data_5VWY # _entry.id 5VWY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5VWY pdb_00005vwy 10.2210/pdb5vwy/pdb WWPDB D_1000227585 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-11-15 2 'Structure model' 1 1 2017-11-29 3 'Structure model' 1 2 2020-01-08 4 'Structure model' 1 3 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Author supporting evidence' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' pdbx_audit_support 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_entry_details 8 4 'Structure model' pdbx_modification_feature 9 4 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 3 'Structure model' '_pdbx_audit_support.funding_organization' 14 4 'Structure model' '_database_2.pdbx_DOI' 15 4 'Structure model' '_database_2.pdbx_database_accession' 16 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5VWY _pdbx_database_status.recvd_initial_deposition_date 2017-05-23 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Brouwer, J.M.' 1 ? 'Colman, P.M.' 2 ? 'Czabotar, P.E.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Mol. Cell' _citation.journal_id_ASTM MOCEFL _citation.journal_id_CSD 2168 _citation.journal_id_ISSN 1097-4164 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 68 _citation.language ? _citation.page_first 659 _citation.page_last 672.e9 _citation.title 'Conversion of Bim-BH3 from Activator to Inhibitor of Bak through Structure-Based Design.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.molcel.2017.11.001 _citation.pdbx_database_id_PubMed 29149594 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Brouwer, J.M.' 1 ? primary 'Lan, P.' 2 ? primary 'Cowan, A.D.' 3 ? primary 'Bernardini, J.P.' 4 ? primary 'Birkinshaw, R.W.' 5 ? primary 'van Delft, M.F.' 6 ? primary 'Sleebs, B.E.' 7 ? primary 'Robin, A.Y.' 8 ? primary 'Wardak, A.' 9 ? primary 'Tan, I.K.' 10 ? primary 'Reljic, B.' 11 ? primary 'Lee, E.F.' 12 ? primary 'Fairlie, W.D.' 13 ? primary 'Call, M.J.' 14 ? primary 'Smith, B.J.' 15 ? primary 'Dewson, G.' 16 ? primary 'Lessene, G.' 17 ? primary 'Colman, P.M.' 18 ? primary 'Czabotar, P.E.' 19 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Bcl-2 homologous antagonist/killer' 19037.320 1 ? C166S 'UNP residues 23-186' ? 2 polymer syn 'Bcl-2-like protein 11' 3241.641 1 ? 'W147R, Y163T' 'UNP residues 141-166' ? 3 non-polymer syn 'PHOSPHATE ION' 94.971 1 ? ? ? ? 4 water nat water 18.015 138 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'Apoptosis regulator BAK,Bcl-2-like protein 7,Bcl2-L-7' 2 'Bcl2-L-11,Bcl2-interacting mediator of cell death' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GPLGSMSEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTM LQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHSIARWIAQRGG WVAALNLGNG ; ;GPLGSMSEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTM LQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHSIARWIAQRGG WVAALNLGNG ; A ? 2 'polypeptide(L)' no yes 'DMRPEIRIAQELRR(9R1)GDEFNATYARR' DMRPEIRIAQELRRXGDEFNATYARR B ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'PHOSPHATE ION' PO4 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 LEU n 1 4 GLY n 1 5 SER n 1 6 MET n 1 7 SER n 1 8 GLU n 1 9 GLU n 1 10 GLN n 1 11 VAL n 1 12 ALA n 1 13 GLN n 1 14 ASP n 1 15 THR n 1 16 GLU n 1 17 GLU n 1 18 VAL n 1 19 PHE n 1 20 ARG n 1 21 SER n 1 22 TYR n 1 23 VAL n 1 24 PHE n 1 25 TYR n 1 26 ARG n 1 27 HIS n 1 28 GLN n 1 29 GLN n 1 30 GLU n 1 31 GLN n 1 32 GLU n 1 33 ALA n 1 34 GLU n 1 35 GLY n 1 36 VAL n 1 37 ALA n 1 38 ALA n 1 39 PRO n 1 40 ALA n 1 41 ASP n 1 42 PRO n 1 43 GLU n 1 44 MET n 1 45 VAL n 1 46 THR n 1 47 LEU n 1 48 PRO n 1 49 LEU n 1 50 GLN n 1 51 PRO n 1 52 SER n 1 53 SER n 1 54 THR n 1 55 MET n 1 56 GLY n 1 57 GLN n 1 58 VAL n 1 59 GLY n 1 60 ARG n 1 61 GLN n 1 62 LEU n 1 63 ALA n 1 64 ILE n 1 65 ILE n 1 66 GLY n 1 67 ASP n 1 68 ASP n 1 69 ILE n 1 70 ASN n 1 71 ARG n 1 72 ARG n 1 73 TYR n 1 74 ASP n 1 75 SER n 1 76 GLU n 1 77 PHE n 1 78 GLN n 1 79 THR n 1 80 MET n 1 81 LEU n 1 82 GLN n 1 83 HIS n 1 84 LEU n 1 85 GLN n 1 86 PRO n 1 87 THR n 1 88 ALA n 1 89 GLU n 1 90 ASN n 1 91 ALA n 1 92 TYR n 1 93 GLU n 1 94 TYR n 1 95 PHE n 1 96 THR n 1 97 LYS n 1 98 ILE n 1 99 ALA n 1 100 THR n 1 101 SER n 1 102 LEU n 1 103 PHE n 1 104 GLU n 1 105 SER n 1 106 GLY n 1 107 ILE n 1 108 ASN n 1 109 TRP n 1 110 GLY n 1 111 ARG n 1 112 VAL n 1 113 VAL n 1 114 ALA n 1 115 LEU n 1 116 LEU n 1 117 GLY n 1 118 PHE n 1 119 GLY n 1 120 TYR n 1 121 ARG n 1 122 LEU n 1 123 ALA n 1 124 LEU n 1 125 HIS n 1 126 VAL n 1 127 TYR n 1 128 GLN n 1 129 HIS n 1 130 GLY n 1 131 LEU n 1 132 THR n 1 133 GLY n 1 134 PHE n 1 135 LEU n 1 136 GLY n 1 137 GLN n 1 138 VAL n 1 139 THR n 1 140 ARG n 1 141 PHE n 1 142 VAL n 1 143 VAL n 1 144 ASP n 1 145 PHE n 1 146 MET n 1 147 LEU n 1 148 HIS n 1 149 HIS n 1 150 SER n 1 151 ILE n 1 152 ALA n 1 153 ARG n 1 154 TRP n 1 155 ILE n 1 156 ALA n 1 157 GLN n 1 158 ARG n 1 159 GLY n 1 160 GLY n 1 161 TRP n 1 162 VAL n 1 163 ALA n 1 164 ALA n 1 165 LEU n 1 166 ASN n 1 167 LEU n 1 168 GLY n 1 169 ASN n 1 170 GLY n 2 1 ASP n 2 2 MET n 2 3 ARG n 2 4 PRO n 2 5 GLU n 2 6 ILE n 2 7 ARG n 2 8 ILE n 2 9 ALA n 2 10 GLN n 2 11 GLU n 2 12 LEU n 2 13 ARG n 2 14 ARG n 2 15 9R1 n 2 16 GLY n 2 17 ASP n 2 18 GLU n 2 19 PHE n 2 20 ASN n 2 21 ALA n 2 22 THR n 2 23 TYR n 2 24 ALA n 2 25 ARG n 2 26 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 170 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'BAK1, BAK, BCL2L7, CDN1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 26 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name Human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 9R1 'L-peptide linking' . '(2S)-2-aminooctanedioic acid' ? 'C8 H15 N O4' 189.209 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PO4 non-polymer . 'PHOSPHATE ION' ? 'O4 P -3' 94.971 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 17 ? ? ? A . n A 1 2 PRO 2 18 ? ? ? A . n A 1 3 LEU 3 19 ? ? ? A . n A 1 4 GLY 4 20 ? ? ? A . n A 1 5 SER 5 21 ? ? ? A . n A 1 6 MET 6 22 ? ? ? A . n A 1 7 SER 7 23 23 SER SER A . n A 1 8 GLU 8 24 24 GLU GLU A . n A 1 9 GLU 9 25 25 GLU GLU A . n A 1 10 GLN 10 26 26 GLN GLN A . n A 1 11 VAL 11 27 27 VAL VAL A . n A 1 12 ALA 12 28 28 ALA ALA A . n A 1 13 GLN 13 29 29 GLN GLN A . n A 1 14 ASP 14 30 30 ASP ASP A . n A 1 15 THR 15 31 31 THR THR A . n A 1 16 GLU 16 32 32 GLU GLU A . n A 1 17 GLU 17 33 33 GLU GLU A . n A 1 18 VAL 18 34 34 VAL VAL A . n A 1 19 PHE 19 35 35 PHE PHE A . n A 1 20 ARG 20 36 36 ARG ARG A . n A 1 21 SER 21 37 37 SER SER A . n A 1 22 TYR 22 38 38 TYR TYR A . n A 1 23 VAL 23 39 39 VAL VAL A . n A 1 24 PHE 24 40 40 PHE PHE A . n A 1 25 TYR 25 41 41 TYR TYR A . n A 1 26 ARG 26 42 42 ARG ARG A . n A 1 27 HIS 27 43 43 HIS HIS A . n A 1 28 GLN 28 44 44 GLN GLN A . n A 1 29 GLN 29 45 45 GLN GLN A . n A 1 30 GLU 30 46 46 GLU GLU A . n A 1 31 GLN 31 47 47 GLN GLN A . n A 1 32 GLU 32 48 48 GLU GLU A . n A 1 33 ALA 33 49 ? ? ? A . n A 1 34 GLU 34 50 ? ? ? A . n A 1 35 GLY 35 51 ? ? ? A . n A 1 36 VAL 36 52 ? ? ? A . n A 1 37 ALA 37 53 ? ? ? A . n A 1 38 ALA 38 54 ? ? ? A . n A 1 39 PRO 39 55 ? ? ? A . n A 1 40 ALA 40 56 ? ? ? A . n A 1 41 ASP 41 57 57 ASP ASP A . n A 1 42 PRO 42 58 58 PRO PRO A . n A 1 43 GLU 43 59 59 GLU GLU A . n A 1 44 MET 44 60 60 MET MET A . n A 1 45 VAL 45 61 61 VAL VAL A . n A 1 46 THR 46 62 62 THR THR A . n A 1 47 LEU 47 63 ? ? ? A . n A 1 48 PRO 48 64 ? ? ? A . n A 1 49 LEU 49 65 ? ? ? A . n A 1 50 GLN 50 66 66 GLN GLN A . n A 1 51 PRO 51 67 67 PRO PRO A . n A 1 52 SER 52 68 68 SER SER A . n A 1 53 SER 53 69 69 SER SER A . n A 1 54 THR 54 70 70 THR THR A . n A 1 55 MET 55 71 71 MET MET A . n A 1 56 GLY 56 72 72 GLY GLY A . n A 1 57 GLN 57 73 73 GLN GLN A . n A 1 58 VAL 58 74 74 VAL VAL A . n A 1 59 GLY 59 75 75 GLY GLY A . n A 1 60 ARG 60 76 76 ARG ARG A . n A 1 61 GLN 61 77 77 GLN GLN A . n A 1 62 LEU 62 78 78 LEU LEU A . n A 1 63 ALA 63 79 79 ALA ALA A . n A 1 64 ILE 64 80 80 ILE ILE A . n A 1 65 ILE 65 81 81 ILE ILE A . n A 1 66 GLY 66 82 82 GLY GLY A . n A 1 67 ASP 67 83 83 ASP ASP A . n A 1 68 ASP 68 84 84 ASP ASP A . n A 1 69 ILE 69 85 85 ILE ILE A . n A 1 70 ASN 70 86 86 ASN ASN A . n A 1 71 ARG 71 87 87 ARG ARG A . n A 1 72 ARG 72 88 88 ARG ARG A . n A 1 73 TYR 73 89 89 TYR TYR A . n A 1 74 ASP 74 90 90 ASP ASP A . n A 1 75 SER 75 91 91 SER SER A . n A 1 76 GLU 76 92 92 GLU GLU A . n A 1 77 PHE 77 93 93 PHE PHE A . n A 1 78 GLN 78 94 94 GLN GLN A . n A 1 79 THR 79 95 95 THR THR A . n A 1 80 MET 80 96 96 MET MET A . n A 1 81 LEU 81 97 97 LEU LEU A . n A 1 82 GLN 82 98 98 GLN GLN A . n A 1 83 HIS 83 99 99 HIS HIS A . n A 1 84 LEU 84 100 100 LEU LEU A . n A 1 85 GLN 85 101 101 GLN GLN A . n A 1 86 PRO 86 102 102 PRO PRO A . n A 1 87 THR 87 103 103 THR THR A . n A 1 88 ALA 88 104 104 ALA ALA A . n A 1 89 GLU 89 105 105 GLU GLU A . n A 1 90 ASN 90 106 106 ASN ASN A . n A 1 91 ALA 91 107 107 ALA ALA A . n A 1 92 TYR 92 108 108 TYR TYR A . n A 1 93 GLU 93 109 109 GLU GLU A . n A 1 94 TYR 94 110 110 TYR TYR A . n A 1 95 PHE 95 111 111 PHE PHE A . n A 1 96 THR 96 112 112 THR THR A . n A 1 97 LYS 97 113 113 LYS LYS A . n A 1 98 ILE 98 114 114 ILE ILE A . n A 1 99 ALA 99 115 115 ALA ALA A . n A 1 100 THR 100 116 116 THR THR A . n A 1 101 SER 101 117 117 SER SER A . n A 1 102 LEU 102 118 118 LEU LEU A . n A 1 103 PHE 103 119 119 PHE PHE A . n A 1 104 GLU 104 120 120 GLU GLU A . n A 1 105 SER 105 121 121 SER SER A . n A 1 106 GLY 106 122 122 GLY GLY A . n A 1 107 ILE 107 123 123 ILE ILE A . n A 1 108 ASN 108 124 124 ASN ASN A . n A 1 109 TRP 109 125 125 TRP TRP A . n A 1 110 GLY 110 126 126 GLY GLY A . n A 1 111 ARG 111 127 127 ARG ARG A . n A 1 112 VAL 112 128 128 VAL VAL A . n A 1 113 VAL 113 129 129 VAL VAL A . n A 1 114 ALA 114 130 130 ALA ALA A . n A 1 115 LEU 115 131 131 LEU LEU A . n A 1 116 LEU 116 132 132 LEU LEU A . n A 1 117 GLY 117 133 133 GLY GLY A . n A 1 118 PHE 118 134 134 PHE PHE A . n A 1 119 GLY 119 135 135 GLY GLY A . n A 1 120 TYR 120 136 136 TYR TYR A . n A 1 121 ARG 121 137 137 ARG ARG A . n A 1 122 LEU 122 138 138 LEU LEU A . n A 1 123 ALA 123 139 139 ALA ALA A . n A 1 124 LEU 124 140 140 LEU LEU A . n A 1 125 HIS 125 141 141 HIS HIS A . n A 1 126 VAL 126 142 142 VAL VAL A . n A 1 127 TYR 127 143 143 TYR TYR A . n A 1 128 GLN 128 144 144 GLN GLN A . n A 1 129 HIS 129 145 145 HIS HIS A . n A 1 130 GLY 130 146 146 GLY GLY A . n A 1 131 LEU 131 147 147 LEU LEU A . n A 1 132 THR 132 148 148 THR THR A . n A 1 133 GLY 133 149 149 GLY GLY A . n A 1 134 PHE 134 150 150 PHE PHE A . n A 1 135 LEU 135 151 151 LEU LEU A . n A 1 136 GLY 136 152 152 GLY GLY A . n A 1 137 GLN 137 153 153 GLN GLN A . n A 1 138 VAL 138 154 154 VAL VAL A . n A 1 139 THR 139 155 155 THR THR A . n A 1 140 ARG 140 156 156 ARG ARG A . n A 1 141 PHE 141 157 157 PHE PHE A . n A 1 142 VAL 142 158 158 VAL VAL A . n A 1 143 VAL 143 159 159 VAL VAL A . n A 1 144 ASP 144 160 160 ASP ASP A . n A 1 145 PHE 145 161 161 PHE PHE A . n A 1 146 MET 146 162 162 MET MET A . n A 1 147 LEU 147 163 163 LEU LEU A . n A 1 148 HIS 148 164 164 HIS HIS A . n A 1 149 HIS 149 165 165 HIS HIS A . n A 1 150 SER 150 166 166 SER SER A . n A 1 151 ILE 151 167 167 ILE ILE A . n A 1 152 ALA 152 168 168 ALA ALA A . n A 1 153 ARG 153 169 169 ARG ARG A . n A 1 154 TRP 154 170 170 TRP TRP A . n A 1 155 ILE 155 171 171 ILE ILE A . n A 1 156 ALA 156 172 172 ALA ALA A . n A 1 157 GLN 157 173 173 GLN GLN A . n A 1 158 ARG 158 174 174 ARG ARG A . n A 1 159 GLY 159 175 175 GLY GLY A . n A 1 160 GLY 160 176 176 GLY GLY A . n A 1 161 TRP 161 177 177 TRP TRP A . n A 1 162 VAL 162 178 178 VAL VAL A . n A 1 163 ALA 163 179 179 ALA ALA A . n A 1 164 ALA 164 180 180 ALA ALA A . n A 1 165 LEU 165 181 181 LEU LEU A . n A 1 166 ASN 166 182 182 ASN ASN A . n A 1 167 LEU 167 183 183 LEU LEU A . n A 1 168 GLY 168 184 184 GLY GLY A . n A 1 169 ASN 169 185 185 ASN ASN A . n A 1 170 GLY 170 186 186 GLY GLY A . n B 2 1 ASP 1 141 141 ASP ASP B . n B 2 2 MET 2 142 142 MET MET B . n B 2 3 ARG 3 143 143 ARG ARG B . n B 2 4 PRO 4 144 144 PRO PRO B . n B 2 5 GLU 5 145 145 GLU GLU B . n B 2 6 ILE 6 146 146 ILE ILE B . n B 2 7 ARG 7 147 147 ARG ARG B . n B 2 8 ILE 8 148 148 ILE ILE B . n B 2 9 ALA 9 149 149 ALA ALA B . n B 2 10 GLN 10 150 150 GLN GLN B . n B 2 11 GLU 11 151 151 GLU GLU B . n B 2 12 LEU 12 152 152 LEU LEU B . n B 2 13 ARG 13 153 153 ARG ARG B . n B 2 14 ARG 14 154 154 ARG ARG B . n B 2 15 9R1 15 155 155 9R1 PEN B . n B 2 16 GLY 16 156 156 GLY GLY B . n B 2 17 ASP 17 157 157 ASP ASP B . n B 2 18 GLU 18 158 158 GLU GLU B . n B 2 19 PHE 19 159 159 PHE PHE B . n B 2 20 ASN 20 160 160 ASN ASN B . n B 2 21 ALA 21 161 161 ALA ALA B . n B 2 22 THR 22 162 162 THR THR B . n B 2 23 TYR 23 163 163 TYR TYR B . n B 2 24 ALA 24 164 164 ALA ALA B . n B 2 25 ARG 25 165 165 ARG ARG B . n B 2 26 ARG 26 166 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 PO4 1 201 1 PO4 PO4 A . D 4 HOH 1 301 97 HOH HOH A . D 4 HOH 2 302 45 HOH HOH A . D 4 HOH 3 303 40 HOH HOH A . D 4 HOH 4 304 95 HOH HOH A . D 4 HOH 5 305 99 HOH HOH A . D 4 HOH 6 306 20 HOH HOH A . D 4 HOH 7 307 61 HOH HOH A . D 4 HOH 8 308 92 HOH HOH A . D 4 HOH 9 309 56 HOH HOH A . D 4 HOH 10 310 24 HOH HOH A . D 4 HOH 11 311 75 HOH HOH A . D 4 HOH 12 312 64 HOH HOH A . D 4 HOH 13 313 57 HOH HOH A . D 4 HOH 14 314 96 HOH HOH A . D 4 HOH 15 315 59 HOH HOH A . D 4 HOH 16 316 55 HOH HOH A . D 4 HOH 17 317 25 HOH HOH A . D 4 HOH 18 318 107 HOH HOH A . D 4 HOH 19 319 16 HOH HOH A . D 4 HOH 20 320 133 HOH HOH A . D 4 HOH 21 321 88 HOH HOH A . D 4 HOH 22 322 89 HOH HOH A . D 4 HOH 23 323 134 HOH HOH A . D 4 HOH 24 324 103 HOH HOH A . D 4 HOH 25 325 90 HOH HOH A . D 4 HOH 26 326 72 HOH HOH A . D 4 HOH 27 327 22 HOH HOH A . D 4 HOH 28 328 53 HOH HOH A . D 4 HOH 29 329 19 HOH HOH A . D 4 HOH 30 330 73 HOH HOH A . D 4 HOH 31 331 7 HOH HOH A . D 4 HOH 32 332 4 HOH HOH A . D 4 HOH 33 333 41 HOH HOH A . D 4 HOH 34 334 114 HOH HOH A . D 4 HOH 35 335 136 HOH HOH A . D 4 HOH 36 336 32 HOH HOH A . D 4 HOH 37 337 51 HOH HOH A . D 4 HOH 38 338 74 HOH HOH A . D 4 HOH 39 339 69 HOH HOH A . D 4 HOH 40 340 6 HOH HOH A . D 4 HOH 41 341 30 HOH HOH A . D 4 HOH 42 342 11 HOH HOH A . D 4 HOH 43 343 155 HOH HOH A . D 4 HOH 44 344 36 HOH HOH A . D 4 HOH 45 345 117 HOH HOH A . D 4 HOH 46 346 137 HOH HOH A . D 4 HOH 47 347 14 HOH HOH A . D 4 HOH 48 348 78 HOH HOH A . D 4 HOH 49 349 29 HOH HOH A . D 4 HOH 50 350 100 HOH HOH A . D 4 HOH 51 351 113 HOH HOH A . D 4 HOH 52 352 17 HOH HOH A . D 4 HOH 53 353 132 HOH HOH A . D 4 HOH 54 354 116 HOH HOH A . D 4 HOH 55 355 31 HOH HOH A . D 4 HOH 56 356 33 HOH HOH A . D 4 HOH 57 357 156 HOH HOH A . D 4 HOH 58 358 47 HOH HOH A . D 4 HOH 59 359 26 HOH HOH A . D 4 HOH 60 360 111 HOH HOH A . D 4 HOH 61 361 152 HOH HOH A . D 4 HOH 62 362 105 HOH HOH A . D 4 HOH 63 363 9 HOH HOH A . D 4 HOH 64 364 126 HOH HOH A . D 4 HOH 65 365 130 HOH HOH A . D 4 HOH 66 366 81 HOH HOH A . D 4 HOH 67 367 43 HOH HOH A . D 4 HOH 68 368 49 HOH HOH A . D 4 HOH 69 369 102 HOH HOH A . D 4 HOH 70 370 98 HOH HOH A . D 4 HOH 71 371 10 HOH HOH A . D 4 HOH 72 372 34 HOH HOH A . D 4 HOH 73 373 28 HOH HOH A . D 4 HOH 74 374 46 HOH HOH A . D 4 HOH 75 375 135 HOH HOH A . D 4 HOH 76 376 38 HOH HOH A . D 4 HOH 77 377 76 HOH HOH A . D 4 HOH 78 378 23 HOH HOH A . D 4 HOH 79 379 65 HOH HOH A . D 4 HOH 80 380 154 HOH HOH A . D 4 HOH 81 381 44 HOH HOH A . D 4 HOH 82 382 54 HOH HOH A . D 4 HOH 83 383 138 HOH HOH A . D 4 HOH 84 384 144 HOH HOH A . D 4 HOH 85 385 109 HOH HOH A . D 4 HOH 86 386 112 HOH HOH A . D 4 HOH 87 387 50 HOH HOH A . D 4 HOH 88 388 27 HOH HOH A . D 4 HOH 89 389 124 HOH HOH A . D 4 HOH 90 390 142 HOH HOH A . D 4 HOH 91 391 108 HOH HOH A . D 4 HOH 92 392 127 HOH HOH A . D 4 HOH 93 393 149 HOH HOH A . D 4 HOH 94 394 91 HOH HOH A . D 4 HOH 95 395 18 HOH HOH A . D 4 HOH 96 396 118 HOH HOH A . D 4 HOH 97 397 120 HOH HOH A . D 4 HOH 98 398 101 HOH HOH A . D 4 HOH 99 399 131 HOH HOH A . D 4 HOH 100 400 87 HOH HOH A . D 4 HOH 101 401 80 HOH HOH A . D 4 HOH 102 402 42 HOH HOH A . D 4 HOH 103 403 139 HOH HOH A . D 4 HOH 104 404 70 HOH HOH A . D 4 HOH 105 405 145 HOH HOH A . D 4 HOH 106 406 68 HOH HOH A . D 4 HOH 107 407 106 HOH HOH A . D 4 HOH 108 408 104 HOH HOH A . D 4 HOH 109 409 146 HOH HOH A . D 4 HOH 110 410 125 HOH HOH A . D 4 HOH 111 411 67 HOH HOH A . D 4 HOH 112 412 121 HOH HOH A . D 4 HOH 113 413 140 HOH HOH A . D 4 HOH 114 414 94 HOH HOH A . D 4 HOH 115 415 71 HOH HOH A . D 4 HOH 116 416 143 HOH HOH A . E 4 HOH 1 201 93 HOH HOH B . E 4 HOH 2 202 153 HOH HOH B . E 4 HOH 3 203 82 HOH HOH B . E 4 HOH 4 204 129 HOH HOH B . E 4 HOH 5 205 5 HOH HOH B . E 4 HOH 6 206 66 HOH HOH B . E 4 HOH 7 207 39 HOH HOH B . E 4 HOH 8 208 2 HOH HOH B . E 4 HOH 9 209 15 HOH HOH B . E 4 HOH 10 210 21 HOH HOH B . E 4 HOH 11 211 83 HOH HOH B . E 4 HOH 12 212 63 HOH HOH B . E 4 HOH 13 213 13 HOH HOH B . E 4 HOH 14 214 147 HOH HOH B . E 4 HOH 15 215 52 HOH HOH B . E 4 HOH 16 216 77 HOH HOH B . E 4 HOH 17 217 62 HOH HOH B . E 4 HOH 18 218 48 HOH HOH B . E 4 HOH 19 219 141 HOH HOH B . E 4 HOH 20 220 37 HOH HOH B . E 4 HOH 21 221 151 HOH HOH B . E 4 HOH 22 222 150 HOH HOH B . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.10.1_2155 1 ? 'data processing' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 107.86 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5VWY _cell.details ? _cell.formula_units_Z ? _cell.length_a 65.890 _cell.length_a_esd ? _cell.length_b 37.540 _cell.length_b_esd ? _cell.length_c 69.560 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5VWY _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5VWY _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.84 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 33.07 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '15.8 % PEG 8000, 50 mM potassium dihydrogen phosphate, and 22.7 % glycerol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-02-04 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9537 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'AUSTRALIAN SYNCHROTRON BEAMLINE MX2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9537 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MX2 _diffrn_source.pdbx_synchrotron_site 'Australian Synchrotron' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5VWY _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.555 _reflns.d_resolution_low 32.45 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 21962 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 93 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.6 _reflns.pdbx_Rmerge_I_obs 0.06555 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.68 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high . _reflns_shell.d_res_low ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5VWY _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.555 _refine.ls_d_res_low 32.450 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 21962 _refine.ls_number_reflns_R_free 1998 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 93.40 _refine.ls_percent_reflns_R_free 9.10 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1787 _refine.ls_R_factor_R_free 0.2156 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1750 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 23.11 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.19 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1452 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.number_atoms_solvent 138 _refine_hist.number_atoms_total 1595 _refine_hist.d_res_high 1.555 _refine_hist.d_res_low 32.450 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 ? 1496 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.138 ? 2021 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 22.434 ? 871 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.052 ? 209 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 269 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.5554 1.5943 . . 99 991 65.00 . . . 0.4062 . 0.3663 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.5943 1.6374 . . 111 1086 72.00 . . . 0.3581 . 0.3040 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.6374 1.6855 . . 145 1401 94.00 . . . 0.2611 . 0.2563 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.6855 1.7399 . . 145 1484 97.00 . . . 0.2797 . 0.2387 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7399 1.8021 . . 144 1462 96.00 . . . 0.2909 . 0.2240 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8021 1.8743 . . 146 1457 96.00 . . . 0.2247 . 0.2024 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8743 1.9596 . . 150 1472 98.00 . . . 0.2239 . 0.2056 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9596 2.0629 . . 146 1493 98.00 . . . 0.2373 . 0.1783 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0629 2.1921 . . 145 1510 98.00 . . . 0.1928 . 0.1610 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1921 2.3613 . . 154 1492 98.00 . . . 0.1967 . 0.1638 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3613 2.5988 . . 144 1497 99.00 . . . 0.2118 . 0.1586 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5988 2.9747 . . 154 1509 99.00 . . . 0.2103 . 0.1617 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9747 3.7469 . . 153 1541 99.00 . . . 0.1925 . 0.1545 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.7469 32.4566 . . 162 1569 99.00 . . . 0.1984 . 0.1566 . . . . . . . . . . # _struct.entry_id 5VWY _struct.title 'Bak core latch dimer in complex with Bim-h3Pc-RT' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5VWY _struct_keywords.text 'Apoptosis, Bcl-2 Family, Inhibitor' _struct_keywords.pdbx_keywords APOPTOSIS # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP BAK_HUMAN Q16611 ? 1 ;SEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQP TAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALN LGNG ; 23 2 UNP B2L11_HUMAN O43521 ? 2 DMRPEIWIAQELRRIGDEFNAYYARR 141 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5VWY A 7 ? 170 ? Q16611 23 ? 186 ? 23 186 2 2 5VWY B 1 ? 26 ? O43521 141 ? 166 ? 141 166 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5VWY GLY A 1 ? UNP Q16611 ? ? 'expression tag' 17 1 1 5VWY PRO A 2 ? UNP Q16611 ? ? 'expression tag' 18 2 1 5VWY LEU A 3 ? UNP Q16611 ? ? 'expression tag' 19 3 1 5VWY GLY A 4 ? UNP Q16611 ? ? 'expression tag' 20 4 1 5VWY SER A 5 ? UNP Q16611 ? ? 'expression tag' 21 5 1 5VWY MET A 6 ? UNP Q16611 ? ? 'expression tag' 22 6 1 5VWY SER A 150 ? UNP Q16611 CYS 166 'engineered mutation' 166 7 2 5VWY ARG B 7 ? UNP O43521 TRP 147 'engineered mutation' 147 8 2 5VWY THR B 22 ? UNP O43521 TYR 162 'engineered mutation' 162 9 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 12040 ? 1 MORE -122 ? 1 'SSA (A^2)' 16690 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_556 -x,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 -21.3335097612 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 66.2078164665 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 7 ? GLN A 31 ? SER A 23 GLN A 47 1 ? 25 HELX_P HELX_P2 AA2 ASP A 41 ? VAL A 45 ? ASP A 57 VAL A 61 5 ? 5 HELX_P HELX_P3 AA3 SER A 53 ? GLY A 66 ? SER A 69 GLY A 82 1 ? 14 HELX_P HELX_P4 AA4 GLY A 66 ? TYR A 73 ? GLY A 82 TYR A 89 1 ? 8 HELX_P HELX_P5 AA5 TYR A 73 ? GLN A 85 ? TYR A 89 GLN A 101 1 ? 13 HELX_P HELX_P6 AA6 ASN A 90 ? PHE A 103 ? ASN A 106 PHE A 119 1 ? 14 HELX_P HELX_P7 AA7 ASN A 108 ? HIS A 129 ? ASN A 124 HIS A 145 1 ? 22 HELX_P HELX_P8 AA8 GLY A 133 ? HIS A 149 ? GLY A 149 HIS A 165 1 ? 17 HELX_P HELX_P9 AA9 SER A 150 ? ARG A 158 ? SER A 166 ARG A 174 1 ? 9 HELX_P HELX_P10 AB1 GLY A 160 ? LEU A 167 ? GLY A 176 LEU A 183 5 ? 8 HELX_P HELX_P11 AB2 ARG B 3 ? ALA B 24 ? ARG B 143 ALA B 164 1 ? 22 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B ARG 14 C ? ? ? 1_555 B 9R1 15 N ? ? B ARG 154 B 9R1 155 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale2 covale both ? B 9R1 15 C ? ? ? 1_555 B GLY 16 N ? ? B 9R1 155 B GLY 156 1_555 ? ? ? ? ? ? ? 1.320 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id 9R1 _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id 15 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id . _pdbx_modification_feature.modified_residue_label_asym_id . _pdbx_modification_feature.modified_residue_label_seq_id . _pdbx_modification_feature.modified_residue_label_alt_id . _pdbx_modification_feature.auth_comp_id 9R1 _pdbx_modification_feature.auth_asym_id B _pdbx_modification_feature.auth_seq_id 155 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id . _pdbx_modification_feature.modified_residue_auth_asym_id . _pdbx_modification_feature.modified_residue_auth_seq_id . _pdbx_modification_feature.modified_residue_PDB_ins_code . _pdbx_modification_feature.modified_residue_symmetry . _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id ? _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id 9R1 _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Non-standard residue' # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id PO4 _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 11 _struct_site.details 'binding site for residue PO4 A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 11 ARG A 72 ? ARG A 88 . ? 4_445 ? 2 AC1 11 ASN A 108 ? ASN A 124 . ? 1_555 ? 3 AC1 11 TRP A 109 ? TRP A 125 . ? 1_555 ? 4 AC1 11 TRP A 154 ? TRP A 170 . ? 2_556 ? 5 AC1 11 ARG A 158 ? ARG A 174 . ? 2_556 ? 6 AC1 11 HOH D . ? HOH A 307 . ? 1_555 ? 7 AC1 11 HOH D . ? HOH A 308 . ? 1_555 ? 8 AC1 11 HOH D . ? HOH A 317 . ? 1_555 ? 9 AC1 11 HOH D . ? HOH A 380 . ? 1_555 ? 10 AC1 11 ASN B 20 ? ASN B 160 . ? 1_555 ? 11 AC1 11 ALA B 24 ? ALA B 164 . ? 1_555 ? # _pdbx_entry_details.entry_id 5VWY _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE1 A GLU 46 ? ? O A HOH 301 ? ? 2.12 2 1 OE1 B GLU 158 ? ? O B HOH 201 ? ? 2.13 3 1 NH1 B ARG 147 ? ? O B HOH 202 ? ? 2.19 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 67 ? ? -23.02 112.23 2 1 SER A 68 ? ? -119.91 -153.34 3 1 SER A 69 ? ? -161.94 -108.67 # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id B _pdbx_struct_mod_residue.label_comp_id 9R1 _pdbx_struct_mod_residue.label_seq_id 15 _pdbx_struct_mod_residue.auth_asym_id B _pdbx_struct_mod_residue.auth_comp_id 9R1 _pdbx_struct_mod_residue.auth_seq_id 155 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id ILE _pdbx_struct_mod_residue.details 'modified residue' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined -4.2928 13.7322 14.7633 0.1165 0.1618 0.1208 0.0079 -0.0094 0.0126 4.7982 2.4529 5.4198 -1.1475 -0.3135 3.2260 -0.1376 -0.0260 -0.1181 0.4972 0.2010 -0.3614 0.2630 0.5202 -0.1356 'X-RAY DIFFRACTION' 2 ? refined -7.8846 24.5661 25.1403 0.5841 0.4313 0.3182 0.0131 -0.1020 -0.0311 6.6098 3.6895 3.8532 -4.9279 3.6842 -2.7015 -0.7106 0.1715 0.8093 1.2896 0.2778 -0.5455 -0.7315 0.2235 0.4696 'X-RAY DIFFRACTION' 3 ? refined 2.8376 17.4531 18.9594 0.6168 0.7747 1.0911 0.2469 -0.2326 -0.0790 4.8315 4.3033 7.2099 -4.3840 3.7161 -2.1860 -0.4058 -0.7772 -0.2153 0.9409 1.0696 -0.9942 2.0967 2.8889 -0.5836 'X-RAY DIFFRACTION' 4 ? refined -3.5458 19.2751 8.3108 0.1172 0.1772 0.1828 -0.0418 0.0128 0.0129 4.4028 7.4808 4.2608 -4.3465 0.2999 -2.0396 0.0451 0.0843 0.6037 -0.1238 -0.1155 -0.7991 -0.2256 0.4568 0.0153 'X-RAY DIFFRACTION' 5 ? refined -22.1731 22.8233 16.3912 0.2065 0.1456 0.1666 0.0418 -0.0157 -0.0509 8.8875 6.2799 7.4109 2.5956 -5.9621 -4.5278 0.2738 -0.3376 0.5078 0.3736 -0.0188 0.2686 -0.5450 0.0287 -0.3085 'X-RAY DIFFRACTION' 6 ? refined -21.0190 7.2533 22.5959 0.2215 0.1885 0.1689 0.0037 0.0293 0.0303 4.6259 3.7728 2.0417 0.4100 0.6948 2.6399 0.0768 -0.6179 -0.2273 0.6530 0.0290 0.0798 0.6519 -0.3264 -0.1078 'X-RAY DIFFRACTION' 7 ? refined -20.0427 5.9479 5.5355 0.1017 0.0754 0.1113 -0.0106 0.0093 -0.0199 7.7353 3.7990 3.0221 -0.6683 2.6919 2.5355 0.0088 0.0414 -0.1709 0.0922 -0.0043 -0.0165 0.3037 -0.2843 0.0154 'X-RAY DIFFRACTION' 8 ? refined -14.7565 15.8049 17.4693 0.0984 0.0919 0.1041 0.0034 0.0099 0.0110 2.0443 1.8675 9.0457 0.9535 1.3490 1.6088 0.0762 -0.2766 0.0003 0.1873 -0.1022 0.0002 -0.3051 -0.1612 0.0574 'X-RAY DIFFRACTION' 9 ? refined -12.2929 8.0074 43.4933 0.2976 0.2042 0.1567 -0.0545 -0.0294 -0.0376 2.3442 6.4443 3.5261 -1.6538 0.9368 -3.9154 0.1343 0.3824 -0.0811 -1.0507 0.0596 0.2330 0.6543 -0.1835 -0.2220 'X-RAY DIFFRACTION' 10 ? refined -13.7015 8.4716 63.2936 0.1116 0.1975 0.0956 -0.0339 0.0094 0.0471 3.2714 7.3171 3.3700 -0.4780 -0.7600 2.6385 0.1142 -0.3082 -0.1134 0.3393 -0.1766 0.0269 0.1697 -0.2625 0.0799 'X-RAY DIFFRACTION' 11 ? refined -23.4252 15.4525 9.1780 0.1022 0.0834 0.1078 0.0018 -0.0337 0.0097 9.1256 3.4736 6.5643 3.2213 -6.5549 -3.0031 0.0399 -0.0869 -0.0644 0.0199 -0.0187 0.1813 0.1024 -0.1793 -0.0436 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 23 through 46 ) ; 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 47 through 60 ) ; 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 61 through 69 ) ; 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 70 through 82 ) ; 'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 83 through 100 ) ; 'X-RAY DIFFRACTION' 6 6 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 101 through 118 ) ; 'X-RAY DIFFRACTION' 7 7 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 119 through 124 ) ; 'X-RAY DIFFRACTION' 8 8 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 125 through 144 ) ; 'X-RAY DIFFRACTION' 9 9 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 145 through 164 ) ; 'X-RAY DIFFRACTION' 10 10 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 165 through 186 ) ; 'X-RAY DIFFRACTION' 11 11 ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 141 through 165 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 17 ? A GLY 1 2 1 Y 1 A PRO 18 ? A PRO 2 3 1 Y 1 A LEU 19 ? A LEU 3 4 1 Y 1 A GLY 20 ? A GLY 4 5 1 Y 1 A SER 21 ? A SER 5 6 1 Y 1 A MET 22 ? A MET 6 7 1 Y 1 A ALA 49 ? A ALA 33 8 1 Y 1 A GLU 50 ? A GLU 34 9 1 Y 1 A GLY 51 ? A GLY 35 10 1 Y 1 A VAL 52 ? A VAL 36 11 1 Y 1 A ALA 53 ? A ALA 37 12 1 Y 1 A ALA 54 ? A ALA 38 13 1 Y 1 A PRO 55 ? A PRO 39 14 1 Y 1 A ALA 56 ? A ALA 40 15 1 Y 1 A LEU 63 ? A LEU 47 16 1 Y 1 A PRO 64 ? A PRO 48 17 1 Y 1 A LEU 65 ? A LEU 49 18 1 Y 1 B ARG 166 ? B ARG 26 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 9R1 N N N N 1 9R1 CA C N S 2 9R1 C C N N 3 9R1 O O N N 4 9R1 CB C N N 5 9R1 CG C N N 6 9R1 CD C N N 7 9R1 CE C N N 8 9R1 CZ C N N 9 9R1 CN C N N 10 9R1 ON1 O N N 11 9R1 ON2 O N N 12 9R1 OXT O N N 13 9R1 H H N N 14 9R1 H2 H N N 15 9R1 HA H N N 16 9R1 H5 H N N 17 9R1 H6 H N N 18 9R1 H7 H N N 19 9R1 H8 H N N 20 9R1 H9 H N N 21 9R1 H10 H N N 22 9R1 H11 H N N 23 9R1 H12 H N N 24 9R1 H13 H N N 25 9R1 H14 H N N 26 9R1 H15 H N N 27 9R1 HXT H N N 28 ALA N N N N 29 ALA CA C N S 30 ALA C C N N 31 ALA O O N N 32 ALA CB C N N 33 ALA OXT O N N 34 ALA H H N N 35 ALA H2 H N N 36 ALA HA H N N 37 ALA HB1 H N N 38 ALA HB2 H N N 39 ALA HB3 H N N 40 ALA HXT H N N 41 ARG N N N N 42 ARG CA C N S 43 ARG C C N N 44 ARG O O N N 45 ARG CB C N N 46 ARG CG C N N 47 ARG CD C N N 48 ARG NE N N N 49 ARG CZ C N N 50 ARG NH1 N N N 51 ARG NH2 N N N 52 ARG OXT O N N 53 ARG H H N N 54 ARG H2 H N N 55 ARG HA H N N 56 ARG HB2 H N N 57 ARG HB3 H N N 58 ARG HG2 H N N 59 ARG HG3 H N N 60 ARG HD2 H N N 61 ARG HD3 H N N 62 ARG HE H N N 63 ARG HH11 H N N 64 ARG HH12 H N N 65 ARG HH21 H N N 66 ARG HH22 H N N 67 ARG HXT H N N 68 ASN N N N N 69 ASN CA C N S 70 ASN C C N N 71 ASN O O N N 72 ASN CB C N N 73 ASN CG C N N 74 ASN OD1 O N N 75 ASN ND2 N N N 76 ASN OXT O N N 77 ASN H H N N 78 ASN H2 H N N 79 ASN HA H N N 80 ASN HB2 H N N 81 ASN HB3 H N N 82 ASN HD21 H N N 83 ASN HD22 H N N 84 ASN HXT H N N 85 ASP N N N N 86 ASP CA C N S 87 ASP C C N N 88 ASP O O N N 89 ASP CB C N N 90 ASP CG C N N 91 ASP OD1 O N N 92 ASP OD2 O N N 93 ASP OXT O N N 94 ASP H H N N 95 ASP H2 H N N 96 ASP HA H N N 97 ASP HB2 H N N 98 ASP HB3 H N N 99 ASP HD2 H N N 100 ASP HXT H N N 101 CYS N N N N 102 CYS CA C N R 103 CYS C C N N 104 CYS O O N N 105 CYS CB C N N 106 CYS SG S N N 107 CYS OXT O N N 108 CYS H H N N 109 CYS H2 H N N 110 CYS HA H N N 111 CYS HB2 H N N 112 CYS HB3 H N N 113 CYS HG H N N 114 CYS HXT H N N 115 GLN N N N N 116 GLN CA C N S 117 GLN C C N N 118 GLN O O N N 119 GLN CB C N N 120 GLN CG C N N 121 GLN CD C N N 122 GLN OE1 O N N 123 GLN NE2 N N N 124 GLN OXT O N N 125 GLN H H N N 126 GLN H2 H N N 127 GLN HA H N N 128 GLN HB2 H N N 129 GLN HB3 H N N 130 GLN HG2 H N N 131 GLN HG3 H N N 132 GLN HE21 H N N 133 GLN HE22 H N N 134 GLN HXT H N N 135 GLU N N N N 136 GLU CA C N S 137 GLU C C N N 138 GLU O O N N 139 GLU CB C N N 140 GLU CG C N N 141 GLU CD C N N 142 GLU OE1 O N N 143 GLU OE2 O N N 144 GLU OXT O N N 145 GLU H H N N 146 GLU H2 H N N 147 GLU HA H N N 148 GLU HB2 H N N 149 GLU HB3 H N N 150 GLU HG2 H N N 151 GLU HG3 H N N 152 GLU HE2 H N N 153 GLU HXT H N N 154 GLY N N N N 155 GLY CA C N N 156 GLY C C N N 157 GLY O O N N 158 GLY OXT O N N 159 GLY H H N N 160 GLY H2 H N N 161 GLY HA2 H N N 162 GLY HA3 H N N 163 GLY HXT H N N 164 HIS N N N N 165 HIS CA C N S 166 HIS C C N N 167 HIS O O N N 168 HIS CB C N N 169 HIS CG C Y N 170 HIS ND1 N Y N 171 HIS CD2 C Y N 172 HIS CE1 C Y N 173 HIS NE2 N Y N 174 HIS OXT O N N 175 HIS H H N N 176 HIS H2 H N N 177 HIS HA H N N 178 HIS HB2 H N N 179 HIS HB3 H N N 180 HIS HD1 H N N 181 HIS HD2 H N N 182 HIS HE1 H N N 183 HIS HE2 H N N 184 HIS HXT H N N 185 HOH O O N N 186 HOH H1 H N N 187 HOH H2 H N N 188 ILE N N N N 189 ILE CA C N S 190 ILE C C N N 191 ILE O O N N 192 ILE CB C N S 193 ILE CG1 C N N 194 ILE CG2 C N N 195 ILE CD1 C N N 196 ILE OXT O N N 197 ILE H H N N 198 ILE H2 H N N 199 ILE HA H N N 200 ILE HB H N N 201 ILE HG12 H N N 202 ILE HG13 H N N 203 ILE HG21 H N N 204 ILE HG22 H N N 205 ILE HG23 H N N 206 ILE HD11 H N N 207 ILE HD12 H N N 208 ILE HD13 H N N 209 ILE HXT H N N 210 LEU N N N N 211 LEU CA C N S 212 LEU C C N N 213 LEU O O N N 214 LEU CB C N N 215 LEU CG C N N 216 LEU CD1 C N N 217 LEU CD2 C N N 218 LEU OXT O N N 219 LEU H H N N 220 LEU H2 H N N 221 LEU HA H N N 222 LEU HB2 H N N 223 LEU HB3 H N N 224 LEU HG H N N 225 LEU HD11 H N N 226 LEU HD12 H N N 227 LEU HD13 H N N 228 LEU HD21 H N N 229 LEU HD22 H N N 230 LEU HD23 H N N 231 LEU HXT H N N 232 LYS N N N N 233 LYS CA C N S 234 LYS C C N N 235 LYS O O N N 236 LYS CB C N N 237 LYS CG C N N 238 LYS CD C N N 239 LYS CE C N N 240 LYS NZ N N N 241 LYS OXT O N N 242 LYS H H N N 243 LYS H2 H N N 244 LYS HA H N N 245 LYS HB2 H N N 246 LYS HB3 H N N 247 LYS HG2 H N N 248 LYS HG3 H N N 249 LYS HD2 H N N 250 LYS HD3 H N N 251 LYS HE2 H N N 252 LYS HE3 H N N 253 LYS HZ1 H N N 254 LYS HZ2 H N N 255 LYS HZ3 H N N 256 LYS HXT H N N 257 MET N N N N 258 MET CA C N S 259 MET C C N N 260 MET O O N N 261 MET CB C N N 262 MET CG C N N 263 MET SD S N N 264 MET CE C N N 265 MET OXT O N N 266 MET H H N N 267 MET H2 H N N 268 MET HA H N N 269 MET HB2 H N N 270 MET HB3 H N N 271 MET HG2 H N N 272 MET HG3 H N N 273 MET HE1 H N N 274 MET HE2 H N N 275 MET HE3 H N N 276 MET HXT H N N 277 PHE N N N N 278 PHE CA C N S 279 PHE C C N N 280 PHE O O N N 281 PHE CB C N N 282 PHE CG C Y N 283 PHE CD1 C Y N 284 PHE CD2 C Y N 285 PHE CE1 C Y N 286 PHE CE2 C Y N 287 PHE CZ C Y N 288 PHE OXT O N N 289 PHE H H N N 290 PHE H2 H N N 291 PHE HA H N N 292 PHE HB2 H N N 293 PHE HB3 H N N 294 PHE HD1 H N N 295 PHE HD2 H N N 296 PHE HE1 H N N 297 PHE HE2 H N N 298 PHE HZ H N N 299 PHE HXT H N N 300 PO4 P P N N 301 PO4 O1 O N N 302 PO4 O2 O N N 303 PO4 O3 O N N 304 PO4 O4 O N N 305 PRO N N N N 306 PRO CA C N S 307 PRO C C N N 308 PRO O O N N 309 PRO CB C N N 310 PRO CG C N N 311 PRO CD C N N 312 PRO OXT O N N 313 PRO H H N N 314 PRO HA H N N 315 PRO HB2 H N N 316 PRO HB3 H N N 317 PRO HG2 H N N 318 PRO HG3 H N N 319 PRO HD2 H N N 320 PRO HD3 H N N 321 PRO HXT H N N 322 SER N N N N 323 SER CA C N S 324 SER C C N N 325 SER O O N N 326 SER CB C N N 327 SER OG O N N 328 SER OXT O N N 329 SER H H N N 330 SER H2 H N N 331 SER HA H N N 332 SER HB2 H N N 333 SER HB3 H N N 334 SER HG H N N 335 SER HXT H N N 336 THR N N N N 337 THR CA C N S 338 THR C C N N 339 THR O O N N 340 THR CB C N R 341 THR OG1 O N N 342 THR CG2 C N N 343 THR OXT O N N 344 THR H H N N 345 THR H2 H N N 346 THR HA H N N 347 THR HB H N N 348 THR HG1 H N N 349 THR HG21 H N N 350 THR HG22 H N N 351 THR HG23 H N N 352 THR HXT H N N 353 TRP N N N N 354 TRP CA C N S 355 TRP C C N N 356 TRP O O N N 357 TRP CB C N N 358 TRP CG C Y N 359 TRP CD1 C Y N 360 TRP CD2 C Y N 361 TRP NE1 N Y N 362 TRP CE2 C Y N 363 TRP CE3 C Y N 364 TRP CZ2 C Y N 365 TRP CZ3 C Y N 366 TRP CH2 C Y N 367 TRP OXT O N N 368 TRP H H N N 369 TRP H2 H N N 370 TRP HA H N N 371 TRP HB2 H N N 372 TRP HB3 H N N 373 TRP HD1 H N N 374 TRP HE1 H N N 375 TRP HE3 H N N 376 TRP HZ2 H N N 377 TRP HZ3 H N N 378 TRP HH2 H N N 379 TRP HXT H N N 380 TYR N N N N 381 TYR CA C N S 382 TYR C C N N 383 TYR O O N N 384 TYR CB C N N 385 TYR CG C Y N 386 TYR CD1 C Y N 387 TYR CD2 C Y N 388 TYR CE1 C Y N 389 TYR CE2 C Y N 390 TYR CZ C Y N 391 TYR OH O N N 392 TYR OXT O N N 393 TYR H H N N 394 TYR H2 H N N 395 TYR HA H N N 396 TYR HB2 H N N 397 TYR HB3 H N N 398 TYR HD1 H N N 399 TYR HD2 H N N 400 TYR HE1 H N N 401 TYR HE2 H N N 402 TYR HH H N N 403 TYR HXT H N N 404 VAL N N N N 405 VAL CA C N S 406 VAL C C N N 407 VAL O O N N 408 VAL CB C N N 409 VAL CG1 C N N 410 VAL CG2 C N N 411 VAL OXT O N N 412 VAL H H N N 413 VAL H2 H N N 414 VAL HA H N N 415 VAL HB H N N 416 VAL HG11 H N N 417 VAL HG12 H N N 418 VAL HG13 H N N 419 VAL HG21 H N N 420 VAL HG22 H N N 421 VAL HG23 H N N 422 VAL HXT H N N 423 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 9R1 O C doub N N 1 9R1 C CA sing N N 2 9R1 N CA sing N N 3 9R1 CA CB sing N N 4 9R1 CB CG sing N N 5 9R1 CG CD sing N N 6 9R1 CD CE sing N N 7 9R1 CE CZ sing N N 8 9R1 ON1 CN doub N N 9 9R1 CZ CN sing N N 10 9R1 CN ON2 sing N N 11 9R1 C OXT sing N N 12 9R1 N H sing N N 13 9R1 N H2 sing N N 14 9R1 CA HA sing N N 15 9R1 CB H5 sing N N 16 9R1 CB H6 sing N N 17 9R1 CG H7 sing N N 18 9R1 CG H8 sing N N 19 9R1 CD H9 sing N N 20 9R1 CD H10 sing N N 21 9R1 CE H11 sing N N 22 9R1 CE H12 sing N N 23 9R1 CZ H13 sing N N 24 9R1 CZ H14 sing N N 25 9R1 ON2 H15 sing N N 26 9R1 OXT HXT sing N N 27 ALA N CA sing N N 28 ALA N H sing N N 29 ALA N H2 sing N N 30 ALA CA C sing N N 31 ALA CA CB sing N N 32 ALA CA HA sing N N 33 ALA C O doub N N 34 ALA C OXT sing N N 35 ALA CB HB1 sing N N 36 ALA CB HB2 sing N N 37 ALA CB HB3 sing N N 38 ALA OXT HXT sing N N 39 ARG N CA sing N N 40 ARG N H sing N N 41 ARG N H2 sing N N 42 ARG CA C sing N N 43 ARG CA CB sing N N 44 ARG CA HA sing N N 45 ARG C O doub N N 46 ARG C OXT sing N N 47 ARG CB CG sing N N 48 ARG CB HB2 sing N N 49 ARG CB HB3 sing N N 50 ARG CG CD sing N N 51 ARG CG HG2 sing N N 52 ARG CG HG3 sing N N 53 ARG CD NE sing N N 54 ARG CD HD2 sing N N 55 ARG CD HD3 sing N N 56 ARG NE CZ sing N N 57 ARG NE HE sing N N 58 ARG CZ NH1 sing N N 59 ARG CZ NH2 doub N N 60 ARG NH1 HH11 sing N N 61 ARG NH1 HH12 sing N N 62 ARG NH2 HH21 sing N N 63 ARG NH2 HH22 sing N N 64 ARG OXT HXT sing N N 65 ASN N CA sing N N 66 ASN N H sing N N 67 ASN N H2 sing N N 68 ASN CA C sing N N 69 ASN CA CB sing N N 70 ASN CA HA sing N N 71 ASN C O doub N N 72 ASN C OXT sing N N 73 ASN CB CG sing N N 74 ASN CB HB2 sing N N 75 ASN CB HB3 sing N N 76 ASN CG OD1 doub N N 77 ASN CG ND2 sing N N 78 ASN ND2 HD21 sing N N 79 ASN ND2 HD22 sing N N 80 ASN OXT HXT sing N N 81 ASP N CA sing N N 82 ASP N H sing N N 83 ASP N H2 sing N N 84 ASP CA C sing N N 85 ASP CA CB sing N N 86 ASP CA HA sing N N 87 ASP C O doub N N 88 ASP C OXT sing N N 89 ASP CB CG sing N N 90 ASP CB HB2 sing N N 91 ASP CB HB3 sing N N 92 ASP CG OD1 doub N N 93 ASP CG OD2 sing N N 94 ASP OD2 HD2 sing N N 95 ASP OXT HXT sing N N 96 CYS N CA sing N N 97 CYS N H sing N N 98 CYS N H2 sing N N 99 CYS CA C sing N N 100 CYS CA CB sing N N 101 CYS CA HA sing N N 102 CYS C O doub N N 103 CYS C OXT sing N N 104 CYS CB SG sing N N 105 CYS CB HB2 sing N N 106 CYS CB HB3 sing N N 107 CYS SG HG sing N N 108 CYS OXT HXT sing N N 109 GLN N CA sing N N 110 GLN N H sing N N 111 GLN N H2 sing N N 112 GLN CA C sing N N 113 GLN CA CB sing N N 114 GLN CA HA sing N N 115 GLN C O doub N N 116 GLN C OXT sing N N 117 GLN CB CG sing N N 118 GLN CB HB2 sing N N 119 GLN CB HB3 sing N N 120 GLN CG CD sing N N 121 GLN CG HG2 sing N N 122 GLN CG HG3 sing N N 123 GLN CD OE1 doub N N 124 GLN CD NE2 sing N N 125 GLN NE2 HE21 sing N N 126 GLN NE2 HE22 sing N N 127 GLN OXT HXT sing N N 128 GLU N CA sing N N 129 GLU N H sing N N 130 GLU N H2 sing N N 131 GLU CA C sing N N 132 GLU CA CB sing N N 133 GLU CA HA sing N N 134 GLU C O doub N N 135 GLU C OXT sing N N 136 GLU CB CG sing N N 137 GLU CB HB2 sing N N 138 GLU CB HB3 sing N N 139 GLU CG CD sing N N 140 GLU CG HG2 sing N N 141 GLU CG HG3 sing N N 142 GLU CD OE1 doub N N 143 GLU CD OE2 sing N N 144 GLU OE2 HE2 sing N N 145 GLU OXT HXT sing N N 146 GLY N CA sing N N 147 GLY N H sing N N 148 GLY N H2 sing N N 149 GLY CA C sing N N 150 GLY CA HA2 sing N N 151 GLY CA HA3 sing N N 152 GLY C O doub N N 153 GLY C OXT sing N N 154 GLY OXT HXT sing N N 155 HIS N CA sing N N 156 HIS N H sing N N 157 HIS N H2 sing N N 158 HIS CA C sing N N 159 HIS CA CB sing N N 160 HIS CA HA sing N N 161 HIS C O doub N N 162 HIS C OXT sing N N 163 HIS CB CG sing N N 164 HIS CB HB2 sing N N 165 HIS CB HB3 sing N N 166 HIS CG ND1 sing Y N 167 HIS CG CD2 doub Y N 168 HIS ND1 CE1 doub Y N 169 HIS ND1 HD1 sing N N 170 HIS CD2 NE2 sing Y N 171 HIS CD2 HD2 sing N N 172 HIS CE1 NE2 sing Y N 173 HIS CE1 HE1 sing N N 174 HIS NE2 HE2 sing N N 175 HIS OXT HXT sing N N 176 HOH O H1 sing N N 177 HOH O H2 sing N N 178 ILE N CA sing N N 179 ILE N H sing N N 180 ILE N H2 sing N N 181 ILE CA C sing N N 182 ILE CA CB sing N N 183 ILE CA HA sing N N 184 ILE C O doub N N 185 ILE C OXT sing N N 186 ILE CB CG1 sing N N 187 ILE CB CG2 sing N N 188 ILE CB HB sing N N 189 ILE CG1 CD1 sing N N 190 ILE CG1 HG12 sing N N 191 ILE CG1 HG13 sing N N 192 ILE CG2 HG21 sing N N 193 ILE CG2 HG22 sing N N 194 ILE CG2 HG23 sing N N 195 ILE CD1 HD11 sing N N 196 ILE CD1 HD12 sing N N 197 ILE CD1 HD13 sing N N 198 ILE OXT HXT sing N N 199 LEU N CA sing N N 200 LEU N H sing N N 201 LEU N H2 sing N N 202 LEU CA C sing N N 203 LEU CA CB sing N N 204 LEU CA HA sing N N 205 LEU C O doub N N 206 LEU C OXT sing N N 207 LEU CB CG sing N N 208 LEU CB HB2 sing N N 209 LEU CB HB3 sing N N 210 LEU CG CD1 sing N N 211 LEU CG CD2 sing N N 212 LEU CG HG sing N N 213 LEU CD1 HD11 sing N N 214 LEU CD1 HD12 sing N N 215 LEU CD1 HD13 sing N N 216 LEU CD2 HD21 sing N N 217 LEU CD2 HD22 sing N N 218 LEU CD2 HD23 sing N N 219 LEU OXT HXT sing N N 220 LYS N CA sing N N 221 LYS N H sing N N 222 LYS N H2 sing N N 223 LYS CA C sing N N 224 LYS CA CB sing N N 225 LYS CA HA sing N N 226 LYS C O doub N N 227 LYS C OXT sing N N 228 LYS CB CG sing N N 229 LYS CB HB2 sing N N 230 LYS CB HB3 sing N N 231 LYS CG CD sing N N 232 LYS CG HG2 sing N N 233 LYS CG HG3 sing N N 234 LYS CD CE sing N N 235 LYS CD HD2 sing N N 236 LYS CD HD3 sing N N 237 LYS CE NZ sing N N 238 LYS CE HE2 sing N N 239 LYS CE HE3 sing N N 240 LYS NZ HZ1 sing N N 241 LYS NZ HZ2 sing N N 242 LYS NZ HZ3 sing N N 243 LYS OXT HXT sing N N 244 MET N CA sing N N 245 MET N H sing N N 246 MET N H2 sing N N 247 MET CA C sing N N 248 MET CA CB sing N N 249 MET CA HA sing N N 250 MET C O doub N N 251 MET C OXT sing N N 252 MET CB CG sing N N 253 MET CB HB2 sing N N 254 MET CB HB3 sing N N 255 MET CG SD sing N N 256 MET CG HG2 sing N N 257 MET CG HG3 sing N N 258 MET SD CE sing N N 259 MET CE HE1 sing N N 260 MET CE HE2 sing N N 261 MET CE HE3 sing N N 262 MET OXT HXT sing N N 263 PHE N CA sing N N 264 PHE N H sing N N 265 PHE N H2 sing N N 266 PHE CA C sing N N 267 PHE CA CB sing N N 268 PHE CA HA sing N N 269 PHE C O doub N N 270 PHE C OXT sing N N 271 PHE CB CG sing N N 272 PHE CB HB2 sing N N 273 PHE CB HB3 sing N N 274 PHE CG CD1 doub Y N 275 PHE CG CD2 sing Y N 276 PHE CD1 CE1 sing Y N 277 PHE CD1 HD1 sing N N 278 PHE CD2 CE2 doub Y N 279 PHE CD2 HD2 sing N N 280 PHE CE1 CZ doub Y N 281 PHE CE1 HE1 sing N N 282 PHE CE2 CZ sing Y N 283 PHE CE2 HE2 sing N N 284 PHE CZ HZ sing N N 285 PHE OXT HXT sing N N 286 PO4 P O1 doub N N 287 PO4 P O2 sing N N 288 PO4 P O3 sing N N 289 PO4 P O4 sing N N 290 PRO N CA sing N N 291 PRO N CD sing N N 292 PRO N H sing N N 293 PRO CA C sing N N 294 PRO CA CB sing N N 295 PRO CA HA sing N N 296 PRO C O doub N N 297 PRO C OXT sing N N 298 PRO CB CG sing N N 299 PRO CB HB2 sing N N 300 PRO CB HB3 sing N N 301 PRO CG CD sing N N 302 PRO CG HG2 sing N N 303 PRO CG HG3 sing N N 304 PRO CD HD2 sing N N 305 PRO CD HD3 sing N N 306 PRO OXT HXT sing N N 307 SER N CA sing N N 308 SER N H sing N N 309 SER N H2 sing N N 310 SER CA C sing N N 311 SER CA CB sing N N 312 SER CA HA sing N N 313 SER C O doub N N 314 SER C OXT sing N N 315 SER CB OG sing N N 316 SER CB HB2 sing N N 317 SER CB HB3 sing N N 318 SER OG HG sing N N 319 SER OXT HXT sing N N 320 THR N CA sing N N 321 THR N H sing N N 322 THR N H2 sing N N 323 THR CA C sing N N 324 THR CA CB sing N N 325 THR CA HA sing N N 326 THR C O doub N N 327 THR C OXT sing N N 328 THR CB OG1 sing N N 329 THR CB CG2 sing N N 330 THR CB HB sing N N 331 THR OG1 HG1 sing N N 332 THR CG2 HG21 sing N N 333 THR CG2 HG22 sing N N 334 THR CG2 HG23 sing N N 335 THR OXT HXT sing N N 336 TRP N CA sing N N 337 TRP N H sing N N 338 TRP N H2 sing N N 339 TRP CA C sing N N 340 TRP CA CB sing N N 341 TRP CA HA sing N N 342 TRP C O doub N N 343 TRP C OXT sing N N 344 TRP CB CG sing N N 345 TRP CB HB2 sing N N 346 TRP CB HB3 sing N N 347 TRP CG CD1 doub Y N 348 TRP CG CD2 sing Y N 349 TRP CD1 NE1 sing Y N 350 TRP CD1 HD1 sing N N 351 TRP CD2 CE2 doub Y N 352 TRP CD2 CE3 sing Y N 353 TRP NE1 CE2 sing Y N 354 TRP NE1 HE1 sing N N 355 TRP CE2 CZ2 sing Y N 356 TRP CE3 CZ3 doub Y N 357 TRP CE3 HE3 sing N N 358 TRP CZ2 CH2 doub Y N 359 TRP CZ2 HZ2 sing N N 360 TRP CZ3 CH2 sing Y N 361 TRP CZ3 HZ3 sing N N 362 TRP CH2 HH2 sing N N 363 TRP OXT HXT sing N N 364 TYR N CA sing N N 365 TYR N H sing N N 366 TYR N H2 sing N N 367 TYR CA C sing N N 368 TYR CA CB sing N N 369 TYR CA HA sing N N 370 TYR C O doub N N 371 TYR C OXT sing N N 372 TYR CB CG sing N N 373 TYR CB HB2 sing N N 374 TYR CB HB3 sing N N 375 TYR CG CD1 doub Y N 376 TYR CG CD2 sing Y N 377 TYR CD1 CE1 sing Y N 378 TYR CD1 HD1 sing N N 379 TYR CD2 CE2 doub Y N 380 TYR CD2 HD2 sing N N 381 TYR CE1 CZ doub Y N 382 TYR CE1 HE1 sing N N 383 TYR CE2 CZ sing Y N 384 TYR CE2 HE2 sing N N 385 TYR CZ OH sing N N 386 TYR OH HH sing N N 387 TYR OXT HXT sing N N 388 VAL N CA sing N N 389 VAL N H sing N N 390 VAL N H2 sing N N 391 VAL CA C sing N N 392 VAL CA CB sing N N 393 VAL CA HA sing N N 394 VAL C O doub N N 395 VAL C OXT sing N N 396 VAL CB CG1 sing N N 397 VAL CB CG2 sing N N 398 VAL CB HB sing N N 399 VAL CG1 HG11 sing N N 400 VAL CG1 HG12 sing N N 401 VAL CG1 HG13 sing N N 402 VAL CG2 HG21 sing N N 403 VAL CG2 HG22 sing N N 404 VAL CG2 HG23 sing N N 405 VAL OXT HXT sing N N 406 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Health and Medical Research Council (NHMRC, Australia)' Australia 1079706 1 'National Health and Medical Research Council (NHMRC, Australia)' Australia 1058331 2 'National Health and Medical Research Council (NHMRC, Australia)' Australia 1113133 3 # _atom_sites.entry_id 5VWY _atom_sites.fract_transf_matrix[1][1] 0.015177 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.004890 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.026638 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015104 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S # loop_