . n A 1 241 ALA 241 239 239 ALA ALA A . n A 1 242 GLN 242 240 240 GLN GLN A . n A 1 243 HIS 243 241 241 HIS HIS A . n A 1 244 LEU 244 242 242 LEU LEU A . n A 1 245 GLN 245 243 ? ? ? A . n A 1 246 SER 246 244 ? ? ? A . n A 1 247 SER 247 245 ? ? ? A . n A 1 248 ARG 248 246 ? ? ? A . n A 1 249 HIS 249 247 ? ? ? A . n A 1 250 ARG 250 248 ? ? ? A . n A 1 251 ARG 251 249 ? ? ? A . n A 1 252 ALA 252 250 ? ? ? A . n A 1 253 LEU 253 251 251 LEU LEU A . n A 1 254 ASP 254 252 252 ASP ASP A . n A 1 255 THR 255 253 253 THR THR A . n A 1 256 ASN 256 254 254 ASN ASN A . n A 1 257 TYR 257 255 255 TYR TYR A . n A 1 258 CYS 258 256 256 CYS CYS A . n A 1 259 PHE 259 257 257 PHE PHE A . n A 1 260 SER 260 258 258 SER SER A . n A 1 261 SER 261 259 259 SER SER A . n A 1 262 THR 262 260 260 THR THR A . n A 1 263 GLU 263 261 261 GLU GLU A . n A 1 264 LYS 264 262 262 LYS LYS A . n A 1 265 ASN 265 263 263 ASN ASN A . n A 1 266 CYS 266 264 264 CYS CYS A . n A 1 267 CYS 267 265 265 CYS CYS A . n A 1 268 VAL 268 266 266 VAL VAL A . n A 1 269 ARG 269 267 267 ARG ARG A . n A 1 270 GLN 270 268 268 GLN GLN A . n A 1 271 LEU 271 269 269 LEU LEU A . n A 1 272 TYR 272 270 270 TYR TYR A . n A 1 273 ILE 273 271 271 ILE ILE A . n A 1 274 ASP 274 272 272 ASP ASP A . n A 1 275 PHE 275 273 273 PHE PHE A . n A 1 276 ARG 276 274 274 ARG ARG A . n A 1 277 LYS 277 275 275 LYS LYS A . n A 1 278 ASP 278 276 276 ASP ASP A . n A 1 279 LEU 279 277 277 LEU LEU A . n A 1 280 GLY 280 278 278 GLY GLY A . n A 1 281 TRP 281 279 279 TRP TRP A . n A 1 282 LYS 282 280 280 LYS LYS A . n A 1 283 TRP 283 281 281 TRP TRP A . n A 1 284 ILE 284 282 282 ILE ILE A . n A 1 285 HIS 285 283 283 HIS HIS A . n A 1 286 GLU 286 284 284 GLU GLU A . n A 1 287 PRO 287 285 285 PRO PRO A . n A 1 288 LYS 288 286 286 LYS LYS A . n A 1 289 GLY 289 287 287 GLY GLY A . n A 1 290 TYR 290 288 288 TYR TYR A . n A 1 291 HIS 291 289 289 HIS HIS A . n A 1 292 ALA 292 290 290 ALA ALA A . n A 1 293 ASN 293 291 291 ASN ASN A . n A 1 294 PHE 294 292 292 PHE PHE A . n A 1 295 CYS 295 293 293 CYS CYS A . n A 1 296 LEU 296 294 294 LEU LEU A . n A 1 297 GLY 297 295 295 GLY GLY A . n A 1 298 PRO 298 296 296 PRO PRO A . n A 1 299 CYS 299 297 297 CYS CYS A . n A 1 300 PRO 300 298 298 PRO PRO A . n A 1 301 TYR 301 299 ? ? ? A . n A 1 302 ILE 302 300 ? ? ? A . n A 1 303 TRP 303 301 ? ? ? A . n A 1 304 SER 304 302 ? ? ? A . n A 1 305 LEU 305 303 ? ? ? A . n A 1 306 ASP 306 304 ? ? ? A . n A 1 307 THR 307 305 ? ? ? A . n A 1 308 GLN 308 306 ? ? ? A . n A 1 309 TYR 309 307 ? ? ? A . n A 1 310 SER 310 308 ? ? ? A . n A 1 311 LYS 311 309 ? ? ? A . n A 1 312 VAL 312 310 ? ? ? A . n A 1 313 LEU 313 311 311 LEU LEU A . n A 1 314 ALA 314 312 312 ALA ALA A . n A 1 315 LEU 315 313 313 LEU LEU A . n A 1 316 TYR 316 314 ? ? ? A . n A 1 317 ASN 317 315 ? ? ? A . n A 1 318 GLN 318 316 ? ? ? A . n A 1 319 HIS 319 317 ? ? ? A . n A 1 320 ASN 320 318 ? ? ? A . n A 1 321 PRO 321 319 319 PRO PRO A . n A 1 322 GLY 322 320 320 GLY GLY A . n A 1 323 ALA 323 321 321 ALA ALA A . n A 1 324 SER 324 322 322 SER SER A . n A 1 325 ALA 325 323 323 ALA ALA A . n A 1 326 ALA 326 324 324 ALA ALA A . n A 1 327 PRO 327 325 325 PRO PRO A . n A 1 328 CYS 328 326 326 CYS CYS A . n A 1 329 CYS 329 327 327 CYS CYS A . n A 1 330 VAL 330 328 328 VAL VAL A . n A 1 331 PRO 331 329 329 PRO PRO A . n A 1 332 GLN 332 330 330 GLN GLN A . n A 1 333 ALA 333 331 331 ALA ALA A . n A 1 334 LEU 334 332 332 LEU LEU A . n A 1 335 GLU 335 333 333 GLU GLU A . n A 1 336 PRO 336 334 334 PRO PRO A . n A 1 337 LEU 337 335 335 LEU LEU A . n A 1 338 PRO 338 336 336 PRO PRO A . n A 1 339 ILE 339 337 337 ILE ILE A . n A 1 340 VAL 340 338 338 VAL VAL A . n A 1 341 TYR 341 339 339 TYR TYR A . n A 1 342 TYR 342 340 340 TYR TYR A . n A 1 343 VAL 343 341 341 VAL VAL A . n A 1 344 GLY 344 342 342 GLY GLY A . n A 1 345 ARG 345 343 343 ARG ARG A . n A 1 346 LYS 346 344 344 LYS LYS A . n A 1 347 PRO 347 345 345 PRO PRO A . n A 1 348 LYS 348 346 346 LYS LYS A . n A 1 349 VAL 349 347 347 VAL VAL A . n A 1 350 GLU 350 348 348 GLU GLU A . n A 1 351 GLN 351 349 349 GLN GLN A . n A 1 352 LEU 352 350 350 LEU LEU A . n A 1 353 SER 353 351 351 SER SER A . n A 1 354 ASN 354 352 352 ASN ASN A . n A 1 355 MET 355 353 353 MET MET A . n A 1 356 ILE 356 354 354 ILE ILE A . n A 1 357 VAL 357 355 355 VAL VAL A . n A 1 358 ARG 358 356 356 ARG ARG A . n A 1 359 SER 359 357 357 SER SER A . n A 1 360 CYS 360 358 358 CYS CYS A . n A 1 361 LYS 361 359 359 LYS LYS A . n A 1 362 CYS 362 360 360 CYS CYS A . n A 1 363 SER 363 361 361 SER SER A . n # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 NAG 1 B NAG 1 A NAG 3053 n B 2 NAG 2 B NAG 2 A NAG 3054 n B 2 BMA 3 B BMA 3 A BMA 3055 n # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.11.1_2575: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 ? 'data processing' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 5 # _cell.entry_id 5VQP _cell.length_a 104.390 _cell.length_b 104.390 _cell.length_c 141.900 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5VQP _symmetry.space_group_name_H-M 'P 6 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 177 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5VQP _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.70 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 54.45 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.3 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100 mM MES pH6.3, 1.68 M Ammonium Sulfate, 11% Dioxane' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 300 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2012-07-14 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.03318 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 23-ID-B' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.03318 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 23-ID-B _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5VQP _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.9 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10672 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.5 _reflns.pdbx_Rmerge_I_obs 0.17 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.32 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.90 _reflns_shell.d_res_low 2.98 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 0.48 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 753 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 6 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.15 _reflns_shell.pdbx_R_split ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 5VQP _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 10668 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 29.477 _refine.ls_d_res_high 2.900 _refine.ls_percent_reflns_obs 99.93 _refine.ls_R_factor_obs 0.2541 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2520 _refine.ls_R_factor_R_free 0.2929 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.01 _refine.ls_number_reflns_R_free 534 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.details ? _refine.pdbx_starting_model 3rjr _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.50 _refine.pdbx_overall_phase_error 33.81 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2576 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 39 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2615 _refine_hist.d_res_high 2.900 _refine_hist.d_res_low 29.477 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.004 ? ? 2677 'X-RAY DIFFRACTION' ? f_angle_d 0.641 ? ? 3624 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 16.683 ? ? 1030 'X-RAY DIFFRACTION' ? f_chiral_restr 0.041 ? ? 408 'X-RAY DIFFRACTION' ? f_plane_restr 0.004 ? ? 457 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all 'X-RAY DIFFRACTION' . 2.9001 3.1917 2448 0.3759 100.00 0.4035 . . 130 . . 'X-RAY DIFFRACTION' . 3.1917 3.6528 2473 0.3075 100.00 0.3351 . . 130 . . 'X-RAY DIFFRACTION' . 3.6528 4.5993 2524 0.2503 100.00 0.3067 . . 132 . . 'X-RAY DIFFRACTION' . 4.5993 29.4789 2689 0.2275 100.00 0.2653 . . 142 . . # _struct.entry_id 5VQP _struct.title 'Crystal structure of human pro-TGF-beta1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5VQP _struct_keywords.text 'latency, furin cleavage, prodomain/growth-factor swapping, homodimer, CYTOKINE' _struct_keywords.pdbx_keywords CYTOKINE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TGFB1_HUMAN _struct_ref.pdbx_db_accession P01137 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;LSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVT RVLMVETHNEIYDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWRYLSNRLLAP SDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATIHGMNRPFLLLMATPLERAQ HLQSSRHRRALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPG ASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS ; _struct_ref.pdbx_align_begin 30 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5VQP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 363 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P01137 _struct_ref_seq.db_align_beg 30 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 390 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 361 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5VQP GLY A 1 ? UNP P01137 ? ? 'expression tag' -1 1 1 5VQP PRO A 2 ? UNP P01137 ? ? 'expression tag' 0 2 1 5VQP SER A 6 ? UNP P01137 CYS 33 'engineered mutation' 4 3 1 5VQP GLN A 109 ? UNP P01137 ASN 136 'engineered mutation' 107 4 1 5VQP GLN A 149 ? UNP P01137 ASN 176 'engineered mutation' 147 5 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 10250 ? 1 MORE -45 ? 1 'SSA (A^2)' 34410 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details 'Gel fitration and SDS-PAGE show it is expressed as a homodimer.' # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_765 -x+2,-y+1,z -1.0000000000 0.0000000000 0.0000000000 156.5850000000 0.0000000000 -1.0000000000 0.0000000000 90.4043919011 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 5 ? ARG A 31 ? THR A 3 ARG A 29 1 ? 27 HELX_P HELX_P2 AA2 PRO A 47 ? ASP A 59 ? PRO A 45 ASP A 57 1 ? 13 HELX_P HELX_P3 AA3 THR A 110 ? VAL A 117 ? THR A 108 VAL A 115 1 ? 8 HELX_P HELX_P4 AA4 GLU A 119 ? VAL A 121 ? GLU A 117 VAL A 119 5 ? 3 HELX_P HELX_P5 AA5 VAL A 173 ? ARG A 183 ? VAL A 171 ARG A 181 1 ? 11 HELX_P HELX_P6 AA6 PRO A 237 ? GLN A 242 ? PRO A 235 GLN A 240 1 ? 6 HELX_P HELX_P7 AA7 TYR A 257 ? THR A 262 ? TYR A 255 THR A 260 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 196 SG ? ? ? 1_555 A CYS 198 SG ? ? A CYS 194 A CYS 196 4_765 ? ? ? ? ? ? ? 2.035 ? ? disulf2 disulf ? ? A CYS 258 SG ? ? ? 1_555 A CYS 267 SG ? ? A CYS 256 A CYS 265 1_555 ? ? ? ? ? ? ? 2.033 ? ? disulf3 disulf ? ? A CYS 266 SG ? ? ? 1_555 A CYS 329 SG ? ? A CYS 264 A CYS 327 1_555 ? ? ? ? ? ? ? 2.036 ? ? disulf4 disulf ? ? A CYS 295 SG ? ? ? 1_555 A CYS 360 SG ? ? A CYS 293 A CYS 358 1_555 ? ? ? ? ? ? ? 2.035 ? ? disulf5 disulf ? ? A CYS 299 SG ? ? ? 1_555 A CYS 362 SG ? ? A CYS 297 A CYS 360 1_555 ? ? ? ? ? ? ? 2.034 ? ? disulf6 disulf ? ? A CYS 328 SG ? ? ? 1_555 A CYS 328 SG ? ? A CYS 326 A CYS 326 4_765 ? ? ? ? ? ? ? 2.033 ? ? covale1 covale one ? A ASN 55 ND2 ? ? ? 1_555 B NAG . C1 ? ? A ASN 53 B NAG 1 1_555 ? ? ? ? ? ? ? 1.444 ? N-Glycosylation covale2 covale both ? B NAG . O4 ? ? ? 1_555 B NAG . C1 ? ? B NAG 1 B NAG 2 1_555 ? ? ? ? ? ? ? 1.438 ? ? covale3 covale both ? B NAG . O4 ? ? ? 1_555 B BMA . C1 ? ? B NAG 2 B BMA 3 1_555 ? ? ? ? ? ? ? 1.450 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 NAG B . ? ASN A 55 ? NAG B 1 ? 1_555 ASN A 53 ? 1_555 C1 ND2 ASN 1 NAG N-Glycosylation Carbohydrate 2 CYS A 196 ? CYS A 198 ? CYS A 194 ? 1_555 CYS A 196 ? 4_765 SG SG . . . None 'Disulfide bridge' 3 CYS A 258 ? CYS A 267 ? CYS A 256 ? 1_555 CYS A 265 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 266 ? CYS A 329 ? CYS A 264 ? 1_555 CYS A 327 ? 1_555 SG SG . . . None 'Disulfide bridge' 5 CYS A 295 ? CYS A 360 ? CYS A 293 ? 1_555 CYS A 358 ? 1_555 SG SG . . . None 'Disulfide bridge' 6 CYS A 299 ? CYS A 362 ? CYS A 297 ? 1_555 CYS A 360 ? 1_555 SG SG . . . None 'Disulfide bridge' 7 CYS A 328 ? CYS A 328 ? CYS A 326 ? 1_555 CYS A 326 ? 4_765 SG SG . . . None 'Disulfide bridge' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLU _struct_mon_prot_cis.label_seq_id 286 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLU _struct_mon_prot_cis.auth_seq_id 284 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 287 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 285 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -4.52 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 4 ? AA3 ? 3 ? AA4 ? 2 ? AA5 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA4 1 2 ? anti-parallel AA5 1 2 ? anti-parallel AA5 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 80 ? LEU A 85 ? GLU A 78 LEU A 83 AA1 2 PHE A 230 ? ALA A 235 ? PHE A 228 ALA A 233 AA1 3 LEU A 123 ? ARG A 132 ? LEU A 121 ARG A 130 AA1 4 GLU A 167 ? ASP A 172 ? GLU A 165 ASP A 170 AA2 1 SER A 103 ? GLN A 109 ? SER A 101 GLN A 107 AA2 2 ILE A 187 ? ARG A 201 ? ILE A 185 ARG A 199 AA2 3 GLN A 139 ? TYR A 147 ? GLN A 137 TYR A 145 AA2 4 SER A 151 ? LEU A 160 ? SER A 149 LEU A 158 AA3 1 SER A 103 ? GLN A 109 ? SER A 101 GLN A 107 AA3 2 ILE A 187 ? ARG A 201 ? ILE A 185 ARG A 199 AA3 3 THR A 204 ? ASN A 210 ? THR A 202 ASN A 208 AA4 1 CYS A 267 ? ASP A 274 ? CYS A 265 ASP A 272 AA4 2 GLY A 289 ? LEU A 296 ? GLY A 287 LEU A 294 AA5 1 ILE A 284 ? GLU A 286 ? ILE A 282 GLU A 284 AA5 2 CYS A 328 ? VAL A 343 ? CYS A 326 VAL A 341 AA5 3 LYS A 346 ? SER A 363 ? LYS A 344 SER A 361 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N THR A 82 ? N THR A 80 O LEU A 233 ? O LEU A 231 AA1 2 3 O LEU A 232 ? O LEU A 230 N GLU A 127 ? N GLU A 125 AA1 3 4 N LEU A 130 ? N LEU A 128 O LEU A 169 ? O LEU A 167 AA2 1 2 N ILE A 104 ? N ILE A 102 O LEU A 192 ? O LEU A 190 AA2 2 3 O HIS A 195 ? O HIS A 193 N HIS A 140 ? N HIS A 138 AA2 3 4 N TYR A 147 ? N TYR A 145 O SER A 151 ? O SER A 149 AA3 1 2 N ILE A 104 ? N ILE A 102 O LEU A 192 ? O LEU A 190 AA3 2 3 N SER A 197 ? N SER A 195 O ASP A 208 ? O ASP A 206 AA4 1 2 N ARG A 269 ? N ARG A 267 O PHE A 294 ? O PHE A 292 AA5 1 2 N GLU A 286 ? N GLU A 284 O VAL A 340 ? O VAL A 338 AA5 2 3 N GLN A 332 ? N GLN A 330 O SER A 359 ? O SER A 357 # _pdbx_entry_details.entry_id 5VQP _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 NH2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ARG _pdbx_validate_close_contact.auth_seq_id_1 56 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O6 _pdbx_validate_close_contact.auth_asym_id_2 B _pdbx_validate_close_contact.auth_comp_id_2 NAG _pdbx_validate_close_contact.auth_seq_id_2 1 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.31 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 34 ? ? -76.09 -161.68 2 1 ASP A 57 ? ? -110.49 69.32 3 1 ALA A 60 ? ? 54.30 -125.93 4 1 HIS A 88 ? ? 57.67 10.53 5 1 GLU A 90 ? ? 56.08 -121.43 6 1 SER A 146 ? ? 56.24 -123.72 7 1 LEU A 153 ? ? -115.43 -74.21 8 1 ARG A 215 ? ? 64.74 -46.47 9 1 HIS A 241 ? ? 55.41 -127.57 10 1 ASP A 276 ? ? -91.63 -64.72 11 1 GLN A 330 ? ? -104.72 -60.89 # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined 89.8388 32.4224 19.3320 0.6769 0.6734 0.7176 -0.1744 0.0642 -0.0240 9.1914 1.7092 8.6021 -1.7828 3.2210 -0.3382 -0.3287 0.3052 0.0327 0.0190 -0.9086 0.2601 -0.1772 0.8566 0.3608 'X-RAY DIFFRACTION' 2 ? refined 92.6816 40.8625 50.3001 0.6553 1.2185 0.5751 0.0469 -0.0987 -0.0423 4.1074 2.8705 9.1168 0.2698 -0.9654 1.6707 -0.0744 0.0774 -0.0509 -1.1221 -0.1073 -0.3290 0.5976 0.3728 1.2816 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 3 A 59 '( CHAIN A AND ( RESID 3:59 OR RESID 252:361 ) )' ? ? ? ? ? 'X-RAY DIFFRACTION' 2 1 A 252 A 361 '( CHAIN A AND ( RESID 3:59 OR RESID 252:361 ) )' ? ? ? ? ? 'X-RAY DIFFRACTION' 3 2 A 60 A 240 '( CHAIN A AND RESID 60:240 )' ? ? ? ? ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -1 ? A GLY 1 2 1 Y 1 A PRO 0 ? A PRO 2 3 1 Y 1 A LEU 1 ? A LEU 3 4 1 Y 1 A SER 2 ? A SER 4 5 1 Y 1 A PRO 40 ? A PRO 42 6 1 Y 1 A PRO 41 ? A PRO 43 7 1 Y 1 A GLU 62 ? A GLU 64 8 1 Y 1 A SER 63 ? A SER 65 9 1 Y 1 A ALA 64 ? A ALA 66 10 1 Y 1 A GLU 65 ? A GLU 67 11 1 Y 1 A PRO 66 ? A PRO 68 12 1 Y 1 A GLU 67 ? A GLU 69 13 1 Y 1 A PRO 68 ? A PRO 70 14 1 Y 1 A GLU 69 ? A GLU 71 15 1 Y 1 A PRO 70 ? A PRO 72 16 1 Y 1 A GLU 71 ? A GLU 73 17 1 Y 1 A GLN 243 ? A GLN 245 18 1 Y 1 A SER 244 ? A SER 246 19 1 Y 1 A SER 245 ? A SER 247 20 1 Y 1 A ARG 246 ? A ARG 248 21 1 Y 1 A HIS 247 ? A HIS 249 22 1 Y 1 A ARG 248 ? A ARG 250 23 1 Y 1 A ARG 249 ? A ARG 251 24 1 Y 1 A ALA 250 ? A ALA 252 25 1 Y 1 A TYR 299 ? A TYR 301 26 1 Y 1 A ILE 300 ? A ILE 302 27 1 Y 1 A TRP 301 ? A TRP 303 28 1 Y 1 A SER 302 ? A SER 304 29 1 Y 1 A LEU 303 ? A LEU 305 30 1 Y 1 A ASP 304 ? A ASP 306 31 1 Y 1 A THR 305 ? A THR 307 32 1 Y 1 A GLN 306 ? A GLN 308 33 1 Y 1 A TYR 307 ? A TYR 309 34 1 Y 1 A SER 308 ? A SER 310 35 1 Y 1 A LYS 309 ? A LYS 311 36 1 Y 1 A VAL 310 ? A VAL 312 37 1 Y 1 A TYR 314 ? A TYR 316 38 1 Y 1 A ASN 315 ? A ASN 317 39 1 Y 1 A GLN 316 ? A GLN 318 40 1 Y 1 A HIS 317 ? A HIS 319 41 1 Y 1 A ASN 318 ? A ASN 320 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 BMA C1 C N R 74 BMA C2 C N S 75 BMA C3 C N S 76 BMA C4 C N S 77 BMA C5 C N R 78 BMA C6 C N N 79 BMA O1 O N N 80 BMA O2 O N N 81 BMA O3 O N N 82 BMA O4 O N N 83 BMA O5 O N N 84 BMA O6 O N N 85 BMA H1 H N N 86 BMA H2 H N N 87 BMA H3 H N N 88 BMA H4 H N N 89 BMA H5 H N N 90 BMA H61 H N N 91 BMA H62 H N N 92 BMA HO1 H N N 93 BMA HO2 H N N 94 BMA HO3 H N N 95 BMA HO4 H N N 96 BMA HO6 H N N 97 CYS N N N N 98 CYS CA C N R 99 CYS C C N N 100 CYS O O N N 101 CYS CB C N N 102 CYS SG S N N 103 CYS OXT O N N 104 CYS H H N N 105 CYS H2 H N N 106 CYS HA H N N 107 CYS HB2 H N N 108 CYS HB3 H N N 109 CYS HG H N N 110 CYS HXT H N N 111 GLN N N N N 112 GLN CA C N S 113 GLN C C N N 114 GLN O O N N 115 GLN CB C N N 116 GLN CG C N N 117 GLN CD C N N 118 GLN OE1 O N N 119 GLN NE2 N N N 120 GLN OXT O N N 121 GLN H H N N 122 GLN H2 H N N 123 GLN HA H N N 124 GLN HB2 H N N 125 GLN HB3 H N N 126 GLN HG2 H N N 127 GLN HG3 H N N 128 GLN HE21 H N N 129 GLN HE22 H N N 130 GLN HXT H N N 131 GLU N N N N 132 GLU CA C N S 133 GLU C C N N 134 GLU O O N N 135 GLU CB C N N 136 GLU CG C N N 137 GLU CD C N N 138 GLU OE1 O N N 139 GLU OE2 O N N 140 GLU OXT O N N 141 GLU H H N N 142 GLU H2 H N N 143 GLU HA H N N 144 GLU HB2 H N N 145 GLU HB3 H N N 146 GLU HG2 H N N 147 GLU HG3 H N N 148 GLU HE2 H N N 149 GLU HXT H N N 150 GLY N N N N 151 GLY CA C N N 152 GLY C C N N 153 GLY O O N N 154 GLY OXT O N N 155 GLY H H N N 156 GLY H2 H N N 157 GLY HA2 H N N 158 GLY HA3 H N N 159 GLY HXT H N N 160 HIS N N N N 161 HIS CA C N S 162 HIS C C N N 163 HIS O O N N 164 HIS CB C N N 165 HIS CG C Y N 166 HIS ND1 N Y N 167 HIS CD2 C Y N 168 HIS CE1 C Y N 169 HIS NE2 N Y N 170 HIS OXT O N N 171 HIS H H N N 172 HIS H2 H N N 173 HIS HA H N N 174 HIS HB2 H N N 175 HIS HB3 H N N 176 HIS HD1 H N N 177 HIS HD2 H N N 178 HIS HE1 H N N 179 HIS HE2 H N N 180 HIS HXT H N N 181 ILE N N N N 182 ILE CA C N S 183 ILE C C N N 184 ILE O O N N 185 ILE CB C N S 186 ILE CG1 C N N 187 ILE CG2 C N N 188 ILE CD1 C N N 189 ILE OXT O N N 190 ILE H H N N 191 ILE H2 H N N 192 ILE HA H N N 193 ILE HB H N N 194 ILE HG12 H N N 195 ILE HG13 H N N 196 ILE HG21 H N N 197 ILE HG22 H N N 198 ILE HG23 H N N 199 ILE HD11 H N N 200 ILE HD12 H N N 201 ILE HD13 H N N 202 ILE HXT H N N 203 LEU N N N N 204 LEU CA C N S 205 LEU C C N N 206 LEU O O N N 207 LEU CB C N N 208 LEU CG C N N 209 LEU CD1 C N N 210 LEU CD2 C N N 211 LEU OXT O N N 212 LEU H H N N 213 LEU H2 H N N 214 LEU HA H N N 215 LEU HB2 H N N 216 LEU HB3 H N N 217 LEU HG H N N 218 LEU HD11 H N N 219 LEU HD12 H N N 220 LEU HD13 H N N 221 LEU HD21 H N N 222 LEU HD22 H N N 223 LEU HD23 H N N 224 LEU HXT H N N 225 LYS N N N N 226 LYS CA C N S 227 LYS C C N N 228 LYS O O N N 229 LYS CB C N N 230 LYS CG C N N 231 LYS CD C N N 232 LYS CE C N N 233 LYS NZ N N N 234 LYS OXT O N N 235 LYS H H N N 236 LYS H2 H N N 237 LYS HA H N N 238 LYS HB2 H N N 239 LYS HB3 H N N 240 LYS HG2 H N N 241 LYS HG3 H N N 242 LYS HD2 H N N 243 LYS HD3 H N N 244 LYS HE2 H N N 245 LYS HE3 H N N 246 LYS HZ1 H N N 247 LYS HZ2 H N N 248 LYS HZ3 H N N 249 LYS HXT H N N 250 MET N N N N 251 MET CA C N S 252 MET C C N N 253 MET O O N N 254 MET CB C N N 255 MET CG C N N 256 MET SD S N N 257 MET CE C N N 258 MET OXT O N N 259 MET H H N N 260 MET H2 H N N 261 MET HA H N N 262 MET HB2 H N N 263 MET HB3 H N N 264 MET HG2 H N N 265 MET HG3 H N N 266 MET HE1 H N N 267 MET HE2 H N N 268 MET HE3 H N N 269 MET HXT H N N 270 NAG C1 C N R 271 NAG C2 C N R 272 NAG C3 C N R 273 NAG C4 C N S 274 NAG C5 C N R 275 NAG C6 C N N 276 NAG C7 C N N 277 NAG C8 C N N 278 NAG N2 N N N 279 NAG O1 O N N 280 NAG O3 O N N 281 NAG O4 O N N 282 NAG O5 O N N 283 NAG O6 O N N 284 NAG O7 O N N 285 NAG H1 H N N 286 NAG H2 H N N 287 NAG H3 H N N 288 NAG H4 H N N 289 NAG H5 H N N 290 NAG H61 H N N 291 NAG H62 H N N 292 NAG H81 H N N 293 NAG H82 H N N 294 NAG H83 H N N 295 NAG HN2 H N N 296 NAG HO1 H N N 297 NAG HO3 H N N 298 NAG HO4 H N N 299 NAG HO6 H N N 300 PHE N N N N 301 PHE CA C N S 302 PHE C C N N 303 PHE O O N N 304 PHE CB C N N 305 PHE CG C Y N 306 PHE CD1 C Y N 307 PHE CD2 C Y N 308 PHE CE1 C Y N 309 PHE CE2 C Y N 310 PHE CZ C Y N 311 PHE OXT O N N 312 PHE H H N N 313 PHE H2 H N N 314 PHE HA H N N 315 PHE HB2 H N N 316 PHE HB3 H N N 317 PHE HD1 H N N 318 PHE HD2 H N N 319 PHE HE1 H N N 320 PHE HE2 H N N 321 PHE HZ H N N 322 PHE HXT H N N 323 PRO N N N N 324 PRO CA C N S 325 PRO C C N N 326 PRO O O N N 327 PRO CB C N N 328 PRO CG C N N 329 PRO CD C N N 330 PRO OXT O N N 331 PRO H H N N 332 PRO HA H N N 333 PRO HB2 H N N 334 PRO HB3 H N N 335 PRO HG2 H N N 336 PRO HG3 H N N 337 PRO HD2 H N N 338 PRO HD3 H N N 339 PRO HXT H N N 340 SER N N N N 341 SER CA C N S 342 SER C C N N 343 SER O O N N 344 SER CB C N N 345 SER OG O N N 346 SER OXT O N N 347 SER H H N N 348 SER H2 H N N 349 SER HA H N N 350 SER HB2 H N N 351 SER HB3 H N N 352 SER HG H N N 353 SER HXT H N N 354 THR N N N N 355 THR CA C N S 356 THR C C N N 357 THR O O N N 358 THR CB C N R 359 THR OG1 O N N 360 THR CG2 C N N 361 THR OXT O N N 362 THR H H N N 363 THR H2 H N N 364 THR HA H N N 365 THR HB H N N 366 THR HG1 H N N 367 THR HG21 H N N 368 THR HG22 H N N 369 THR HG23 H N N 370 THR HXT H N N 371 TRP N N N N 372 TRP CA C N S 373 TRP C C N N 374 TRP O O N N 375 TRP CB C N N 376 TRP CG C Y N 377 TRP CD1 C Y N 378 TRP CD2 C Y N 379 TRP NE1 N Y N 380 TRP CE2 C Y N 381 TRP CE3 C Y N 382 TRP CZ2 C Y N 383 TRP CZ3 C Y N 384 TRP CH2 C Y N 385 TRP OXT O N N 386 TRP H H N N 387 TRP H2 H N N 388 TRP HA H N N 389 TRP HB2 H N N 390 TRP HB3 H N N 391 TRP HD1 H N N 392 TRP HE1 H N N 393 TRP HE3 H N N 394 TRP HZ2 H N N 395 TRP HZ3 H N N 396 TRP HH2 H N N 397 TRP HXT H N N 398 TYR N N N N 399 TYR CA C N S 400 TYR C C N N 401 TYR O O N N 402 TYR CB C N N 403 TYR CG C Y N 404 TYR CD1 C Y N 405 TYR CD2 C Y N 406 TYR CE1 C Y N 407 TYR CE2 C Y N 408 TYR CZ C Y N 409 TYR OH O N N 410 TYR OXT O N N 411 TYR H H N N 412 TYR H2 H N N 413 TYR HA H N N 414 TYR HB2 H N N 415 TYR HB3 H N N 416 TYR HD1 H N N 417 TYR HD2 H N N 418 TYR HE1 H N N 419 TYR HE2 H N N 420 TYR HH H N N 421 TYR HXT H N N 422 VAL N N N N 423 VAL CA C N S 424 VAL C C N N 425 VAL O O N N 426 VAL CB C N N 427 VAL CG1 C N N 428 VAL CG2 C N N 429 VAL OXT O N N 430 VAL H H N N 431 VAL H2 H N N 432 VAL HA H N N 433 VAL HB H N N 434 VAL HG11 H N N 435 VAL HG12 H N N 436 VAL HG13 H N N 437 VAL HG21 H N N 438 VAL HG22 H N N 439 VAL HG23 H N N 440 VAL HXT H N N 441 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 BMA C1 C2 sing N N 70 BMA C1 O1 sing N N 71 BMA C1 O5 sing N N 72 BMA C1 H1 sing N N 73 BMA C2 C3 sing N N 74 BMA C2 O2 sing N N 75 BMA C2 H2 sing N N 76 BMA C3 C4 sing N N 77 BMA C3 O3 sing N N 78 BMA C3 H3 sing N N 79 BMA C4 C5 sing N N 80 BMA C4 O4 sing N N 81 BMA C4 H4 sing N N 82 BMA C5 C6 sing N N 83 BMA C5 O5 sing N N 84 BMA C5 H5 sing N N 85 BMA C6 O6 sing N N 86 BMA C6 H61 sing N N 87 BMA C6 H62 sing N N 88 BMA O1 HO1 sing N N 89 BMA O2 HO2 sing N N 90 BMA O3 HO3 sing N N 91 BMA O4 HO4 sing N N 92 BMA O6 HO6 sing N N 93 CYS N CA sing N N 94 CYS N H sing N N 95 CYS N H2 sing N N 96 CYS CA C sing N N 97 CYS CA CB sing N N 98 CYS CA HA sing N N 99 CYS C O doub N N 100 CYS C OXT sing N N 101 CYS CB SG sing N N 102 CYS CB HB2 sing N N 103 CYS CB HB3 sing N N 104 CYS SG HG sing N N 105 CYS OXT HXT sing N N 106 GLN N CA sing N N 107 GLN N H sing N N 108 GLN N H2 sing N N 109 GLN CA C sing N N 110 GLN CA CB sing N N 111 GLN CA HA sing N N 112 GLN C O doub N N 113 GLN C OXT sing N N 114 GLN CB CG sing N N 115 GLN CB HB2 sing N N 116 GLN CB HB3 sing N N 117 GLN CG CD sing N N 118 GLN CG HG2 sing N N 119 GLN CG HG3 sing N N 120 GLN CD OE1 doub N N 121 GLN CD NE2 sing N N 122 GLN NE2 HE21 sing N N 123 GLN NE2 HE22 sing N N 124 GLN OXT HXT sing N N 125 GLU N CA sing N N 126 GLU N H sing N N 127 GLU N H2 sing N N 128 GLU CA C sing N N 129 GLU CA CB sing N N 130 GLU CA HA sing N N 131 GLU C O doub N N 132 GLU C OXT sing N N 133 GLU CB CG sing N N 134 GLU CB HB2 sing N N 135 GLU CB HB3 sing N N 136 GLU CG CD sing N N 137 GLU CG HG2 sing N N 138 GLU CG HG3 sing N N 139 GLU CD OE1 doub N N 140 GLU CD OE2 sing N N 141 GLU OE2 HE2 sing N N 142 GLU OXT HXT sing N N 143 GLY N CA sing N N 144 GLY N H sing N N 145 GLY N H2 sing N N 146 GLY CA C sing N N 147 GLY CA HA2 sing N N 148 GLY CA HA3 sing N N 149 GLY C O doub N N 150 GLY C OXT sing N N 151 GLY OXT HXT sing N N 152 HIS N CA sing N N 153 HIS N H sing N N 154 HIS N H2 sing N N 155 HIS CA C sing N N 156 HIS CA CB sing N N 157 HIS CA HA sing N N 158 HIS C O doub N N 159 HIS C OXT sing N N 160 HIS CB CG sing N N 161 HIS CB HB2 sing N N 162 HIS CB HB3 sing N N 163 HIS CG ND1 sing Y N 164 HIS CG CD2 doub Y N 165 HIS ND1 CE1 doub Y N 166 HIS ND1 HD1 sing N N 167 HIS CD2 NE2 sing Y N 168 HIS CD2 HD2 sing N N 169 HIS CE1 NE2 sing Y N 170 HIS CE1 HE1 sing N N 171 HIS NE2 HE2 sing N N 172 HIS OXT HXT sing N N 173 ILE N CA sing N N 174 ILE N H sing N N 175 ILE N H2 sing N N 176 ILE CA C sing N N 177 ILE CA CB sing N N 178 ILE CA HA sing N N 179 ILE C O doub N N 180 ILE C OXT sing N N 181 ILE CB CG1 sing N N 182 ILE CB CG2 sing N N 183 ILE CB HB sing N N 184 ILE CG1 CD1 sing N N 185 ILE CG1 HG12 sing N N 186 ILE CG1 HG13 sing N N 187 ILE CG2 HG21 sing N N 188 ILE CG2 HG22 sing N N 189 ILE CG2 HG23 sing N N 190 ILE CD1 HD11 sing N N 191 ILE CD1 HD12 sing N N 192 ILE CD1 HD13 sing N N 193 ILE OXT HXT sing N N 194 LEU N CA sing N N 195 LEU N H sing N N 196 LEU N H2 sing N N 197 LEU CA C sing N N 198 LEU CA CB sing N N 199 LEU CA HA sing N N 200 LEU C O doub N N 201 LEU C OXT sing N N 202 LEU CB CG sing N N 203 LEU CB HB2 sing N N 204 LEU CB HB3 sing N N 205 LEU CG CD1 sing N N 206 LEU CG CD2 sing N N 207 LEU CG HG sing N N 208 LEU CD1 HD11 sing N N 209 LEU CD1 HD12 sing N N 210 LEU CD1 HD13 sing N N 211 LEU CD2 HD21 sing N N 212 LEU CD2 HD22 sing N N 213 LEU CD2 HD23 sing N N 214 LEU OXT HXT sing N N 215 LYS N CA sing N N 216 LYS N H sing N N 217 LYS N H2 sing N N 218 LYS CA C sing N N 219 LYS CA CB sing N N 220 LYS CA HA sing N N 221 LYS C O doub N N 222 LYS C OXT sing N N 223 LYS CB CG sing N N 224 LYS CB HB2 sing N N 225 LYS CB HB3 sing N N 226 LYS CG CD sing N N 227 LYS CG HG2 sing N N 228 LYS CG HG3 sing N N 229 LYS CD CE sing N N 230 LYS CD HD2 sing N N 231 LYS CD HD3 sing N N 232 LYS CE NZ sing N N 233 LYS CE HE2 sing N N 234 LYS CE HE3 sing N N 235 LYS NZ HZ1 sing N N 236 LYS NZ HZ2 sing N N 237 LYS NZ HZ3 sing N N 238 LYS OXT HXT sing N N 239 MET N CA sing N N 240 MET N H sing N N 241 MET N H2 sing N N 242 MET CA C sing N N 243 MET CA CB sing N N 244 MET CA HA sing N N 245 MET C O doub N N 246 MET C OXT sing N N 247 MET CB CG sing N N 248 MET CB HB2 sing N N 249 MET CB HB3 sing N N 250 MET CG SD sing N N 251 MET CG HG2 sing N N 252 MET CG HG3 sing N N 253 MET SD CE sing N N 254 MET CE HE1 sing N N 255 MET CE HE2 sing N N 256 MET CE HE3 sing N N 257 MET OXT HXT sing N N 258 NAG C1 C2 sing N N 259 NAG C1 O1 sing N N 260 NAG C1 O5 sing N N 261 NAG C1 H1 sing N N 262 NAG C2 C3 sing N N 263 NAG C2 N2 sing N N 264 NAG C2 H2 sing N N 265 NAG C3 C4 sing N N 266 NAG C3 O3 sing N N 267 NAG C3 H3 sing N N 268 NAG C4 C5 sing N N 269 NAG C4 O4 sing N N 270 NAG C4 H4 sing N N 271 NAG C5 C6 sing N N 272 NAG C5 O5 sing N N 273 NAG C5 H5 sing N N 274 NAG C6 O6 sing N N 275 NAG C6 H61 sing N N 276 NAG C6 H62 sing N N 277 NAG C7 C8 sing N N 278 NAG C7 N2 sing N N 279 NAG C7 O7 doub N N 280 NAG C8 H81 sing N N 281 NAG C8 H82 sing N N 282 NAG C8 H83 sing N N 283 NAG N2 HN2 sing N N 284 NAG O1 HO1 sing N N 285 NAG O3 HO3 sing N N 286 NAG O4 HO4 sing N N 287 NAG O6 HO6 sing N N 288 PHE N CA sing N N 289 PHE N H sing N N 290 PHE N H2 sing N N 291 PHE CA C sing N N 292 PHE CA CB sing N N 293 PHE CA HA sing N N 294 PHE C O doub N N 295 PHE C OXT sing N N 296 PHE CB CG sing N N 297 PHE CB HB2 sing N N 298 PHE CB HB3 sing N N 299 PHE CG CD1 doub Y N 300 PHE CG CD2 sing Y N 301 PHE CD1 CE1 sing Y N 302 PHE CD1 HD1 sing N N 303 PHE CD2 CE2 doub Y N 304 PHE CD2 HD2 sing N N 305 PHE CE1 CZ doub Y N 306 PHE CE1 HE1 sing N N 307 PHE CE2 CZ sing Y N 308 PHE CE2 HE2 sing N N 309 PHE CZ HZ sing N N 310 PHE OXT HXT sing N N 311 PRO N CA sing N N 312 PRO N CD sing N N 313 PRO N H sing N N 314 PRO CA C sing N N 315 PRO CA CB sing N N 316 PRO CA HA sing N N 317 PRO C O doub N N 318 PRO C OXT sing N N 319 PRO CB CG sing N N 320 PRO CB HB2 sing N N 321 PRO CB HB3 sing N N 322 PRO CG CD sing N N 323 PRO CG HG2 sing N N 324 PRO CG HG3 sing N N 325 PRO CD HD2 sing N N 326 PRO CD HD3 sing N N 327 PRO OXT HXT sing N N 328 SER N CA sing N N 329 SER N H sing N N 330 SER N H2 sing N N 331 SER CA C sing N N 332 SER CA CB sing N N 333 SER CA HA sing N N 334 SER C O doub N N 335 SER C OXT sing N N 336 SER CB OG sing N N 337 SER CB HB2 sing N N 338 SER CB HB3 sing N N 339 SER OG HG sing N N 340 SER OXT HXT sing N N 341 THR N CA sing N N 342 THR N H sing N N 343 THR N H2 sing N N 344 THR CA C sing N N 345 THR CA CB sing N N 346 THR CA HA sing N N 347 THR C O doub N N 348 THR C OXT sing N N 349 THR CB OG1 sing N N 350 THR CB CG2 sing N N 351 THR CB HB sing N N 352 THR OG1 HG1 sing N N 353 THR CG2 HG21 sing N N 354 THR CG2 HG22 sing N N 355 THR CG2 HG23 sing N N 356 THR OXT HXT sing N N 357 TRP N CA sing N N 358 TRP N H sing N N 359 TRP N H2 sing N N 360 TRP CA C sing N N 361 TRP CA CB sing N N 362 TRP CA HA sing N N 363 TRP C O doub N N 364 TRP C OXT sing N N 365 TRP CB CG sing N N 366 TRP CB HB2 sing N N 367 TRP CB HB3 sing N N 368 TRP CG CD1 doub Y N 369 TRP CG CD2 sing Y N 370 TRP CD1 NE1 sing Y N 371 TRP CD1 HD1 sing N N 372 TRP CD2 CE2 doub Y N 373 TRP CD2 CE3 sing Y N 374 TRP NE1 CE2 sing Y N 375 TRP NE1 HE1 sing N N 376 TRP CE2 CZ2 sing Y N 377 TRP CE3 CZ3 doub Y N 378 TRP CE3 HE3 sing N N 379 TRP CZ2 CH2 doub Y N 380 TRP CZ2 HZ2 sing N N 381 TRP CZ3 CH2 sing Y N 382 TRP CZ3 HZ3 sing N N 383 TRP CH2 HH2 sing N N 384 TRP OXT HXT sing N N 385 TYR N CA sing N N 386 TYR N H sing N N 387 TYR N H2 sing N N 388 TYR CA C sing N N 389 TYR CA CB sing N N 390 TYR CA HA sing N N 391 TYR C O doub N N 392 TYR C OXT sing N N 393 TYR CB CG sing N N 394 TYR CB HB2 sing N N 395 TYR CB HB3 sing N N 396 TYR CG CD1 doub Y N 397 TYR CG CD2 sing Y N 398 TYR CD1 CE1 sing Y N 399 TYR CD1 HD1 sing N N 400 TYR CD2 CE2 doub Y N 401 TYR CD2 HD2 sing N N 402 TYR CE1 CZ doub Y N 403 TYR CE1 HE1 sing N N 404 TYR CE2 CZ sing Y N 405 TYR CE2 HE2 sing N N 406 TYR CZ OH sing N N 407 TYR OH HH sing N N 408 TYR OXT HXT sing N N 409 VAL N CA sing N N 410 VAL N H sing N N 411 VAL N H2 sing N N 412 VAL CA C sing N N 413 VAL CA CB sing N N 414 VAL CA HA sing N N 415 VAL C O doub N N 416 VAL C OXT sing N N 417 VAL CB CG1 sing N N 418 VAL CB CG2 sing N N 419 VAL CB HB sing N N 420 VAL CG1 HG11 sing N N 421 VAL CG1 HG12 sing N N 422 VAL CG1 HG13 sing N N 423 VAL CG2 HG21 sing N N 424 VAL CG2 HG22 sing N N 425 VAL CG2 HG23 sing N N 426 VAL OXT HXT sing N N 427 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of Arthritis and Musculoskeletal and Skin Diseases (NIH/NIAMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number R01AR067288 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 NAG 1 n 2 NAG 2 n 2 BMA 3 n # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3RJR _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 5VQP _atom_sites.fract_transf_matrix[1][1] 0.009579 _atom_sites.fract_transf_matrix[1][2] 0.005531 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011061 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007047 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ # loop_ #