data_5W8Z # _entry.id 5W8Z # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5W8Z pdb_00005w8z 10.2210/pdb5w8z/pdb WWPDB D_1000227233 ? ? BMRB 30310 ? 10.13018/BMR30310 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-07-11 2 'Structure model' 1 1 2018-08-08 3 'Structure model' 1 2 2018-11-07 4 'Structure model' 1 3 2020-01-01 5 'Structure model' 1 4 2023-06-14 6 'Structure model' 1 5 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 4 'Structure model' 'Author supporting evidence' 6 4 'Structure model' 'Data collection' 7 5 'Structure model' 'Database references' 8 5 'Structure model' Other 9 6 'Structure model' 'Data collection' 10 6 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' pdbx_audit_support 5 4 'Structure model' pdbx_nmr_software 6 5 'Structure model' database_2 7 5 'Structure model' pdbx_database_status 8 6 'Structure model' chem_comp_atom 9 6 'Structure model' chem_comp_bond 10 6 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 2 'Structure model' '_citation_author.name' 11 3 'Structure model' '_citation.journal_volume' 12 3 'Structure model' '_citation.page_first' 13 3 'Structure model' '_citation.page_last' 14 4 'Structure model' '_pdbx_audit_support.funding_organization' 15 4 'Structure model' '_pdbx_nmr_software.name' 16 5 'Structure model' '_database_2.pdbx_DOI' 17 5 'Structure model' '_database_2.pdbx_database_accession' 18 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' 19 6 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5W8Z _pdbx_database_status.recvd_initial_deposition_date 2017-06-22 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution Structure of XPH2, a Hybrid Sequence of Xfaso 1 and Pfl 6, Two Cro Proteins With Different Folds' _pdbx_database_related.db_id 30310 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kumirov, V.K.' 1 ? 'Dykstra, E.M.' 2 ? 'Cordes, M.H.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Protein Sci.' _citation.journal_id_ASTM PRCIEI _citation.journal_id_CSD 0795 _citation.journal_id_ISSN 1469-896X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 27 _citation.language ? _citation.page_first 1767 _citation.page_last 1779 _citation.title 'Multistep mutational transformation of a protein fold through structural intermediates.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/pro.3488 _citation.pdbx_database_id_PubMed 30051937 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kumirov, V.K.' 1 ? primary 'Dykstra, E.M.' 2 ? primary 'Hall, B.M.' 3 ? primary 'Anderson, W.J.' 4 ? primary 'Szyszka, T.N.' 5 ? primary 'Cordes, M.H.J.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description XPH2 _entity.formula_weight 7887.996 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MKKIPLSKYLEEHGTQSALAAALGVNQSAISQMVRAGRCIDIELYTDGRVECRELRPDVFGALEHHHHHH _entity_poly.pdbx_seq_one_letter_code_can MKKIPLSKYLEEHGTQSALAAALGVNQSAISQMVRAGRCIDIELYTDGRVECRELRPDVFGALEHHHHHH _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 LYS n 1 4 ILE n 1 5 PRO n 1 6 LEU n 1 7 SER n 1 8 LYS n 1 9 TYR n 1 10 LEU n 1 11 GLU n 1 12 GLU n 1 13 HIS n 1 14 GLY n 1 15 THR n 1 16 GLN n 1 17 SER n 1 18 ALA n 1 19 LEU n 1 20 ALA n 1 21 ALA n 1 22 ALA n 1 23 LEU n 1 24 GLY n 1 25 VAL n 1 26 ASN n 1 27 GLN n 1 28 SER n 1 29 ALA n 1 30 ILE n 1 31 SER n 1 32 GLN n 1 33 MET n 1 34 VAL n 1 35 ARG n 1 36 ALA n 1 37 GLY n 1 38 ARG n 1 39 CYS n 1 40 ILE n 1 41 ASP n 1 42 ILE n 1 43 GLU n 1 44 LEU n 1 45 TYR n 1 46 THR n 1 47 ASP n 1 48 GLY n 1 49 ARG n 1 50 VAL n 1 51 GLU n 1 52 CYS n 1 53 ARG n 1 54 GLU n 1 55 LEU n 1 56 ARG n 1 57 PRO n 1 58 ASP n 1 59 VAL n 1 60 PHE n 1 61 GLY n 1 62 ALA n 1 63 LEU n 1 64 GLU n 1 65 HIS n 1 66 HIS n 1 67 HIS n 1 68 HIS n 1 69 HIS n 1 70 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 70 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene CRO _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details 'Hybrid between two natural Cro sequences from prophages in Xylella fastidiosa and Pseudomonas fluorescens' _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas fluorescens PF5' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1218948 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET21b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 HIS 13 13 13 HIS HIS A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 MET 33 33 33 MET MET A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 CYS 52 52 52 CYS CYS A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 LEU 63 63 ? ? ? A . n A 1 64 GLU 64 64 ? ? ? A . n A 1 65 HIS 65 65 ? ? ? A . n A 1 66 HIS 66 66 ? ? ? A . n A 1 67 HIS 67 67 ? ? ? A . n A 1 68 HIS 68 68 ? ? ? A . n A 1 69 HIS 69 69 ? ? ? A . n A 1 70 HIS 70 70 ? ? ? A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5W8Z _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 5W8Z _struct.title 'Solution Structure of XPH2, a Hybrid Sequence of Xfaso 1 and Pfl 6, Two Cro Proteins With Different Folds' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5W8Z _struct_keywords.text ;helix-turn-helix, structural evolution, conformational switch, metamorphic protein, disulfide bond, transcription factor, TRANSCRIPTION ; _struct_keywords.pdbx_keywords TRANSCRIPTION # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 5W8Z _struct_ref.pdbx_db_accession 5W8Z _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5W8Z _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 70 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 5W8Z _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 70 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 70 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details 'Monomer confirmed by SEC (gel filtration)' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details 'Monomer confirmed by SEC (gel filtration)' # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LEU A 6 ? HIS A 13 ? LEU A 6 HIS A 13 1 ? 8 HELX_P HELX_P2 AA2 THR A 15 ? GLY A 24 ? THR A 15 GLY A 24 1 ? 10 HELX_P HELX_P3 AA3 ASN A 26 ? GLY A 37 ? ASN A 26 GLY A 37 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 2 ? PRO A 5 ? LYS A 2 PRO A 5 AA1 2 ASP A 41 ? LEU A 44 ? ASP A 41 LEU A 44 AA1 3 VAL A 50 ? GLU A 51 ? VAL A 50 GLU A 51 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 4 ? N ILE A 4 O ILE A 42 ? O ILE A 42 AA1 2 3 N GLU A 43 ? N GLU A 43 O GLU A 51 ? O GLU A 51 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 4 PHE A 60 ? ? -147.52 14.39 2 5 PHE A 60 ? ? -154.50 13.63 3 6 PRO A 57 ? ? -59.53 -6.72 4 7 PHE A 60 ? ? -57.00 106.59 5 10 HIS A 13 ? ? -136.92 -48.03 6 10 LEU A 55 ? ? -68.66 93.51 7 10 PHE A 60 ? ? -169.14 -158.84 8 12 PRO A 57 ? ? -54.92 -5.01 9 15 PHE A 60 ? ? -134.48 -66.22 10 17 PHE A 60 ? ? -163.33 17.47 11 18 LEU A 55 ? ? -66.76 99.48 # _pdbx_nmr_ensemble.entry_id 5W8Z _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 5W8Z _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 ;0.8 mM [U-13C; U-15N] XPH2, 50 mM NA- potassium phosphate, 150 mM NA- potassium chloride, 0.01 % NA- sodium azide, 0.1 mM NA- DSS, 1 M [U-2H] trimethylamine oxide, 90% H2O/10% D2O ; '90% H2O/10% D2O' 13C_15N_sample solution ? 4 ;1.6 mM [U-10% 13C] XPH2, 50 mM NA- potassium phosphate, 150 mM NA- potassium chloride, 0.01 % NA- sodium azide, 0.1 mM NA- DSS, 90% H2O/10% D2O ; '90% H2O/10% D2O' '10% 13C sample' solution ? 3 ;0.9 mM [U-15N] XPH2, 50 mM NA- potassium phosphate, 150 mM NA- potassium chloride, 0.01 % NA- sodium azide, 0.1 mM NA- DSS, 90% H2O/10% D2O ; '90% H2O/10% D2O' 15N_sample solution ? 2 ;0.6 mM [U-13C; U-15N] XPH2, 50 mM NA- potassium phosphate, 150 mM NA- potassium chloride, 0.01 % NA- sodium azide, 0.1 mM NA- DSS, 1 M [U-2H] trimethylamine oxide, 100% D2O ; '100% D2O' 13C_15N_sample_D20 solution ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 XPH2 0.8 ? mM '[U-13C; U-15N]' 1 'potassium phosphate' 50 ? mM NA- 1 'potassium chloride' 150 ? mM NA- 1 'sodium azide' 0.01 ? % NA- 1 DSS 0.1 ? mM NA- 1 'trimethylamine oxide' 1 ? M '[U-2H]' 4 XPH2 1.6 ? mM '[U-10% 13C]' 4 'potassium phosphate' 50 ? mM NA- 4 'potassium chloride' 150 ? mM NA- 4 'sodium azide' 0.01 ? % NA- 4 DSS 0.1 ? mM NA- 3 XPH2 0.9 ? mM '[U-15N]' 3 'potassium phosphate' 50 ? mM NA- 3 'potassium chloride' 150 ? mM NA- 3 'sodium azide' 0.01 ? % NA- 3 DSS 0.1 ? mM NA- 2 XPH2 0.6 ? mM '[U-13C; U-15N]' 2 'potassium phosphate' 50 ? mM NA- 2 'potassium chloride' 150 ? mM NA- 2 'sodium azide' 0.01 ? % NA- 2 DSS 0.1 ? mM NA- 2 'trimethylamine oxide' 1 ? M '[U-2H]' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 150 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH* _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 3 3D_15N-separated_NOESY 1 isotropic 2 1 2 3D_13C-separated_NOESY 1 isotropic 3 1 1 '3D HNCO' 1 isotropic 4 1 1 '3D HNCACB' 1 isotropic 5 1 1 '3D CBCA(CO)NH' 1 isotropic 6 1 1 '3D HCCH-TOCSY' 1 isotropic 7 1 4 '2D 1H-13C HSQC aliphatic' 1 isotropic 8 1 3 '2D 1H-15N HSQC' 1 isotropic # _pdbx_nmr_refine.entry_id 5W8Z _pdbx_nmr_refine.method CYANA _pdbx_nmr_refine.details 'Water refinement of the lowest energy 20 structures was performed using CNS' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CNS ? 'Brunger A. T. et.al.' 2 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 3 'chemical shift assignment' Sparky ? Goddard 4 'peak picking' Sparky ? Goddard 5 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LEU 63 ? A LEU 63 2 1 Y 1 A GLU 64 ? A GLU 64 3 1 Y 1 A HIS 65 ? A HIS 65 4 1 Y 1 A HIS 66 ? A HIS 66 5 1 Y 1 A HIS 67 ? A HIS 67 6 1 Y 1 A HIS 68 ? A HIS 68 7 1 Y 1 A HIS 69 ? A HIS 69 8 1 Y 1 A HIS 70 ? A HIS 70 9 2 Y 1 A LEU 63 ? A LEU 63 10 2 Y 1 A GLU 64 ? A GLU 64 11 2 Y 1 A HIS 65 ? A HIS 65 12 2 Y 1 A HIS 66 ? A HIS 66 13 2 Y 1 A HIS 67 ? A HIS 67 14 2 Y 1 A HIS 68 ? A HIS 68 15 2 Y 1 A HIS 69 ? A HIS 69 16 2 Y 1 A HIS 70 ? A HIS 70 17 3 Y 1 A LEU 63 ? A LEU 63 18 3 Y 1 A GLU 64 ? A GLU 64 19 3 Y 1 A HIS 65 ? A HIS 65 20 3 Y 1 A HIS 66 ? A HIS 66 21 3 Y 1 A HIS 67 ? A HIS 67 22 3 Y 1 A HIS 68 ? A HIS 68 23 3 Y 1 A HIS 69 ? A HIS 69 24 3 Y 1 A HIS 70 ? A HIS 70 25 4 Y 1 A LEU 63 ? A LEU 63 26 4 Y 1 A GLU 64 ? A GLU 64 27 4 Y 1 A HIS 65 ? A HIS 65 28 4 Y 1 A HIS 66 ? A HIS 66 29 4 Y 1 A HIS 67 ? A HIS 67 30 4 Y 1 A HIS 68 ? A HIS 68 31 4 Y 1 A HIS 69 ? A HIS 69 32 4 Y 1 A HIS 70 ? A HIS 70 33 5 Y 1 A LEU 63 ? A LEU 63 34 5 Y 1 A GLU 64 ? A GLU 64 35 5 Y 1 A HIS 65 ? A HIS 65 36 5 Y 1 A HIS 66 ? A HIS 66 37 5 Y 1 A HIS 67 ? A HIS 67 38 5 Y 1 A HIS 68 ? A HIS 68 39 5 Y 1 A HIS 69 ? A HIS 69 40 5 Y 1 A HIS 70 ? A HIS 70 41 6 Y 1 A LEU 63 ? A LEU 63 42 6 Y 1 A GLU 64 ? A GLU 64 43 6 Y 1 A HIS 65 ? A HIS 65 44 6 Y 1 A HIS 66 ? A HIS 66 45 6 Y 1 A HIS 67 ? A HIS 67 46 6 Y 1 A HIS 68 ? A HIS 68 47 6 Y 1 A HIS 69 ? A HIS 69 48 6 Y 1 A HIS 70 ? A HIS 70 49 7 Y 1 A LEU 63 ? A LEU 63 50 7 Y 1 A GLU 64 ? A GLU 64 51 7 Y 1 A HIS 65 ? A HIS 65 52 7 Y 1 A HIS 66 ? A HIS 66 53 7 Y 1 A HIS 67 ? A HIS 67 54 7 Y 1 A HIS 68 ? A HIS 68 55 7 Y 1 A HIS 69 ? A HIS 69 56 7 Y 1 A HIS 70 ? A HIS 70 57 8 Y 1 A LEU 63 ? A LEU 63 58 8 Y 1 A GLU 64 ? A GLU 64 59 8 Y 1 A HIS 65 ? A HIS 65 60 8 Y 1 A HIS 66 ? A HIS 66 61 8 Y 1 A HIS 67 ? A HIS 67 62 8 Y 1 A HIS 68 ? A HIS 68 63 8 Y 1 A HIS 69 ? A HIS 69 64 8 Y 1 A HIS 70 ? A HIS 70 65 9 Y 1 A LEU 63 ? A LEU 63 66 9 Y 1 A GLU 64 ? A GLU 64 67 9 Y 1 A HIS 65 ? A HIS 65 68 9 Y 1 A HIS 66 ? A HIS 66 69 9 Y 1 A HIS 67 ? A HIS 67 70 9 Y 1 A HIS 68 ? A HIS 68 71 9 Y 1 A HIS 69 ? A HIS 69 72 9 Y 1 A HIS 70 ? A HIS 70 73 10 Y 1 A LEU 63 ? A LEU 63 74 10 Y 1 A GLU 64 ? A GLU 64 75 10 Y 1 A HIS 65 ? A HIS 65 76 10 Y 1 A HIS 66 ? A HIS 66 77 10 Y 1 A HIS 67 ? A HIS 67 78 10 Y 1 A HIS 68 ? A HIS 68 79 10 Y 1 A HIS 69 ? A HIS 69 80 10 Y 1 A HIS 70 ? A HIS 70 81 11 Y 1 A LEU 63 ? A LEU 63 82 11 Y 1 A GLU 64 ? A GLU 64 83 11 Y 1 A HIS 65 ? A HIS 65 84 11 Y 1 A HIS 66 ? A HIS 66 85 11 Y 1 A HIS 67 ? A HIS 67 86 11 Y 1 A HIS 68 ? A HIS 68 87 11 Y 1 A HIS 69 ? A HIS 69 88 11 Y 1 A HIS 70 ? A HIS 70 89 12 Y 1 A LEU 63 ? A LEU 63 90 12 Y 1 A GLU 64 ? A GLU 64 91 12 Y 1 A HIS 65 ? A HIS 65 92 12 Y 1 A HIS 66 ? A HIS 66 93 12 Y 1 A HIS 67 ? A HIS 67 94 12 Y 1 A HIS 68 ? A HIS 68 95 12 Y 1 A HIS 69 ? A HIS 69 96 12 Y 1 A HIS 70 ? A HIS 70 97 13 Y 1 A LEU 63 ? A LEU 63 98 13 Y 1 A GLU 64 ? A GLU 64 99 13 Y 1 A HIS 65 ? A HIS 65 100 13 Y 1 A HIS 66 ? A HIS 66 101 13 Y 1 A HIS 67 ? A HIS 67 102 13 Y 1 A HIS 68 ? A HIS 68 103 13 Y 1 A HIS 69 ? A HIS 69 104 13 Y 1 A HIS 70 ? A HIS 70 105 14 Y 1 A LEU 63 ? A LEU 63 106 14 Y 1 A GLU 64 ? A GLU 64 107 14 Y 1 A HIS 65 ? A HIS 65 108 14 Y 1 A HIS 66 ? A HIS 66 109 14 Y 1 A HIS 67 ? A HIS 67 110 14 Y 1 A HIS 68 ? A HIS 68 111 14 Y 1 A HIS 69 ? A HIS 69 112 14 Y 1 A HIS 70 ? A HIS 70 113 15 Y 1 A LEU 63 ? A LEU 63 114 15 Y 1 A GLU 64 ? A GLU 64 115 15 Y 1 A HIS 65 ? A HIS 65 116 15 Y 1 A HIS 66 ? A HIS 66 117 15 Y 1 A HIS 67 ? A HIS 67 118 15 Y 1 A HIS 68 ? A HIS 68 119 15 Y 1 A HIS 69 ? A HIS 69 120 15 Y 1 A HIS 70 ? A HIS 70 121 16 Y 1 A LEU 63 ? A LEU 63 122 16 Y 1 A GLU 64 ? A GLU 64 123 16 Y 1 A HIS 65 ? A HIS 65 124 16 Y 1 A HIS 66 ? A HIS 66 125 16 Y 1 A HIS 67 ? A HIS 67 126 16 Y 1 A HIS 68 ? A HIS 68 127 16 Y 1 A HIS 69 ? A HIS 69 128 16 Y 1 A HIS 70 ? A HIS 70 129 17 Y 1 A LEU 63 ? A LEU 63 130 17 Y 1 A GLU 64 ? A GLU 64 131 17 Y 1 A HIS 65 ? A HIS 65 132 17 Y 1 A HIS 66 ? A HIS 66 133 17 Y 1 A HIS 67 ? A HIS 67 134 17 Y 1 A HIS 68 ? A HIS 68 135 17 Y 1 A HIS 69 ? A HIS 69 136 17 Y 1 A HIS 70 ? A HIS 70 137 18 Y 1 A LEU 63 ? A LEU 63 138 18 Y 1 A GLU 64 ? A GLU 64 139 18 Y 1 A HIS 65 ? A HIS 65 140 18 Y 1 A HIS 66 ? A HIS 66 141 18 Y 1 A HIS 67 ? A HIS 67 142 18 Y 1 A HIS 68 ? A HIS 68 143 18 Y 1 A HIS 69 ? A HIS 69 144 18 Y 1 A HIS 70 ? A HIS 70 145 19 Y 1 A LEU 63 ? A LEU 63 146 19 Y 1 A GLU 64 ? A GLU 64 147 19 Y 1 A HIS 65 ? A HIS 65 148 19 Y 1 A HIS 66 ? A HIS 66 149 19 Y 1 A HIS 67 ? A HIS 67 150 19 Y 1 A HIS 68 ? A HIS 68 151 19 Y 1 A HIS 69 ? A HIS 69 152 19 Y 1 A HIS 70 ? A HIS 70 153 20 Y 1 A LEU 63 ? A LEU 63 154 20 Y 1 A GLU 64 ? A GLU 64 155 20 Y 1 A HIS 65 ? A HIS 65 156 20 Y 1 A HIS 66 ? A HIS 66 157 20 Y 1 A HIS 67 ? A HIS 67 158 20 Y 1 A HIS 68 ? A HIS 68 159 20 Y 1 A HIS 69 ? A HIS 69 160 20 Y 1 A HIS 70 ? A HIS 70 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TYR N N N N 318 TYR CA C N S 319 TYR C C N N 320 TYR O O N N 321 TYR CB C N N 322 TYR CG C Y N 323 TYR CD1 C Y N 324 TYR CD2 C Y N 325 TYR CE1 C Y N 326 TYR CE2 C Y N 327 TYR CZ C Y N 328 TYR OH O N N 329 TYR OXT O N N 330 TYR H H N N 331 TYR H2 H N N 332 TYR HA H N N 333 TYR HB2 H N N 334 TYR HB3 H N N 335 TYR HD1 H N N 336 TYR HD2 H N N 337 TYR HE1 H N N 338 TYR HE2 H N N 339 TYR HH H N N 340 TYR HXT H N N 341 VAL N N N N 342 VAL CA C N S 343 VAL C C N N 344 VAL O O N N 345 VAL CB C N N 346 VAL CG1 C N N 347 VAL CG2 C N N 348 VAL OXT O N N 349 VAL H H N N 350 VAL H2 H N N 351 VAL HA H N N 352 VAL HB H N N 353 VAL HG11 H N N 354 VAL HG12 H N N 355 VAL HG13 H N N 356 VAL HG21 H N N 357 VAL HG22 H N N 358 VAL HG23 H N N 359 VAL HXT H N N 360 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TYR N CA sing N N 304 TYR N H sing N N 305 TYR N H2 sing N N 306 TYR CA C sing N N 307 TYR CA CB sing N N 308 TYR CA HA sing N N 309 TYR C O doub N N 310 TYR C OXT sing N N 311 TYR CB CG sing N N 312 TYR CB HB2 sing N N 313 TYR CB HB3 sing N N 314 TYR CG CD1 doub Y N 315 TYR CG CD2 sing Y N 316 TYR CD1 CE1 sing Y N 317 TYR CD1 HD1 sing N N 318 TYR CD2 CE2 doub Y N 319 TYR CD2 HD2 sing N N 320 TYR CE1 CZ doub Y N 321 TYR CE1 HE1 sing N N 322 TYR CE2 CZ sing Y N 323 TYR CE2 HE2 sing N N 324 TYR CZ OH sing N N 325 TYR OH HH sing N N 326 TYR OXT HXT sing N N 327 VAL N CA sing N N 328 VAL N H sing N N 329 VAL N H2 sing N N 330 VAL CA C sing N N 331 VAL CA CB sing N N 332 VAL CA HA sing N N 333 VAL C O doub N N 334 VAL C OXT sing N N 335 VAL CB CG1 sing N N 336 VAL CB CG2 sing N N 337 VAL CB HB sing N N 338 VAL CG1 HG11 sing N N 339 VAL CG1 HG12 sing N N 340 VAL CG1 HG13 sing N N 341 VAL CG2 HG21 sing N N 342 VAL CG2 HG22 sing N N 343 VAL CG2 HG23 sing N N 344 VAL OXT HXT sing N N 345 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' GM066806 1 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' GM104040 2 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 5W8Z _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_