data_5W44 # _entry.id 5W44 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5W44 pdb_00005w44 10.2210/pdb5w44/pdb WWPDB D_1000228394 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.details . _pdbx_database_related.db_id 5W3I _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5W44 _pdbx_database_status.recvd_initial_deposition_date 2017-06-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kumar, G.' 1 ? 'White, S.W.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Rep' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2045-2322 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 7 _citation.language ? _citation.page_first 17139 _citation.page_last 17139 _citation.title 'Protein-Structure Assisted Optimization of 4,5-Dihydroxypyrimidine-6-Carboxamide Inhibitors of Influenza Virus Endonuclease.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41598-017-17419-6 _citation.pdbx_database_id_PubMed 29215062 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Beylkin, D.' 1 ? primary 'Kumar, G.' 2 ? primary 'Zhou, W.' 3 ? primary 'Park, J.' 4 ? primary 'Jeevan, T.' 5 ? primary 'Lagisetti, C.' 6 ? primary 'Harfoot, R.' 7 ? primary 'Webby, R.J.' 8 ? primary 'White, S.W.' 9 ? primary 'Webb, T.R.' 10 ? # _cell.length_a 74.111 _cell.length_b 74.111 _cell.length_c 127.845 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 120.000 _cell.entry_id 5W44 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.space_group_name_H-M 'P 64 2 2' _symmetry.entry_id 5W44 _symmetry.Int_Tables_number 181 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Polymerase acidic protein' 21048.053 1 3.1.-.- ? ? ? 2 non-polymer syn 'MANGANESE (II) ION' 54.938 1 ? ? ? ? 3 non-polymer syn '2-[(2S)-1-(2,6-dichlorobenzene-1-carbonyl)pyrrolidin-2-yl]-5-hydroxy-6-oxo-N-(2-phenylethyl)-1,6-dihydropyrimidine-4-carboxamide' 501.362 1 ? ? ? ? 4 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 5 non-polymer syn 'SODIUM ION' 22.990 1 ? ? ? ? 6 water nat water 18.015 58 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'RNA-directed RNA polymerase subunit P2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDGGSKHRFEIIEGRDRIMAWTVVNSICNTTG VEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIR QEMASRSLWDSFRQSERA ; _entity_poly.pdbx_seq_one_letter_code_can ;MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDGGSKHRFEIIEGRDRIMAWTVVNSICNTTG VEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIR QEMASRSLWDSFRQSERA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 ASP n 1 4 PHE n 1 5 VAL n 1 6 ARG n 1 7 GLN n 1 8 CYS n 1 9 PHE n 1 10 ASN n 1 11 PRO n 1 12 MET n 1 13 ILE n 1 14 VAL n 1 15 GLU n 1 16 LEU n 1 17 ALA n 1 18 GLU n 1 19 LYS n 1 20 ALA n 1 21 MET n 1 22 LYS n 1 23 GLU n 1 24 TYR n 1 25 GLY n 1 26 GLU n 1 27 ASP n 1 28 PRO n 1 29 LYS n 1 30 ILE n 1 31 GLU n 1 32 THR n 1 33 ASN n 1 34 LYS n 1 35 PHE n 1 36 ALA n 1 37 ALA n 1 38 ILE n 1 39 CYS n 1 40 THR n 1 41 HIS n 1 42 LEU n 1 43 GLU n 1 44 VAL n 1 45 CYS n 1 46 PHE n 1 47 MET n 1 48 TYR n 1 49 SER n 1 50 ASP n 1 51 GLY n 1 52 GLY n 1 53 SER n 1 54 LYS n 1 55 HIS n 1 56 ARG n 1 57 PHE n 1 58 GLU n 1 59 ILE n 1 60 ILE n 1 61 GLU n 1 62 GLY n 1 63 ARG n 1 64 ASP n 1 65 ARG n 1 66 ILE n 1 67 MET n 1 68 ALA n 1 69 TRP n 1 70 THR n 1 71 VAL n 1 72 VAL n 1 73 ASN n 1 74 SER n 1 75 ILE n 1 76 CYS n 1 77 ASN n 1 78 THR n 1 79 THR n 1 80 GLY n 1 81 VAL n 1 82 GLU n 1 83 LYS n 1 84 PRO n 1 85 LYS n 1 86 PHE n 1 87 LEU n 1 88 PRO n 1 89 ASP n 1 90 LEU n 1 91 TYR n 1 92 ASP n 1 93 TYR n 1 94 LYS n 1 95 GLU n 1 96 ASN n 1 97 ARG n 1 98 PHE n 1 99 ILE n 1 100 GLU n 1 101 ILE n 1 102 GLY n 1 103 VAL n 1 104 THR n 1 105 ARG n 1 106 ARG n 1 107 GLU n 1 108 VAL n 1 109 HIS n 1 110 ILE n 1 111 TYR n 1 112 TYR n 1 113 LEU n 1 114 GLU n 1 115 LYS n 1 116 ALA n 1 117 ASN n 1 118 LYS n 1 119 ILE n 1 120 LYS n 1 121 SER n 1 122 GLU n 1 123 LYS n 1 124 THR n 1 125 HIS n 1 126 ILE n 1 127 HIS n 1 128 ILE n 1 129 PHE n 1 130 SER n 1 131 PHE n 1 132 THR n 1 133 GLY n 1 134 GLU n 1 135 GLU n 1 136 MET n 1 137 ALA n 1 138 THR n 1 139 LYS n 1 140 ALA n 1 141 ASP n 1 142 TYR n 1 143 THR n 1 144 LEU n 1 145 ASP n 1 146 GLU n 1 147 GLU n 1 148 SER n 1 149 ARG n 1 150 ALA n 1 151 ARG n 1 152 ILE n 1 153 LYS n 1 154 THR n 1 155 ARG n 1 156 LEU n 1 157 PHE n 1 158 THR n 1 159 ILE n 1 160 ARG n 1 161 GLN n 1 162 GLU n 1 163 MET n 1 164 ALA n 1 165 SER n 1 166 ARG n 1 167 SER n 1 168 LEU n 1 169 TRP n 1 170 ASP n 1 171 SER n 1 172 PHE n 1 173 ARG n 1 174 GLN n 1 175 SER n 1 176 GLU n 1 177 ARG n 1 178 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 178 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PA _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'swl A/California/04/2009 H1N1' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Influenza A virus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 641501 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code C3W5S0_I09A0 _struct_ref.pdbx_db_accession C3W5S0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGESIIVESGDPNALLKHRFEIIE GRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKAD YTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERG ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5W44 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 178 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession C3W5S0 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 197 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 178 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5W44 ? A ? ? UNP C3W5S0 PHE 51 deletion ? 1 1 5W44 ? A ? ? UNP C3W5S0 HIS 52 deletion ? 2 1 5W44 ? A ? ? UNP C3W5S0 PHE 53 deletion ? 3 1 5W44 ? A ? ? UNP C3W5S0 ILE 54 deletion ? 4 1 5W44 ? A ? ? UNP C3W5S0 ASP 55 deletion ? 5 1 5W44 ? A ? ? UNP C3W5S0 GLU 56 deletion ? 6 1 5W44 ? A ? ? UNP C3W5S0 ARG 57 deletion ? 7 1 5W44 ? A ? ? UNP C3W5S0 GLY 58 deletion ? 8 1 5W44 ? A ? ? UNP C3W5S0 GLU 59 deletion ? 9 1 5W44 ? A ? ? UNP C3W5S0 SER 60 deletion ? 10 1 5W44 ? A ? ? UNP C3W5S0 ILE 61 deletion ? 11 1 5W44 ? A ? ? UNP C3W5S0 ILE 62 deletion ? 12 1 5W44 ? A ? ? UNP C3W5S0 VAL 63 deletion ? 13 1 5W44 ? A ? ? UNP C3W5S0 GLU 64 deletion ? 14 1 5W44 ? A ? ? UNP C3W5S0 SER 65 deletion ? 15 1 5W44 ? A ? ? UNP C3W5S0 GLY 66 deletion ? 16 1 5W44 ? A ? ? UNP C3W5S0 ASP 67 deletion ? 17 1 5W44 ? A ? ? UNP C3W5S0 PRO 68 deletion ? 18 1 5W44 ? A ? ? UNP C3W5S0 ASN 69 deletion ? 19 1 5W44 GLY A 51 ? UNP C3W5S0 ALA 70 linker 51 20 1 5W44 GLY A 52 ? UNP C3W5S0 LEU 71 linker 52 21 1 5W44 SER A 53 ? UNP C3W5S0 LEU 72 linker 53 22 1 5W44 ALA A 178 ? UNP C3W5S0 GLY 197 'expression tag' 178 23 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GY6 non-polymer . '2-[(2S)-1-(2,6-dichlorobenzene-1-carbonyl)pyrrolidin-2-yl]-5-hydroxy-6-oxo-N-(2-phenylethyl)-1,6-dihydropyrimidine-4-carboxamide' ? 'C24 H22 Cl2 N4 O4' 501.362 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 MN non-polymer . 'MANGANESE (II) ION' ? 'Mn 2' 54.938 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5W44 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.31 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 46.69 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M Tris pH 8.5, 30% PEG 4000, 0.2 M MgCl2, 2 mM MnCl2' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RAYONIX MX300-HS' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-07-16 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 22-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 22-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.entry_id 5W44 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50.000 _reflns.d_resolution_high 2.100 _reflns.number_obs 12718 _reflns.number_all ? _reflns.percent_possible_obs 99.700 _reflns.pdbx_Rmerge_I_obs 0.094 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 7.200 _reflns.B_iso_Wilson_estimate 36.870 _reflns.pdbx_redundancy 16.500 _reflns.pdbx_Rrim_I_all 0.097 _reflns.pdbx_Rpim_I_all 0.024 _reflns.pdbx_CC_half ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_number_measured_all 210115 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_chi_squared 1.018 _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.details ? # loop_ _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_ordinal _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.pdbx_rejects _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.meanI_over_sigI_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_CC_half 1 1 2.100 2.180 ? ? 1212 ? 0.624 ? ? 0.605 11.600 ? ? ? ? ? ? ? ? 97.600 0.650 0.178 0.927 1 2 2.180 2.260 ? ? 1210 ? 0.510 ? ? 0.643 14.900 ? ? ? ? ? ? ? ? 99.800 0.527 0.132 0.964 1 3 2.260 2.370 ? ? 1240 ? 0.405 ? ? 0.685 17.300 ? ? ? ? ? ? ? ? 99.800 0.417 0.099 0.982 1 4 2.370 2.490 ? ? 1246 ? 0.327 ? ? 0.732 17.800 ? ? ? ? ? ? ? ? 100.000 0.337 0.079 0.987 1 5 2.490 2.650 ? ? 1263 ? 0.235 ? ? 0.855 17.800 ? ? ? ? ? ? ? ? 100.000 0.242 0.057 0.993 1 6 2.650 2.850 ? ? 1260 ? 0.179 ? ? 1.004 17.800 ? ? ? ? ? ? ? ? 100.000 0.185 0.044 0.994 1 7 2.850 3.140 ? ? 1257 ? 0.128 ? ? 1.211 17.700 ? ? ? ? ? ? ? ? 100.000 0.132 0.031 0.996 1 8 3.140 3.590 ? ? 1283 ? 0.096 ? ? 1.404 17.500 ? ? ? ? ? ? ? ? 100.000 0.098 0.023 0.997 1 9 3.590 4.520 ? ? 1309 ? 0.077 ? ? 1.488 17.200 ? ? ? ? ? ? ? ? 99.900 0.080 0.019 0.999 1 10 4.520 50.000 ? ? 1438 ? 0.050 ? ? 1.298 15.600 ? ? ? ? ? ? ? ? 99.900 0.052 0.013 0.999 # _refine.entry_id 5W44 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_d_res_high 2.1000 _refine.ls_d_res_low 35.5910 _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 99.3600 _refine.ls_number_reflns_obs 12679 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.ls_matrix_type ? _refine.pdbx_R_Free_selection_details ? _refine.details ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1947 _refine.ls_R_factor_R_work 0.1928 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.2238 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 5.9700 _refine.ls_number_reflns_R_free 757 _refine.ls_number_reflns_R_work 11922 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 51.6845 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.2400 _refine.overall_SU_B ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model 5DES _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set ? _refine.B_iso_max 112.760 _refine.B_iso_min 24.210 _refine.pdbx_overall_phase_error 23.3900 _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_R_factor_R_free_error_details ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.1000 _refine_hist.d_res_low 35.5910 _refine_hist.pdbx_number_atoms_ligand 59 _refine_hist.number_atoms_solvent 58 _refine_hist.number_atoms_total 1560 _refine_hist.pdbx_number_residues_total 178 _refine_hist.pdbx_B_iso_mean_ligand 57.68 _refine_hist.pdbx_B_iso_mean_solvent 49.73 _refine_hist.pdbx_number_atoms_protein 1443 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' f_bond_d 1510 0.005 ? ? ? 'X-RAY DIFFRACTION' f_angle_d 2037 0.625 ? ? ? 'X-RAY DIFFRACTION' f_chiral_restr 215 0.046 ? ? ? 'X-RAY DIFFRACTION' f_plane_restr 263 0.004 ? ? ? 'X-RAY DIFFRACTION' f_dihedral_angle_d 919 16.351 ? ? ? # loop_ _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.percent_reflns_obs _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_R_work _refine_ls_shell.R_factor_R_free _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.pdbx_refine_id 2.0997 2.2618 5 97.0000 2257 . 0.2035 0.2401 . 140 0.0000 2397 . 'X-RAY DIFFRACTION' 2.2618 2.4893 5 100.0000 2352 . 0.2074 0.2695 . 138 0.0000 2490 . 'X-RAY DIFFRACTION' 2.4893 2.8494 5 100.0000 2369 . 0.2000 0.2643 . 153 0.0000 2522 . 'X-RAY DIFFRACTION' 2.8494 3.5894 5 100.0000 2396 . 0.2012 0.2431 . 144 0.0000 2540 . 'X-RAY DIFFRACTION' 3.5894 35.5957 5 100.0000 2548 . 0.1827 0.2002 . 182 0.0000 2730 . 'X-RAY DIFFRACTION' # _struct.entry_id 5W44 _struct.title 'Crystal structure of the influenza virus PA endonuclease in complex with inhibitor 7a (SRI-29770)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5W44 _struct_keywords.text 'nuclease, transcription, cap-snatching, virus, HYDROLASE, hydrolase-hydrolase inhibitor complex' _struct_keywords.pdbx_keywords 'hydrolase/hydrolase inhibitor' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 6 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 MET A 1 ? PHE A 9 ? MET A 1 PHE A 9 1 ? 9 HELX_P HELX_P2 AA2 ASN A 10 ? GLU A 23 ? ASN A 10 GLU A 23 1 ? 14 HELX_P HELX_P3 AA3 GLU A 31 ? ASP A 50 ? GLU A 31 ASP A 50 1 ? 20 HELX_P HELX_P4 AA4 ASP A 64 ? GLY A 80 ? ASP A 64 GLY A 80 1 ? 17 HELX_P HELX_P5 AA5 GLU A 107 ? LYS A 120 ? GLU A 107 LYS A 120 1 ? 14 HELX_P HELX_P6 AA6 LYS A 139 ? ASP A 141 ? LYS A 139 ASP A 141 5 ? 3 HELX_P HELX_P7 AA7 ASP A 145 ? ARG A 166 ? ASP A 145 ARG A 166 1 ? 22 HELX_P HELX_P8 AA8 LEU A 168 ? GLN A 174 ? LEU A 168 GLN A 174 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 41 NE2 ? ? ? 1_555 B MN . MN ? ? A HIS 41 A MN 301 1_555 ? ? ? ? ? ? ? 2.220 ? ? metalc2 metalc ? ? A GLU 61 OE1 ? ? ? 1_555 D MG . MG ? ? A GLU 61 A MG 303 1_555 ? ? ? ? ? ? ? 2.075 ? ? metalc3 metalc ? ? A ASP 89 OD2 ? ? ? 1_555 B MN . MN ? ? A ASP 89 A MN 301 1_555 ? ? ? ? ? ? ? 2.158 ? ? metalc4 metalc ? ? A ASP 89 OD1 ? ? ? 1_555 D MG . MG ? ? A ASP 89 A MG 303 1_555 ? ? ? ? ? ? ? 1.993 ? ? metalc5 metalc ? ? A GLU 100 OE1 ? ? ? 1_555 B MN . MN ? ? A GLU 100 A MN 301 1_555 ? ? ? ? ? ? ? 2.248 ? ? metalc6 metalc ? ? A ILE 101 O ? ? ? 1_555 B MN . MN ? ? A ILE 101 A MN 301 1_555 ? ? ? ? ? ? ? 2.188 ? ? metalc7 metalc ? ? B MN . MN ? ? ? 1_555 C GY6 . O08 ? ? A MN 301 A GY6 302 1_555 ? ? ? ? ? ? ? 2.082 ? ? metalc8 metalc ? ? B MN . MN ? ? ? 1_555 C GY6 . O05 ? ? A MN 301 A GY6 302 1_555 ? ? ? ? ? ? ? 2.296 ? ? metalc9 metalc ? ? C GY6 . O05 ? ? ? 1_555 D MG . MG ? ? A GY6 302 A MG 303 1_555 ? ? ? ? ? ? ? 2.005 ? ? metalc10 metalc ? ? C GY6 . O12 ? ? ? 1_555 D MG . MG ? ? A GY6 302 A MG 303 1_555 ? ? ? ? ? ? ? 2.065 ? ? metalc11 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 303 A HOH 409 1_555 ? ? ? ? ? ? ? 2.121 ? ? metalc12 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 303 A HOH 423 1_555 ? ? ? ? ? ? ? 2.165 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 57 ? ILE A 59 ? PHE A 57 ILE A 59 AA1 2 LEU A 90 ? ASP A 92 ? LEU A 90 ASP A 92 AA1 3 ARG A 97 ? THR A 104 ? ARG A 97 THR A 104 AA1 4 HIS A 125 ? SER A 130 ? HIS A 125 SER A 130 AA1 5 GLU A 135 ? ALA A 137 ? GLU A 135 ALA A 137 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 58 ? N GLU A 58 O TYR A 91 ? O TYR A 91 AA1 2 3 N ASP A 92 ? N ASP A 92 O ARG A 97 ? O ARG A 97 AA1 3 4 N GLU A 100 ? N GLU A 100 O HIS A 125 ? O HIS A 125 AA1 4 5 N ILE A 128 ? N ILE A 128 O MET A 136 ? O MET A 136 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A MN 301 ? 6 'binding site for residue MN A 301' AC2 Software A GY6 302 ? 17 'binding site for residue GY6 A 302' AC3 Software A MG 303 ? 6 'binding site for residue MG A 303' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 HIS A 41 ? HIS A 41 . ? 1_555 ? 2 AC1 6 ASP A 89 ? ASP A 89 . ? 1_555 ? 3 AC1 6 GLU A 100 ? GLU A 100 . ? 1_555 ? 4 AC1 6 ILE A 101 ? ILE A 101 . ? 1_555 ? 5 AC1 6 GY6 C . ? GY6 A 302 . ? 1_555 ? 6 AC1 6 MG D . ? MG A 303 . ? 1_555 ? 7 AC2 17 ALA A 20 ? ALA A 20 . ? 1_555 ? 8 AC2 17 TYR A 24 ? TYR A 24 . ? 1_555 ? 9 AC2 17 GLU A 26 ? GLU A 26 . ? 1_555 ? 10 AC2 17 LYS A 34 ? LYS A 34 . ? 1_555 ? 11 AC2 17 ILE A 38 ? ILE A 38 . ? 1_555 ? 12 AC2 17 HIS A 41 ? HIS A 41 . ? 1_555 ? 13 AC2 17 GLU A 61 ? GLU A 61 . ? 1_555 ? 14 AC2 17 ASP A 89 ? ASP A 89 . ? 1_555 ? 15 AC2 17 GLU A 100 ? GLU A 100 . ? 1_555 ? 16 AC2 17 ILE A 101 ? ILE A 101 . ? 1_555 ? 17 AC2 17 LYS A 115 ? LYS A 115 . ? 1_555 ? 18 AC2 17 MN B . ? MN A 301 . ? 1_555 ? 19 AC2 17 MG D . ? MG A 303 . ? 1_555 ? 20 AC2 17 HOH F . ? HOH A 409 . ? 1_555 ? 21 AC2 17 HOH F . ? HOH A 418 . ? 1_555 ? 22 AC2 17 HOH F . ? HOH A 423 . ? 1_555 ? 23 AC2 17 HOH F . ? HOH A 427 . ? 1_555 ? 24 AC3 6 GLU A 61 ? GLU A 61 . ? 1_555 ? 25 AC3 6 ASP A 89 ? ASP A 89 . ? 1_555 ? 26 AC3 6 MN B . ? MN A 301 . ? 1_555 ? 27 AC3 6 GY6 C . ? GY6 A 302 . ? 1_555 ? 28 AC3 6 HOH F . ? HOH A 409 . ? 1_555 ? 29 AC3 6 HOH F . ? HOH A 423 . ? 1_555 ? # _atom_sites.entry_id 5W44 _atom_sites.fract_transf_matrix[1][1] 0.013493 _atom_sites.fract_transf_matrix[1][2] 0.007790 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015581 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007822 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CL H MG MN N NA O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 CYS 8 8 8 CYS CYS A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 MET 12 12 12 MET MET A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 MET 21 21 21 MET MET A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 HIS 41 41 41 HIS HIS A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 CYS 45 45 45 CYS CYS A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 MET 47 47 47 MET MET A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 HIS 55 55 55 HIS HIS A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 PHE 57 57 57 PHE PHE A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 MET 67 67 67 MET MET A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 TRP 69 69 69 TRP TRP A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 CYS 76 76 76 CYS CYS A . n A 1 77 ASN 77 77 77 ASN ASN A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 PRO 84 84 84 PRO PRO A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 PHE 86 86 86 PHE PHE A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 TYR 91 91 91 TYR TYR A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 TYR 93 93 93 TYR TYR A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 ASN 96 96 96 ASN ASN A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 PHE 98 98 98 PHE PHE A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 ILE 101 101 101 ILE ILE A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 THR 104 104 104 THR THR A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 ARG 106 106 106 ARG ARG A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 HIS 109 109 109 HIS HIS A . n A 1 110 ILE 110 110 110 ILE ILE A . n A 1 111 TYR 111 111 111 TYR TYR A . n A 1 112 TYR 112 112 112 TYR TYR A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 LYS 115 115 115 LYS LYS A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 ASN 117 117 117 ASN ASN A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 ILE 119 119 119 ILE ILE A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 SER 121 121 121 SER SER A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 THR 124 124 124 THR THR A . n A 1 125 HIS 125 125 125 HIS HIS A . n A 1 126 ILE 126 126 126 ILE ILE A . n A 1 127 HIS 127 127 127 HIS HIS A . n A 1 128 ILE 128 128 128 ILE ILE A . n A 1 129 PHE 129 129 129 PHE PHE A . n A 1 130 SER 130 130 130 SER SER A . n A 1 131 PHE 131 131 131 PHE PHE A . n A 1 132 THR 132 132 132 THR THR A . n A 1 133 GLY 133 133 133 GLY GLY A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 MET 136 136 136 MET MET A . n A 1 137 ALA 137 137 137 ALA ALA A . n A 1 138 THR 138 138 138 THR THR A . n A 1 139 LYS 139 139 139 LYS LYS A . n A 1 140 ALA 140 140 140 ALA ALA A . n A 1 141 ASP 141 141 141 ASP ASP A . n A 1 142 TYR 142 142 142 TYR TYR A . n A 1 143 THR 143 143 143 THR THR A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 GLU 146 146 146 GLU GLU A . n A 1 147 GLU 147 147 147 GLU GLU A . n A 1 148 SER 148 148 148 SER SER A . n A 1 149 ARG 149 149 149 ARG ARG A . n A 1 150 ALA 150 150 150 ALA ALA A . n A 1 151 ARG 151 151 151 ARG ARG A . n A 1 152 ILE 152 152 152 ILE ILE A . n A 1 153 LYS 153 153 153 LYS LYS A . n A 1 154 THR 154 154 154 THR THR A . n A 1 155 ARG 155 155 155 ARG ARG A . n A 1 156 LEU 156 156 156 LEU LEU A . n A 1 157 PHE 157 157 157 PHE PHE A . n A 1 158 THR 158 158 158 THR THR A . n A 1 159 ILE 159 159 159 ILE ILE A . n A 1 160 ARG 160 160 160 ARG ARG A . n A 1 161 GLN 161 161 161 GLN GLN A . n A 1 162 GLU 162 162 162 GLU GLU A . n A 1 163 MET 163 163 163 MET MET A . n A 1 164 ALA 164 164 164 ALA ALA A . n A 1 165 SER 165 165 165 SER SER A . n A 1 166 ARG 166 166 166 ARG ARG A . n A 1 167 SER 167 167 167 SER SER A . n A 1 168 LEU 168 168 168 LEU LEU A . n A 1 169 TRP 169 169 169 TRP TRP A . n A 1 170 ASP 170 170 170 ASP ASP A . n A 1 171 SER 171 171 171 SER SER A . n A 1 172 PHE 172 172 172 PHE PHE A . n A 1 173 ARG 173 173 173 ARG ARG A . n A 1 174 GLN 174 174 174 GLN GLN A . n A 1 175 SER 175 175 175 SER SER A . n A 1 176 GLU 176 176 176 GLU GLU A . n A 1 177 ARG 177 177 177 ARG ARG A . n A 1 178 ALA 178 178 178 ALA ALA A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MN 1 301 301 MN MN A . C 3 GY6 1 302 1 GY6 GY6 A . D 4 MG 1 303 1 MG MG A . E 5 NA 1 304 1 NA NA A . F 6 HOH 1 401 69 HOH HOH A . F 6 HOH 2 402 29 HOH HOH A . F 6 HOH 3 403 63 HOH HOH A . F 6 HOH 4 404 32 HOH HOH A . F 6 HOH 5 405 36 HOH HOH A . F 6 HOH 6 406 68 HOH HOH A . F 6 HOH 7 407 56 HOH HOH A . F 6 HOH 8 408 43 HOH HOH A . F 6 HOH 9 409 5 HOH HOH A . F 6 HOH 10 410 13 HOH HOH A . F 6 HOH 11 411 15 HOH HOH A . F 6 HOH 12 412 28 HOH HOH A . F 6 HOH 13 413 55 HOH HOH A . F 6 HOH 14 414 10 HOH HOH A . F 6 HOH 15 415 20 HOH HOH A . F 6 HOH 16 416 17 HOH HOH A . F 6 HOH 17 417 34 HOH HOH A . F 6 HOH 18 418 46 HOH HOH A . F 6 HOH 19 419 39 HOH HOH A . F 6 HOH 20 420 49 HOH HOH A . F 6 HOH 21 421 12 HOH HOH A . F 6 HOH 22 422 11 HOH HOH A . F 6 HOH 23 423 7 HOH HOH A . F 6 HOH 24 424 23 HOH HOH A . F 6 HOH 25 425 25 HOH HOH A . F 6 HOH 26 426 27 HOH HOH A . F 6 HOH 27 427 35 HOH HOH A . F 6 HOH 28 428 33 HOH HOH A . F 6 HOH 29 429 30 HOH HOH A . F 6 HOH 30 430 31 HOH HOH A . F 6 HOH 31 431 18 HOH HOH A . F 6 HOH 32 432 60 HOH HOH A . F 6 HOH 33 433 16 HOH HOH A . F 6 HOH 34 434 50 HOH HOH A . F 6 HOH 35 435 22 HOH HOH A . F 6 HOH 36 436 72 HOH HOH A . F 6 HOH 37 437 14 HOH HOH A . F 6 HOH 38 438 41 HOH HOH A . F 6 HOH 39 439 24 HOH HOH A . F 6 HOH 40 440 51 HOH HOH A . F 6 HOH 41 441 57 HOH HOH A . F 6 HOH 42 442 59 HOH HOH A . F 6 HOH 43 443 58 HOH HOH A . F 6 HOH 44 444 48 HOH HOH A . F 6 HOH 45 445 53 HOH HOH A . F 6 HOH 46 446 42 HOH HOH A . F 6 HOH 47 447 70 HOH HOH A . F 6 HOH 48 448 21 HOH HOH A . F 6 HOH 49 449 71 HOH HOH A . F 6 HOH 50 450 38 HOH HOH A . F 6 HOH 51 451 45 HOH HOH A . F 6 HOH 52 452 62 HOH HOH A . F 6 HOH 53 453 40 HOH HOH A . F 6 HOH 54 454 54 HOH HOH A . F 6 HOH 55 455 52 HOH HOH A . F 6 HOH 56 456 19 HOH HOH A . F 6 HOH 57 457 44 HOH HOH A . F 6 HOH 58 458 26 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 41 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 OD2 ? A ASP 89 ? A ASP 89 ? 1_555 98.3 ? 2 NE2 ? A HIS 41 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 OE1 ? A GLU 100 ? A GLU 100 ? 1_555 169.1 ? 3 OD2 ? A ASP 89 ? A ASP 89 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 OE1 ? A GLU 100 ? A GLU 100 ? 1_555 86.6 ? 4 NE2 ? A HIS 41 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O ? A ILE 101 ? A ILE 101 ? 1_555 89.8 ? 5 OD2 ? A ASP 89 ? A ASP 89 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O ? A ILE 101 ? A ILE 101 ? 1_555 88.5 ? 6 OE1 ? A GLU 100 ? A GLU 100 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O ? A ILE 101 ? A ILE 101 ? 1_555 80.6 ? 7 NE2 ? A HIS 41 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O08 ? C GY6 . ? A GY6 302 ? 1_555 83.5 ? 8 OD2 ? A ASP 89 ? A ASP 89 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O08 ? C GY6 . ? A GY6 302 ? 1_555 178.2 ? 9 OE1 ? A GLU 100 ? A GLU 100 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O08 ? C GY6 . ? A GY6 302 ? 1_555 91.7 ? 10 O ? A ILE 101 ? A ILE 101 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O08 ? C GY6 . ? A GY6 302 ? 1_555 92.0 ? 11 NE2 ? A HIS 41 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O05 ? C GY6 . ? A GY6 302 ? 1_555 95.1 ? 12 OD2 ? A ASP 89 ? A ASP 89 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O05 ? C GY6 . ? A GY6 302 ? 1_555 103.7 ? 13 OE1 ? A GLU 100 ? A GLU 100 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O05 ? C GY6 . ? A GY6 302 ? 1_555 93.1 ? 14 O ? A ILE 101 ? A ILE 101 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O05 ? C GY6 . ? A GY6 302 ? 1_555 166.0 ? 15 O08 ? C GY6 . ? A GY6 302 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O05 ? C GY6 . ? A GY6 302 ? 1_555 75.6 ? 16 OE1 ? A GLU 61 ? A GLU 61 ? 1_555 MG ? D MG . ? A MG 303 ? 1_555 OD1 ? A ASP 89 ? A ASP 89 ? 1_555 97.8 ? 17 OE1 ? A GLU 61 ? A GLU 61 ? 1_555 MG ? D MG . ? A MG 303 ? 1_555 O05 ? C GY6 . ? A GY6 302 ? 1_555 106.3 ? 18 OD1 ? A ASP 89 ? A ASP 89 ? 1_555 MG ? D MG . ? A MG 303 ? 1_555 O05 ? C GY6 . ? A GY6 302 ? 1_555 95.5 ? 19 OE1 ? A GLU 61 ? A GLU 61 ? 1_555 MG ? D MG . ? A MG 303 ? 1_555 O12 ? C GY6 . ? A GY6 302 ? 1_555 88.9 ? 20 OD1 ? A ASP 89 ? A ASP 89 ? 1_555 MG ? D MG . ? A MG 303 ? 1_555 O12 ? C GY6 . ? A GY6 302 ? 1_555 172.8 ? 21 O05 ? C GY6 . ? A GY6 302 ? 1_555 MG ? D MG . ? A MG 303 ? 1_555 O12 ? C GY6 . ? A GY6 302 ? 1_555 80.0 ? 22 OE1 ? A GLU 61 ? A GLU 61 ? 1_555 MG ? D MG . ? A MG 303 ? 1_555 O ? F HOH . ? A HOH 409 ? 1_555 170.9 ? 23 OD1 ? A ASP 89 ? A ASP 89 ? 1_555 MG ? D MG . ? A MG 303 ? 1_555 O ? F HOH . ? A HOH 409 ? 1_555 87.3 ? 24 O05 ? C GY6 . ? A GY6 302 ? 1_555 MG ? D MG . ? A MG 303 ? 1_555 O ? F HOH . ? A HOH 409 ? 1_555 80.6 ? 25 O12 ? C GY6 . ? A GY6 302 ? 1_555 MG ? D MG . ? A MG 303 ? 1_555 O ? F HOH . ? A HOH 409 ? 1_555 86.4 ? 26 OE1 ? A GLU 61 ? A GLU 61 ? 1_555 MG ? D MG . ? A MG 303 ? 1_555 O ? F HOH . ? A HOH 423 ? 1_555 91.5 ? 27 OD1 ? A ASP 89 ? A ASP 89 ? 1_555 MG ? D MG . ? A MG 303 ? 1_555 O ? F HOH . ? A HOH 423 ? 1_555 95.2 ? 28 O05 ? C GY6 . ? A GY6 302 ? 1_555 MG ? D MG . ? A MG 303 ? 1_555 O ? F HOH . ? A HOH 423 ? 1_555 157.8 ? 29 O12 ? C GY6 . ? A GY6 302 ? 1_555 MG ? D MG . ? A MG 303 ? 1_555 O ? F HOH . ? A HOH 423 ? 1_555 87.3 ? 30 O ? F HOH . ? A HOH 409 ? 1_555 MG ? D MG . ? A MG 303 ? 1_555 O ? F HOH . ? A HOH 423 ? 1_555 80.5 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-01-10 2 'Structure model' 1 1 2019-12-11 3 'Structure model' 1 2 2023-10-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_audit_support 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_initial_refinement_model 6 3 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_audit_support.funding_organization' 2 3 'Structure model' '_database_2.pdbx_DOI' 3 3 'Structure model' '_database_2.pdbx_database_accession' 4 3 'Structure model' '_struct_conn.pdbx_dist_value' 5 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 6 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 7 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 8 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 9 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 10 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -14.3610 _pdbx_refine_tls.origin_y 75.9972 _pdbx_refine_tls.origin_z 14.0938 _pdbx_refine_tls.T[1][1] 0.3656 _pdbx_refine_tls.T[2][2] 0.2204 _pdbx_refine_tls.T[3][3] 0.4094 _pdbx_refine_tls.T[1][2] 0.0166 _pdbx_refine_tls.T[1][3] 0.0876 _pdbx_refine_tls.T[2][3] -0.0373 _pdbx_refine_tls.L[1][1] 1.5974 _pdbx_refine_tls.L[2][2] 3.1580 _pdbx_refine_tls.L[3][3] 3.2950 _pdbx_refine_tls.L[1][2] -0.0914 _pdbx_refine_tls.L[1][3] -0.1739 _pdbx_refine_tls.L[2][3] 0.6996 _pdbx_refine_tls.S[1][1] -0.0939 _pdbx_refine_tls.S[2][2] -0.0840 _pdbx_refine_tls.S[3][3] 0.1333 _pdbx_refine_tls.S[1][2] 0.1018 _pdbx_refine_tls.S[1][3] -0.4228 _pdbx_refine_tls.S[2][3] -0.2374 _pdbx_refine_tls.S[2][1] -0.2025 _pdbx_refine_tls.S[3][1] 0.4884 _pdbx_refine_tls.S[3][2] 0.0776 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 1 A 178 all ? ? ? ? ? 'X-RAY DIFFRACTION' 2 1 B 301 B 301 all ? ? ? ? ? 'X-RAY DIFFRACTION' 3 1 S 5 S 72 all ? ? ? ? ? 'X-RAY DIFFRACTION' 4 1 C 1 C 1 all ? ? ? ? ? 'X-RAY DIFFRACTION' 5 1 D 1 D 1 all ? ? ? ? ? 'X-RAY DIFFRACTION' 6 1 E 1 E 1 all ? ? ? ? ? # _pdbx_phasing_MR.entry_id 5W44 _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details 'Phaser MODE: MR_AUTO' _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 5.220 _pdbx_phasing_MR.d_res_low_rotation 42.620 _pdbx_phasing_MR.d_res_high_translation 5.220 _pdbx_phasing_MR.d_res_low_translation 42.620 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.7.17 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 5 ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? SERGUI ? ? ? . 6 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE2 A GLU 107 ? ? ND1 A HIS 109 ? ? 2.16 2 1 O A HOH 450 ? ? O A HOH 451 ? ? 2.18 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 55 ? ? 82.59 5.90 2 1 ARG A 106 ? ? -98.62 -132.76 3 1 LYS A 120 ? ? 48.93 22.35 4 1 THR A 143 ? ? 70.59 -62.03 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 54 ? CG ? A LYS 54 CG 2 1 Y 1 A LYS 54 ? CD ? A LYS 54 CD 3 1 Y 1 A LYS 54 ? CE ? A LYS 54 CE 4 1 Y 1 A LYS 54 ? NZ ? A LYS 54 NZ 5 1 Y 1 A LYS 85 ? CG ? A LYS 85 CG 6 1 Y 1 A LYS 85 ? CD ? A LYS 85 CD 7 1 Y 1 A LYS 85 ? CE ? A LYS 85 CE 8 1 Y 1 A LYS 85 ? NZ ? A LYS 85 NZ 9 1 Y 1 A LYS 94 ? CG ? A LYS 94 CG 10 1 Y 1 A LYS 94 ? CD ? A LYS 94 CD 11 1 Y 1 A LYS 94 ? CE ? A LYS 94 CE 12 1 Y 1 A LYS 94 ? NZ ? A LYS 94 NZ 13 1 Y 1 A ASN 117 ? CG ? A ASN 117 CG 14 1 Y 1 A ASN 117 ? OD1 ? A ASN 117 OD1 15 1 Y 1 A ASN 117 ? ND2 ? A ASN 117 ND2 16 1 Y 1 A LYS 118 ? CG ? A LYS 118 CG 17 1 Y 1 A LYS 118 ? CD ? A LYS 118 CD 18 1 Y 1 A LYS 118 ? CE ? A LYS 118 CE 19 1 Y 1 A LYS 118 ? NZ ? A LYS 118 NZ 20 1 Y 1 A LYS 120 ? CG ? A LYS 120 CG 21 1 Y 1 A LYS 120 ? CD ? A LYS 120 CD 22 1 Y 1 A LYS 120 ? CE ? A LYS 120 CE 23 1 Y 1 A LYS 120 ? NZ ? A LYS 120 NZ 24 1 Y 1 A GLU 122 ? CG ? A GLU 122 CG 25 1 Y 1 A GLU 122 ? CD ? A GLU 122 CD 26 1 Y 1 A GLU 122 ? OE1 ? A GLU 122 OE1 27 1 Y 1 A GLU 122 ? OE2 ? A GLU 122 OE2 28 1 Y 1 A LYS 123 ? CG ? A LYS 123 CG 29 1 Y 1 A LYS 123 ? CD ? A LYS 123 CD 30 1 Y 1 A LYS 123 ? CE ? A LYS 123 CE 31 1 Y 1 A LYS 123 ? NZ ? A LYS 123 NZ # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 GY6 C01 C N N 137 GY6 C03 C N N 138 GY6 C04 C N N 139 GY6 C07 C N N 140 GY6 C11 C N N 141 GY6 C14 C N N 142 GY6 C17 C N N 143 GY6 C21 C N N 144 GY6 C24 C N N 145 GY6 C27 C N S 146 GY6 C30 C N N 147 GY6 C33 C N N 148 GY6 C35 C Y N 149 GY6 C37 C Y N 150 GY6 C39 C Y N 151 GY6 C41 C Y N 152 GY6 C42 C Y N 153 GY6 C44 C Y N 154 GY6 C46 C Y N 155 GY6 C48 C Y N 156 GY6 C50 C Y N 157 GY6 C52 C Y N 158 GY6 C53 C Y N 159 GY6 C55 C Y N 160 GY6 N02 N N N 161 GY6 N09 N N N 162 GY6 N13 N N N 163 GY6 N29 N N N 164 GY6 O05 O N N 165 GY6 O08 O N N 166 GY6 O12 O N N 167 GY6 O34 O N N 168 GY6 CL2 CL N N 169 GY6 CL CL N N 170 GY6 H15 H N N 171 GY6 H16 H N N 172 GY6 H18 H N N 173 GY6 H19 H N N 174 GY6 H23 H N N 175 GY6 H22 H N N 176 GY6 H26 H N N 177 GY6 H25 H N N 178 GY6 H28 H N N 179 GY6 H31 H N N 180 GY6 H32 H N N 181 GY6 H36 H N N 182 GY6 H38 H N N 183 GY6 H45 H N N 184 GY6 H47 H N N 185 GY6 H49 H N N 186 GY6 H51 H N N 187 GY6 H54 H N N 188 GY6 H56 H N N 189 GY6 H10 H N N 190 GY6 H20 H N N 191 GY6 H06 H N N 192 HIS N N N N 193 HIS CA C N S 194 HIS C C N N 195 HIS O O N N 196 HIS CB C N N 197 HIS CG C Y N 198 HIS ND1 N Y N 199 HIS CD2 C Y N 200 HIS CE1 C Y N 201 HIS NE2 N Y N 202 HIS OXT O N N 203 HIS H H N N 204 HIS H2 H N N 205 HIS HA H N N 206 HIS HB2 H N N 207 HIS HB3 H N N 208 HIS HD1 H N N 209 HIS HD2 H N N 210 HIS HE1 H N N 211 HIS HE2 H N N 212 HIS HXT H N N 213 HOH O O N N 214 HOH H1 H N N 215 HOH H2 H N N 216 ILE N N N N 217 ILE CA C N S 218 ILE C C N N 219 ILE O O N N 220 ILE CB C N S 221 ILE CG1 C N N 222 ILE CG2 C N N 223 ILE CD1 C N N 224 ILE OXT O N N 225 ILE H H N N 226 ILE H2 H N N 227 ILE HA H N N 228 ILE HB H N N 229 ILE HG12 H N N 230 ILE HG13 H N N 231 ILE HG21 H N N 232 ILE HG22 H N N 233 ILE HG23 H N N 234 ILE HD11 H N N 235 ILE HD12 H N N 236 ILE HD13 H N N 237 ILE HXT H N N 238 LEU N N N N 239 LEU CA C N S 240 LEU C C N N 241 LEU O O N N 242 LEU CB C N N 243 LEU CG C N N 244 LEU CD1 C N N 245 LEU CD2 C N N 246 LEU OXT O N N 247 LEU H H N N 248 LEU H2 H N N 249 LEU HA H N N 250 LEU HB2 H N N 251 LEU HB3 H N N 252 LEU HG H N N 253 LEU HD11 H N N 254 LEU HD12 H N N 255 LEU HD13 H N N 256 LEU HD21 H N N 257 LEU HD22 H N N 258 LEU HD23 H N N 259 LEU HXT H N N 260 LYS N N N N 261 LYS CA C N S 262 LYS C C N N 263 LYS O O N N 264 LYS CB C N N 265 LYS CG C N N 266 LYS CD C N N 267 LYS CE C N N 268 LYS NZ N N N 269 LYS OXT O N N 270 LYS H H N N 271 LYS H2 H N N 272 LYS HA H N N 273 LYS HB2 H N N 274 LYS HB3 H N N 275 LYS HG2 H N N 276 LYS HG3 H N N 277 LYS HD2 H N N 278 LYS HD3 H N N 279 LYS HE2 H N N 280 LYS HE3 H N N 281 LYS HZ1 H N N 282 LYS HZ2 H N N 283 LYS HZ3 H N N 284 LYS HXT H N N 285 MET N N N N 286 MET CA C N S 287 MET C C N N 288 MET O O N N 289 MET CB C N N 290 MET CG C N N 291 MET SD S N N 292 MET CE C N N 293 MET OXT O N N 294 MET H H N N 295 MET H2 H N N 296 MET HA H N N 297 MET HB2 H N N 298 MET HB3 H N N 299 MET HG2 H N N 300 MET HG3 H N N 301 MET HE1 H N N 302 MET HE2 H N N 303 MET HE3 H N N 304 MET HXT H N N 305 MG MG MG N N 306 MN MN MN N N 307 NA NA NA N N 308 PHE N N N N 309 PHE CA C N S 310 PHE C C N N 311 PHE O O N N 312 PHE CB C N N 313 PHE CG C Y N 314 PHE CD1 C Y N 315 PHE CD2 C Y N 316 PHE CE1 C Y N 317 PHE CE2 C Y N 318 PHE CZ C Y N 319 PHE OXT O N N 320 PHE H H N N 321 PHE H2 H N N 322 PHE HA H N N 323 PHE HB2 H N N 324 PHE HB3 H N N 325 PHE HD1 H N N 326 PHE HD2 H N N 327 PHE HE1 H N N 328 PHE HE2 H N N 329 PHE HZ H N N 330 PHE HXT H N N 331 PRO N N N N 332 PRO CA C N S 333 PRO C C N N 334 PRO O O N N 335 PRO CB C N N 336 PRO CG C N N 337 PRO CD C N N 338 PRO OXT O N N 339 PRO H H N N 340 PRO HA H N N 341 PRO HB2 H N N 342 PRO HB3 H N N 343 PRO HG2 H N N 344 PRO HG3 H N N 345 PRO HD2 H N N 346 PRO HD3 H N N 347 PRO HXT H N N 348 SER N N N N 349 SER CA C N S 350 SER C C N N 351 SER O O N N 352 SER CB C N N 353 SER OG O N N 354 SER OXT O N N 355 SER H H N N 356 SER H2 H N N 357 SER HA H N N 358 SER HB2 H N N 359 SER HB3 H N N 360 SER HG H N N 361 SER HXT H N N 362 THR N N N N 363 THR CA C N S 364 THR C C N N 365 THR O O N N 366 THR CB C N R 367 THR OG1 O N N 368 THR CG2 C N N 369 THR OXT O N N 370 THR H H N N 371 THR H2 H N N 372 THR HA H N N 373 THR HB H N N 374 THR HG1 H N N 375 THR HG21 H N N 376 THR HG22 H N N 377 THR HG23 H N N 378 THR HXT H N N 379 TRP N N N N 380 TRP CA C N S 381 TRP C C N N 382 TRP O O N N 383 TRP CB C N N 384 TRP CG C Y N 385 TRP CD1 C Y N 386 TRP CD2 C Y N 387 TRP NE1 N Y N 388 TRP CE2 C Y N 389 TRP CE3 C Y N 390 TRP CZ2 C Y N 391 TRP CZ3 C Y N 392 TRP CH2 C Y N 393 TRP OXT O N N 394 TRP H H N N 395 TRP H2 H N N 396 TRP HA H N N 397 TRP HB2 H N N 398 TRP HB3 H N N 399 TRP HD1 H N N 400 TRP HE1 H N N 401 TRP HE3 H N N 402 TRP HZ2 H N N 403 TRP HZ3 H N N 404 TRP HH2 H N N 405 TRP HXT H N N 406 TYR N N N N 407 TYR CA C N S 408 TYR C C N N 409 TYR O O N N 410 TYR CB C N N 411 TYR CG C Y N 412 TYR CD1 C Y N 413 TYR CD2 C Y N 414 TYR CE1 C Y N 415 TYR CE2 C Y N 416 TYR CZ C Y N 417 TYR OH O N N 418 TYR OXT O N N 419 TYR H H N N 420 TYR H2 H N N 421 TYR HA H N N 422 TYR HB2 H N N 423 TYR HB3 H N N 424 TYR HD1 H N N 425 TYR HD2 H N N 426 TYR HE1 H N N 427 TYR HE2 H N N 428 TYR HH H N N 429 TYR HXT H N N 430 VAL N N N N 431 VAL CA C N S 432 VAL C C N N 433 VAL O O N N 434 VAL CB C N N 435 VAL CG1 C N N 436 VAL CG2 C N N 437 VAL OXT O N N 438 VAL H H N N 439 VAL H2 H N N 440 VAL HA H N N 441 VAL HB H N N 442 VAL HG11 H N N 443 VAL HG12 H N N 444 VAL HG13 H N N 445 VAL HG21 H N N 446 VAL HG22 H N N 447 VAL HG23 H N N 448 VAL HXT H N N 449 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 GY6 CL C42 sing N N 129 GY6 C44 C42 doub Y N 130 GY6 C44 C35 sing Y N 131 GY6 C42 C41 sing Y N 132 GY6 O34 C33 doub N N 133 GY6 C35 C37 doub Y N 134 GY6 C41 C33 sing N N 135 GY6 C41 C39 doub Y N 136 GY6 C33 N29 sing N N 137 GY6 C37 C39 sing Y N 138 GY6 N29 C27 sing N N 139 GY6 N29 C30 sing N N 140 GY6 C39 CL2 sing N N 141 GY6 C27 C24 sing N N 142 GY6 C27 C01 sing N N 143 GY6 C24 C21 sing N N 144 GY6 C30 C21 sing N N 145 GY6 N09 C01 sing N N 146 GY6 N09 C07 sing N N 147 GY6 C01 N02 doub N N 148 GY6 O08 C07 doub N N 149 GY6 C07 C04 sing N N 150 GY6 N02 C03 sing N N 151 GY6 C04 C03 doub N N 152 GY6 C04 O05 sing N N 153 GY6 C03 C11 sing N N 154 GY6 C55 C46 doub Y N 155 GY6 C55 C53 sing Y N 156 GY6 C46 C48 sing Y N 157 GY6 C53 C52 doub Y N 158 GY6 N13 C11 sing N N 159 GY6 N13 C14 sing N N 160 GY6 C11 O12 doub N N 161 GY6 C48 C50 doub Y N 162 GY6 C52 C50 sing Y N 163 GY6 C52 C17 sing N N 164 GY6 C14 C17 sing N N 165 GY6 C14 H15 sing N N 166 GY6 C14 H16 sing N N 167 GY6 C17 H18 sing N N 168 GY6 C17 H19 sing N N 169 GY6 C21 H23 sing N N 170 GY6 C21 H22 sing N N 171 GY6 C24 H26 sing N N 172 GY6 C24 H25 sing N N 173 GY6 C27 H28 sing N N 174 GY6 C30 H31 sing N N 175 GY6 C30 H32 sing N N 176 GY6 C35 H36 sing N N 177 GY6 C37 H38 sing N N 178 GY6 C44 H45 sing N N 179 GY6 C46 H47 sing N N 180 GY6 C48 H49 sing N N 181 GY6 C50 H51 sing N N 182 GY6 C53 H54 sing N N 183 GY6 C55 H56 sing N N 184 GY6 N09 H10 sing N N 185 GY6 N13 H20 sing N N 186 GY6 O05 H06 sing N N 187 HIS N CA sing N N 188 HIS N H sing N N 189 HIS N H2 sing N N 190 HIS CA C sing N N 191 HIS CA CB sing N N 192 HIS CA HA sing N N 193 HIS C O doub N N 194 HIS C OXT sing N N 195 HIS CB CG sing N N 196 HIS CB HB2 sing N N 197 HIS CB HB3 sing N N 198 HIS CG ND1 sing Y N 199 HIS CG CD2 doub Y N 200 HIS ND1 CE1 doub Y N 201 HIS ND1 HD1 sing N N 202 HIS CD2 NE2 sing Y N 203 HIS CD2 HD2 sing N N 204 HIS CE1 NE2 sing Y N 205 HIS CE1 HE1 sing N N 206 HIS NE2 HE2 sing N N 207 HIS OXT HXT sing N N 208 HOH O H1 sing N N 209 HOH O H2 sing N N 210 ILE N CA sing N N 211 ILE N H sing N N 212 ILE N H2 sing N N 213 ILE CA C sing N N 214 ILE CA CB sing N N 215 ILE CA HA sing N N 216 ILE C O doub N N 217 ILE C OXT sing N N 218 ILE CB CG1 sing N N 219 ILE CB CG2 sing N N 220 ILE CB HB sing N N 221 ILE CG1 CD1 sing N N 222 ILE CG1 HG12 sing N N 223 ILE CG1 HG13 sing N N 224 ILE CG2 HG21 sing N N 225 ILE CG2 HG22 sing N N 226 ILE CG2 HG23 sing N N 227 ILE CD1 HD11 sing N N 228 ILE CD1 HD12 sing N N 229 ILE CD1 HD13 sing N N 230 ILE OXT HXT sing N N 231 LEU N CA sing N N 232 LEU N H sing N N 233 LEU N H2 sing N N 234 LEU CA C sing N N 235 LEU CA CB sing N N 236 LEU CA HA sing N N 237 LEU C O doub N N 238 LEU C OXT sing N N 239 LEU CB CG sing N N 240 LEU CB HB2 sing N N 241 LEU CB HB3 sing N N 242 LEU CG CD1 sing N N 243 LEU CG CD2 sing N N 244 LEU CG HG sing N N 245 LEU CD1 HD11 sing N N 246 LEU CD1 HD12 sing N N 247 LEU CD1 HD13 sing N N 248 LEU CD2 HD21 sing N N 249 LEU CD2 HD22 sing N N 250 LEU CD2 HD23 sing N N 251 LEU OXT HXT sing N N 252 LYS N CA sing N N 253 LYS N H sing N N 254 LYS N H2 sing N N 255 LYS CA C sing N N 256 LYS CA CB sing N N 257 LYS CA HA sing N N 258 LYS C O doub N N 259 LYS C OXT sing N N 260 LYS CB CG sing N N 261 LYS CB HB2 sing N N 262 LYS CB HB3 sing N N 263 LYS CG CD sing N N 264 LYS CG HG2 sing N N 265 LYS CG HG3 sing N N 266 LYS CD CE sing N N 267 LYS CD HD2 sing N N 268 LYS CD HD3 sing N N 269 LYS CE NZ sing N N 270 LYS CE HE2 sing N N 271 LYS CE HE3 sing N N 272 LYS NZ HZ1 sing N N 273 LYS NZ HZ2 sing N N 274 LYS NZ HZ3 sing N N 275 LYS OXT HXT sing N N 276 MET N CA sing N N 277 MET N H sing N N 278 MET N H2 sing N N 279 MET CA C sing N N 280 MET CA CB sing N N 281 MET CA HA sing N N 282 MET C O doub N N 283 MET C OXT sing N N 284 MET CB CG sing N N 285 MET CB HB2 sing N N 286 MET CB HB3 sing N N 287 MET CG SD sing N N 288 MET CG HG2 sing N N 289 MET CG HG3 sing N N 290 MET SD CE sing N N 291 MET CE HE1 sing N N 292 MET CE HE2 sing N N 293 MET CE HE3 sing N N 294 MET OXT HXT sing N N 295 PHE N CA sing N N 296 PHE N H sing N N 297 PHE N H2 sing N N 298 PHE CA C sing N N 299 PHE CA CB sing N N 300 PHE CA HA sing N N 301 PHE C O doub N N 302 PHE C OXT sing N N 303 PHE CB CG sing N N 304 PHE CB HB2 sing N N 305 PHE CB HB3 sing N N 306 PHE CG CD1 doub Y N 307 PHE CG CD2 sing Y N 308 PHE CD1 CE1 sing Y N 309 PHE CD1 HD1 sing N N 310 PHE CD2 CE2 doub Y N 311 PHE CD2 HD2 sing N N 312 PHE CE1 CZ doub Y N 313 PHE CE1 HE1 sing N N 314 PHE CE2 CZ sing Y N 315 PHE CE2 HE2 sing N N 316 PHE CZ HZ sing N N 317 PHE OXT HXT sing N N 318 PRO N CA sing N N 319 PRO N CD sing N N 320 PRO N H sing N N 321 PRO CA C sing N N 322 PRO CA CB sing N N 323 PRO CA HA sing N N 324 PRO C O doub N N 325 PRO C OXT sing N N 326 PRO CB CG sing N N 327 PRO CB HB2 sing N N 328 PRO CB HB3 sing N N 329 PRO CG CD sing N N 330 PRO CG HG2 sing N N 331 PRO CG HG3 sing N N 332 PRO CD HD2 sing N N 333 PRO CD HD3 sing N N 334 PRO OXT HXT sing N N 335 SER N CA sing N N 336 SER N H sing N N 337 SER N H2 sing N N 338 SER CA C sing N N 339 SER CA CB sing N N 340 SER CA HA sing N N 341 SER C O doub N N 342 SER C OXT sing N N 343 SER CB OG sing N N 344 SER CB HB2 sing N N 345 SER CB HB3 sing N N 346 SER OG HG sing N N 347 SER OXT HXT sing N N 348 THR N CA sing N N 349 THR N H sing N N 350 THR N H2 sing N N 351 THR CA C sing N N 352 THR CA CB sing N N 353 THR CA HA sing N N 354 THR C O doub N N 355 THR C OXT sing N N 356 THR CB OG1 sing N N 357 THR CB CG2 sing N N 358 THR CB HB sing N N 359 THR OG1 HG1 sing N N 360 THR CG2 HG21 sing N N 361 THR CG2 HG22 sing N N 362 THR CG2 HG23 sing N N 363 THR OXT HXT sing N N 364 TRP N CA sing N N 365 TRP N H sing N N 366 TRP N H2 sing N N 367 TRP CA C sing N N 368 TRP CA CB sing N N 369 TRP CA HA sing N N 370 TRP C O doub N N 371 TRP C OXT sing N N 372 TRP CB CG sing N N 373 TRP CB HB2 sing N N 374 TRP CB HB3 sing N N 375 TRP CG CD1 doub Y N 376 TRP CG CD2 sing Y N 377 TRP CD1 NE1 sing Y N 378 TRP CD1 HD1 sing N N 379 TRP CD2 CE2 doub Y N 380 TRP CD2 CE3 sing Y N 381 TRP NE1 CE2 sing Y N 382 TRP NE1 HE1 sing N N 383 TRP CE2 CZ2 sing Y N 384 TRP CE3 CZ3 doub Y N 385 TRP CE3 HE3 sing N N 386 TRP CZ2 CH2 doub Y N 387 TRP CZ2 HZ2 sing N N 388 TRP CZ3 CH2 sing Y N 389 TRP CZ3 HZ3 sing N N 390 TRP CH2 HH2 sing N N 391 TRP OXT HXT sing N N 392 TYR N CA sing N N 393 TYR N H sing N N 394 TYR N H2 sing N N 395 TYR CA C sing N N 396 TYR CA CB sing N N 397 TYR CA HA sing N N 398 TYR C O doub N N 399 TYR C OXT sing N N 400 TYR CB CG sing N N 401 TYR CB HB2 sing N N 402 TYR CB HB3 sing N N 403 TYR CG CD1 doub Y N 404 TYR CG CD2 sing Y N 405 TYR CD1 CE1 sing Y N 406 TYR CD1 HD1 sing N N 407 TYR CD2 CE2 doub Y N 408 TYR CD2 HD2 sing N N 409 TYR CE1 CZ doub Y N 410 TYR CE1 HE1 sing N N 411 TYR CE2 CZ sing Y N 412 TYR CE2 HE2 sing N N 413 TYR CZ OH sing N N 414 TYR OH HH sing N N 415 TYR OXT HXT sing N N 416 VAL N CA sing N N 417 VAL N H sing N N 418 VAL N H2 sing N N 419 VAL CA C sing N N 420 VAL CA CB sing N N 421 VAL CA HA sing N N 422 VAL C O doub N N 423 VAL C OXT sing N N 424 VAL CB CG1 sing N N 425 VAL CB CG2 sing N N 426 VAL CB HB sing N N 427 VAL CG1 HG11 sing N N 428 VAL CG1 HG12 sing N N 429 VAL CG1 HG13 sing N N 430 VAL CG2 HG21 sing N N 431 VAL CG2 HG22 sing N N 432 VAL CG2 HG23 sing N N 433 VAL OXT HXT sing N N 434 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' R01AI098757 1 ;St. Jude Children's Research Hospital (ALSAC) ; 'United States' ? 2 ;St. Jude Children's Research Hospital (ALSAC) ; 'United States' ? 3 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MANGANESE (II) ION' MN 3 '2-[(2S)-1-(2,6-dichlorobenzene-1-carbonyl)pyrrolidin-2-yl]-5-hydroxy-6-oxo-N-(2-phenylethyl)-1,6-dihydropyrimidine-4-carboxamide' GY6 4 'MAGNESIUM ION' MG 5 'SODIUM ION' NA 6 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5DES _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details 'Protein purifies as a monomer' #