data_5WCS # _entry.id 5WCS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5WCS pdb_00005wcs 10.2210/pdb5wcs/pdb WWPDB D_1000228788 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-01-03 2 'Structure model' 1 1 2019-12-11 3 'Structure model' 1 2 2024-03-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_audit_support 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_struct_conn_angle 6 3 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_audit_support.funding_organization' 2 3 'Structure model' '_database_2.pdbx_DOI' 3 3 'Structure model' '_database_2.pdbx_database_accession' 4 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 7 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 8 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 9 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 10 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 12 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 13 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 14 3 'Structure model' '_pdbx_struct_conn_angle.value' 15 3 'Structure model' '_struct_conn.pdbx_dist_value' 16 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 17 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 18 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 19 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 20 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 21 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5WCS _pdbx_database_status.recvd_initial_deposition_date 2017-07-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 5W3I unspecified PDB . 5W44 unspecified PDB . 5W73 unspecified PDB . 5W7U unspecified PDB . 5W92 unspecified PDB . 5W9G unspecified PDB . 5WA6 unspecified PDB . 5WA7 unspecified PDB . 5WAP unspecified PDB . 5WB3 unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kumar, G.' 1 0000-0001-7593-0737 'White, S.W.' 2 0000-0001-8188-5944 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Rep' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2045-2322 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 7 _citation.language ? _citation.page_first 17139 _citation.page_last 17139 _citation.title 'Protein-Structure Assisted Optimization of 4,5-Dihydroxypyrimidine-6-Carboxamide Inhibitors of Influenza Virus Endonuclease.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41598-017-17419-6 _citation.pdbx_database_id_PubMed 29215062 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Beylkin, D.' 1 ? primary 'Kumar, G.' 2 ? primary 'Zhou, W.' 3 ? primary 'Park, J.' 4 ? primary 'Jeevan, T.' 5 ? primary 'Lagisetti, C.' 6 ? primary 'Harfoot, R.' 7 ? primary 'Webby, R.J.' 8 ? primary 'White, S.W.' 9 ? primary 'Webb, T.R.' 10 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Polymerase acidic protein' 21970.160 1 ? 'Loop 51-72 is replaced a GGS linker, C-terminal has residual His-tag' ? ? 2 non-polymer syn 'MANGANESE (II) ION' 54.938 2 ? ? ? ? 3 non-polymer syn '5-hydroxy-2-[(2S)-1-{[(naphthalen-1-yl)oxy]acetyl}pyrrolidin-2-yl]-6-oxo-1,6-dihydropyrimidine-4-carboxylic acid' 409.392 1 ? ? ? ? 4 water nat water 18.015 23 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDGGSKHRFEIIEGRDRIMAWTVVNSICNTTG VEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIR QEMASRSLWDSFRQSERAAAELALVPR ; _entity_poly.pdbx_seq_one_letter_code_can ;MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDGGSKHRFEIIEGRDRIMAWTVVNSICNTTG VEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIR QEMASRSLWDSFRQSERAAAELALVPR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MANGANESE (II) ION' MN 3 '5-hydroxy-2-[(2S)-1-{[(naphthalen-1-yl)oxy]acetyl}pyrrolidin-2-yl]-6-oxo-1,6-dihydropyrimidine-4-carboxylic acid' 9KU 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 ASP n 1 4 PHE n 1 5 VAL n 1 6 ARG n 1 7 GLN n 1 8 CYS n 1 9 PHE n 1 10 ASN n 1 11 PRO n 1 12 MET n 1 13 ILE n 1 14 VAL n 1 15 GLU n 1 16 LEU n 1 17 ALA n 1 18 GLU n 1 19 LYS n 1 20 ALA n 1 21 MET n 1 22 LYS n 1 23 GLU n 1 24 TYR n 1 25 GLY n 1 26 GLU n 1 27 ASP n 1 28 PRO n 1 29 LYS n 1 30 ILE n 1 31 GLU n 1 32 THR n 1 33 ASN n 1 34 LYS n 1 35 PHE n 1 36 ALA n 1 37 ALA n 1 38 ILE n 1 39 CYS n 1 40 THR n 1 41 HIS n 1 42 LEU n 1 43 GLU n 1 44 VAL n 1 45 CYS n 1 46 PHE n 1 47 MET n 1 48 TYR n 1 49 SER n 1 50 ASP n 1 51 GLY n 1 52 GLY n 1 53 SER n 1 54 LYS n 1 55 HIS n 1 56 ARG n 1 57 PHE n 1 58 GLU n 1 59 ILE n 1 60 ILE n 1 61 GLU n 1 62 GLY n 1 63 ARG n 1 64 ASP n 1 65 ARG n 1 66 ILE n 1 67 MET n 1 68 ALA n 1 69 TRP n 1 70 THR n 1 71 VAL n 1 72 VAL n 1 73 ASN n 1 74 SER n 1 75 ILE n 1 76 CYS n 1 77 ASN n 1 78 THR n 1 79 THR n 1 80 GLY n 1 81 VAL n 1 82 GLU n 1 83 LYS n 1 84 PRO n 1 85 LYS n 1 86 PHE n 1 87 LEU n 1 88 PRO n 1 89 ASP n 1 90 LEU n 1 91 TYR n 1 92 ASP n 1 93 TYR n 1 94 LYS n 1 95 GLU n 1 96 ASN n 1 97 ARG n 1 98 PHE n 1 99 ILE n 1 100 GLU n 1 101 ILE n 1 102 GLY n 1 103 VAL n 1 104 THR n 1 105 ARG n 1 106 ARG n 1 107 GLU n 1 108 VAL n 1 109 HIS n 1 110 ILE n 1 111 TYR n 1 112 TYR n 1 113 LEU n 1 114 GLU n 1 115 LYS n 1 116 ALA n 1 117 ASN n 1 118 LYS n 1 119 ILE n 1 120 LYS n 1 121 SER n 1 122 GLU n 1 123 LYS n 1 124 THR n 1 125 HIS n 1 126 ILE n 1 127 HIS n 1 128 ILE n 1 129 PHE n 1 130 SER n 1 131 PHE n 1 132 THR n 1 133 GLY n 1 134 GLU n 1 135 GLU n 1 136 MET n 1 137 ALA n 1 138 THR n 1 139 LYS n 1 140 ALA n 1 141 ASP n 1 142 TYR n 1 143 THR n 1 144 LEU n 1 145 ASP n 1 146 GLU n 1 147 GLU n 1 148 SER n 1 149 ARG n 1 150 ALA n 1 151 ARG n 1 152 ILE n 1 153 LYS n 1 154 THR n 1 155 ARG n 1 156 LEU n 1 157 PHE n 1 158 THR n 1 159 ILE n 1 160 ARG n 1 161 GLN n 1 162 GLU n 1 163 MET n 1 164 ALA n 1 165 SER n 1 166 ARG n 1 167 SER n 1 168 LEU n 1 169 TRP n 1 170 ASP n 1 171 SER n 1 172 PHE n 1 173 ARG n 1 174 GLN n 1 175 SER n 1 176 GLU n 1 177 ARG n 1 178 ALA n 1 179 ALA n 1 180 ALA n 1 181 GLU n 1 182 LEU n 1 183 ALA n 1 184 LEU n 1 185 VAL n 1 186 PRO n 1 187 ARG n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 50 ? ? PA ? 'swl A/California/04/2009 H1N1' ? ? ? ? 'Influenza A virus' 641501 ? ? ? ? ? ? ? ? 'Escherichia coli' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 2 sample 'Biological sequence' 51 187 ? ? PA ? 'swl A/California/04/2009 H1N1' ? ? ? ? 'Influenza A virus' 641501 ? ? ? ? ? ? ? ? 'Escherichia coli' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 9KU non-polymer . '5-hydroxy-2-[(2S)-1-{[(naphthalen-1-yl)oxy]acetyl}pyrrolidin-2-yl]-6-oxo-1,6-dihydropyrimidine-4-carboxylic acid' SRI-29789 'C21 H19 N3 O6' 409.392 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MN non-polymer . 'MANGANESE (II) ION' ? 'Mn 2' 54.938 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 CYS 8 8 8 CYS CYS A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 MET 12 12 12 MET MET A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 MET 21 21 21 MET MET A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 HIS 41 41 41 HIS HIS A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 CYS 45 45 45 CYS CYS A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 MET 47 47 47 MET MET A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 LYS 54 73 73 LYS LYS A . n A 1 55 HIS 55 74 74 HIS HIS A . n A 1 56 ARG 56 75 75 ARG ARG A . n A 1 57 PHE 57 76 76 PHE PHE A . n A 1 58 GLU 58 77 77 GLU GLU A . n A 1 59 ILE 59 78 78 ILE ILE A . n A 1 60 ILE 60 79 79 ILE ILE A . n A 1 61 GLU 61 80 80 GLU GLU A . n A 1 62 GLY 62 81 81 GLY GLY A . n A 1 63 ARG 63 82 82 ARG ARG A . n A 1 64 ASP 64 83 83 ASP ASP A . n A 1 65 ARG 65 84 84 ARG ARG A . n A 1 66 ILE 66 85 85 ILE ILE A . n A 1 67 MET 67 86 86 MET MET A . n A 1 68 ALA 68 87 87 ALA ALA A . n A 1 69 TRP 69 88 88 TRP TRP A . n A 1 70 THR 70 89 89 THR THR A . n A 1 71 VAL 71 90 90 VAL VAL A . n A 1 72 VAL 72 91 91 VAL VAL A . n A 1 73 ASN 73 92 92 ASN ASN A . n A 1 74 SER 74 93 93 SER SER A . n A 1 75 ILE 75 94 94 ILE ILE A . n A 1 76 CYS 76 95 95 CYS CYS A . n A 1 77 ASN 77 96 96 ASN ASN A . n A 1 78 THR 78 97 97 THR THR A . n A 1 79 THR 79 98 98 THR THR A . n A 1 80 GLY 80 99 99 GLY GLY A . n A 1 81 VAL 81 100 100 VAL VAL A . n A 1 82 GLU 82 101 101 GLU GLU A . n A 1 83 LYS 83 102 102 LYS LYS A . n A 1 84 PRO 84 103 103 PRO PRO A . n A 1 85 LYS 85 104 104 LYS LYS A . n A 1 86 PHE 86 105 105 PHE PHE A . n A 1 87 LEU 87 106 106 LEU LEU A . n A 1 88 PRO 88 107 107 PRO PRO A . n A 1 89 ASP 89 108 108 ASP ASP A . n A 1 90 LEU 90 109 109 LEU LEU A . n A 1 91 TYR 91 110 110 TYR TYR A . n A 1 92 ASP 92 111 111 ASP ASP A . n A 1 93 TYR 93 112 112 TYR TYR A . n A 1 94 LYS 94 113 113 LYS LYS A . n A 1 95 GLU 95 114 114 GLU GLU A . n A 1 96 ASN 96 115 115 ASN ASN A . n A 1 97 ARG 97 116 116 ARG ARG A . n A 1 98 PHE 98 117 117 PHE PHE A . n A 1 99 ILE 99 118 118 ILE ILE A . n A 1 100 GLU 100 119 119 GLU GLU A . n A 1 101 ILE 101 120 120 ILE ILE A . n A 1 102 GLY 102 121 121 GLY GLY A . n A 1 103 VAL 103 122 122 VAL VAL A . n A 1 104 THR 104 123 123 THR THR A . n A 1 105 ARG 105 124 124 ARG ARG A . n A 1 106 ARG 106 125 125 ARG ARG A . n A 1 107 GLU 107 126 126 GLU GLU A . n A 1 108 VAL 108 127 127 VAL VAL A . n A 1 109 HIS 109 128 128 HIS HIS A . n A 1 110 ILE 110 129 129 ILE ILE A . n A 1 111 TYR 111 130 130 TYR TYR A . n A 1 112 TYR 112 131 131 TYR TYR A . n A 1 113 LEU 113 132 132 LEU LEU A . n A 1 114 GLU 114 133 133 GLU GLU A . n A 1 115 LYS 115 134 134 LYS LYS A . n A 1 116 ALA 116 135 135 ALA ALA A . n A 1 117 ASN 117 136 136 ASN ASN A . n A 1 118 LYS 118 137 137 LYS LYS A . n A 1 119 ILE 119 138 138 ILE ILE A . n A 1 120 LYS 120 139 139 LYS LYS A . n A 1 121 SER 121 140 140 SER SER A . n A 1 122 GLU 122 141 141 GLU GLU A . n A 1 123 LYS 123 142 142 LYS LYS A . n A 1 124 THR 124 143 143 THR THR A . n A 1 125 HIS 125 144 144 HIS HIS A . n A 1 126 ILE 126 145 145 ILE ILE A . n A 1 127 HIS 127 146 146 HIS HIS A . n A 1 128 ILE 128 147 147 ILE ILE A . n A 1 129 PHE 129 148 148 PHE PHE A . n A 1 130 SER 130 149 149 SER SER A . n A 1 131 PHE 131 150 150 PHE PHE A . n A 1 132 THR 132 151 151 THR THR A . n A 1 133 GLY 133 152 152 GLY GLY A . n A 1 134 GLU 134 153 153 GLU GLU A . n A 1 135 GLU 135 154 154 GLU GLU A . n A 1 136 MET 136 155 155 MET MET A . n A 1 137 ALA 137 156 156 ALA ALA A . n A 1 138 THR 138 157 157 THR THR A . n A 1 139 LYS 139 158 158 LYS LYS A . n A 1 140 ALA 140 159 159 ALA ALA A . n A 1 141 ASP 141 160 160 ASP ASP A . n A 1 142 TYR 142 161 161 TYR TYR A . n A 1 143 THR 143 162 162 THR THR A . n A 1 144 LEU 144 163 163 LEU LEU A . n A 1 145 ASP 145 164 164 ASP ASP A . n A 1 146 GLU 146 165 165 GLU GLU A . n A 1 147 GLU 147 166 166 GLU GLU A . n A 1 148 SER 148 167 167 SER SER A . n A 1 149 ARG 149 168 168 ARG ARG A . n A 1 150 ALA 150 169 169 ALA ALA A . n A 1 151 ARG 151 170 170 ARG ARG A . n A 1 152 ILE 152 171 171 ILE ILE A . n A 1 153 LYS 153 172 172 LYS LYS A . n A 1 154 THR 154 173 173 THR THR A . n A 1 155 ARG 155 174 174 ARG ARG A . n A 1 156 LEU 156 175 175 LEU LEU A . n A 1 157 PHE 157 176 176 PHE PHE A . n A 1 158 THR 158 177 177 THR THR A . n A 1 159 ILE 159 178 178 ILE ILE A . n A 1 160 ARG 160 179 179 ARG ARG A . n A 1 161 GLN 161 180 180 GLN GLN A . n A 1 162 GLU 162 181 181 GLU GLU A . n A 1 163 MET 163 182 182 MET MET A . n A 1 164 ALA 164 183 183 ALA ALA A . n A 1 165 SER 165 184 184 SER SER A . n A 1 166 ARG 166 185 185 ARG ARG A . n A 1 167 SER 167 186 186 SER SER A . n A 1 168 LEU 168 187 187 LEU LEU A . n A 1 169 TRP 169 188 188 TRP TRP A . n A 1 170 ASP 170 189 189 ASP ASP A . n A 1 171 SER 171 190 190 SER SER A . n A 1 172 PHE 172 191 191 PHE PHE A . n A 1 173 ARG 173 192 192 ARG ARG A . n A 1 174 GLN 174 193 193 GLN GLN A . n A 1 175 SER 175 194 194 SER SER A . n A 1 176 GLU 176 195 195 GLU GLU A . n A 1 177 ARG 177 196 196 ARG ARG A . n A 1 178 ALA 178 197 ? ? ? A . n A 1 179 ALA 179 198 ? ? ? A . n A 1 180 ALA 180 199 ? ? ? A . n A 1 181 GLU 181 200 ? ? ? A . n A 1 182 LEU 182 201 ? ? ? A . n A 1 183 ALA 183 202 ? ? ? A . n A 1 184 LEU 184 203 ? ? ? A . n A 1 185 VAL 185 204 ? ? ? A . n A 1 186 PRO 186 205 ? ? ? A . n A 1 187 ARG 187 206 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MN 1 301 1 MN MN A . C 2 MN 1 302 2 MN MN A . D 3 9KU 1 303 1 9KU 9KU A . E 4 HOH 1 401 11 HOH HOH A . E 4 HOH 2 402 2 HOH HOH A . E 4 HOH 3 403 8 HOH HOH A . E 4 HOH 4 404 1 HOH HOH A . E 4 HOH 5 405 18 HOH HOH A . E 4 HOH 6 406 19 HOH HOH A . E 4 HOH 7 407 24 HOH HOH A . E 4 HOH 8 408 12 HOH HOH A . E 4 HOH 9 409 5 HOH HOH A . E 4 HOH 10 410 15 HOH HOH A . E 4 HOH 11 411 6 HOH HOH A . E 4 HOH 12 412 17 HOH HOH A . E 4 HOH 13 413 22 HOH HOH A . E 4 HOH 14 414 20 HOH HOH A . E 4 HOH 15 415 10 HOH HOH A . E 4 HOH 16 416 14 HOH HOH A . E 4 HOH 17 417 3 HOH HOH A . E 4 HOH 18 418 9 HOH HOH A . E 4 HOH 19 419 4 HOH HOH A . E 4 HOH 20 420 13 HOH HOH A . E 4 HOH 21 421 7 HOH HOH A . E 4 HOH 22 422 21 HOH HOH A . E 4 HOH 23 423 23 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 101 ? CG ? A GLU 82 CG 2 1 Y 1 A GLU 101 ? CD ? A GLU 82 CD 3 1 Y 1 A GLU 101 ? OE1 ? A GLU 82 OE1 4 1 Y 1 A GLU 101 ? OE2 ? A GLU 82 OE2 5 1 Y 1 A GLU 133 ? CG ? A GLU 114 CG 6 1 Y 1 A GLU 133 ? CD ? A GLU 114 CD 7 1 Y 1 A GLU 133 ? OE1 ? A GLU 114 OE1 8 1 Y 1 A GLU 133 ? OE2 ? A GLU 114 OE2 9 1 Y 1 A LYS 137 ? CG ? A LYS 118 CG 10 1 Y 1 A LYS 137 ? CD ? A LYS 118 CD 11 1 Y 1 A LYS 137 ? CE ? A LYS 118 CE 12 1 Y 1 A LYS 137 ? NZ ? A LYS 118 NZ 13 1 Y 1 A ILE 138 ? CG1 ? A ILE 119 CG1 14 1 Y 1 A ILE 138 ? CG2 ? A ILE 119 CG2 15 1 Y 1 A ILE 138 ? CD1 ? A ILE 119 CD1 16 1 Y 1 A LYS 139 ? CG ? A LYS 120 CG 17 1 Y 1 A LYS 139 ? CD ? A LYS 120 CD 18 1 Y 1 A LYS 139 ? CE ? A LYS 120 CE 19 1 Y 1 A LYS 139 ? NZ ? A LYS 120 NZ 20 1 Y 1 A GLU 141 ? CG ? A GLU 122 CG 21 1 Y 1 A GLU 141 ? CD ? A GLU 122 CD 22 1 Y 1 A GLU 141 ? OE1 ? A GLU 122 OE1 23 1 Y 1 A GLU 141 ? OE2 ? A GLU 122 OE2 24 1 Y 1 A THR 151 ? OG1 ? A THR 132 OG1 25 1 Y 1 A THR 151 ? CG2 ? A THR 132 CG2 26 1 Y 1 A LYS 158 ? CG ? A LYS 139 CG 27 1 Y 1 A LYS 158 ? CD ? A LYS 139 CD 28 1 Y 1 A LYS 158 ? CE ? A LYS 139 CE 29 1 Y 1 A LYS 158 ? NZ ? A LYS 139 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 5WCS _cell.details ? _cell.formula_units_Z ? _cell.length_a 74.666 _cell.length_a_esd ? _cell.length_b 74.666 _cell.length_b_esd ? _cell.length_c 125.722 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5WCS _symmetry.cell_setting ? _symmetry.Int_Tables_number 181 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 64 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5WCS _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.30 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 46.58 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M MgCl2, 2 mM MnCl2, 0.1 M Tris pH 8.5, 30% PEG 3000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 300 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-11-17 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 22-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 22-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 57.440 _reflns.entry_id 5WCS _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.5250 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7482 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.700 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 21.400 _reflns.pdbx_Rmerge_I_obs 0.122 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.400 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.430 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.125 _reflns.pdbx_Rpim_I_all 0.027 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.530 2.620 ? ? ? ? ? ? ? 97.500 ? ? ? ? 1.060 ? ? ? ? ? ? ? ? 15.300 ? 0.795 ? ? 1.096 0.271 ? 1 1 0.877 ? 2.620 2.730 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.865 ? ? ? ? ? ? ? ? 21.600 ? 0.839 ? ? 0.885 0.188 ? 2 1 0.941 ? 2.730 2.850 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.658 ? ? ? ? ? ? ? ? 22.800 ? 0.872 ? ? 0.673 0.139 ? 3 1 0.965 ? 2.850 3.000 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.419 ? ? ? ? ? ? ? ? 22.900 ? 0.958 ? ? 0.429 0.089 ? 4 1 0.988 ? 3.000 3.190 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.278 ? ? ? ? ? ? ? ? 23.000 ? 1.109 ? ? 0.284 0.059 ? 5 1 0.993 ? 3.190 3.430 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.189 ? ? ? ? ? ? ? ? 22.800 ? 1.405 ? ? 0.193 0.040 ? 6 1 0.996 ? 3.430 3.780 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.136 ? ? ? ? ? ? ? ? 22.700 ? 1.748 ? ? 0.139 0.029 ? 7 1 0.996 ? 3.780 4.330 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.100 ? ? ? ? ? ? ? ? 22.200 ? 1.968 ? ? 0.102 0.022 ? 8 1 0.998 ? 4.330 5.450 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.091 ? ? ? ? ? ? ? ? 21.500 ? 2.275 ? ? 0.093 0.020 ? 9 1 0.998 ? 5.450 50.000 ? ? ? ? ? ? ? 99.700 ? ? ? ? 0.065 ? ? ? ? ? ? ? ? 19.000 ? 2.067 ? ? 0.067 0.015 ? 10 1 0.998 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 132.320 _refine.B_iso_mean 72.2376 _refine.B_iso_min 33.150 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5WCS _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.5250 _refine.ls_d_res_low 35.1680 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7445 _refine.ls_number_reflns_R_free 417 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.7300 _refine.ls_percent_reflns_R_free 5.6000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2082 _refine.ls_R_factor_R_free 0.2402 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2063 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.6400 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3700 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.5250 _refine_hist.d_res_low 35.1680 _refine_hist.pdbx_number_atoms_ligand 32 _refine_hist.number_atoms_solvent 23 _refine_hist.number_atoms_total 1495 _refine_hist.pdbx_number_residues_total 177 _refine_hist.pdbx_B_iso_mean_ligand 104.17 _refine_hist.pdbx_B_iso_mean_solvent 58.82 _refine_hist.pdbx_number_atoms_protein 1440 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.002 ? 1503 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.420 ? 2024 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.037 ? 212 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 261 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 2.533 ? 918 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.5248 2.8900 2388 . 133 2255 99.0000 . . . 0.3387 0.0000 0.2765 . . . . . . 3 . . . 'X-RAY DIFFRACTION' 2.8900 3.6404 2436 . 141 2295 100.0000 . . . 0.2690 0.0000 0.2388 . . . . . . 3 . . . 'X-RAY DIFFRACTION' 3.6404 35.1710 2621 . 143 2478 100.0000 . . . 0.2087 0.0000 0.1806 . . . . . . 3 . . . # _struct.entry_id 5WCS _struct.title 'Crystal structure of the influenza virus PA endonuclease in complex with inhibitor 6b (SRI-29789)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5WCS _struct_keywords.text 'nuclease, transcription, cap-snatching, virus, HYDROLASE, hydrolase-hydrolase inhibitor complex' _struct_keywords.pdbx_keywords 'HYDROLASE/HYDROLASE INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP C3W5S0_I09A0 C3W5S0 ? 1 MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 1 2 UNP C3W5S0_I09A0 C3W5S0 ? 1 ;KHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTG EEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSER ; 73 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5WCS A 1 ? 50 ? C3W5S0 1 ? 50 ? 1 50 2 2 5WCS A 54 ? 177 ? C3W5S0 73 ? 196 ? 73 196 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5WCS GLY A 51 ? UNP C3W5S0 ? ? linker 51 1 1 5WCS GLY A 52 ? UNP C3W5S0 ? ? linker 52 2 1 5WCS SER A 53 ? UNP C3W5S0 ? ? linker 53 3 2 5WCS ALA A 178 ? UNP C3W5S0 ? ? 'expression tag' 197 4 2 5WCS ALA A 179 ? UNP C3W5S0 ? ? 'expression tag' 198 5 2 5WCS ALA A 180 ? UNP C3W5S0 ? ? 'expression tag' 199 6 2 5WCS GLU A 181 ? UNP C3W5S0 ? ? 'expression tag' 200 7 2 5WCS LEU A 182 ? UNP C3W5S0 ? ? 'expression tag' 201 8 2 5WCS ALA A 183 ? UNP C3W5S0 ? ? 'expression tag' 202 9 2 5WCS LEU A 184 ? UNP C3W5S0 ? ? 'expression tag' 203 10 2 5WCS VAL A 185 ? UNP C3W5S0 ? ? 'expression tag' 204 11 2 5WCS PRO A 186 ? UNP C3W5S0 ? ? 'expression tag' 205 12 2 5WCS ARG A 187 ? UNP C3W5S0 ? ? 'expression tag' 206 13 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 software_defined_assembly PISA dimeric 2 2 software_defined_assembly PISA monomeric 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1520 ? 1 MORE -27 ? 1 'SSA (A^2)' 18100 ? 2 'ABSA (A^2)' 150 ? 2 MORE -7 ? 2 'SSA (A^2)' 9660 ? # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1,2 A,B,C,D,E 2 1 A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details 'Protein purifies as a monomer' # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_675 x-y+1,-y+2,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 129.3253055979 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 MET A 1 ? PHE A 9 ? MET A 1 PHE A 9 1 ? 9 HELX_P HELX_P2 AA2 ASN A 10 ? GLU A 23 ? ASN A 10 GLU A 23 1 ? 14 HELX_P HELX_P3 AA3 GLU A 31 ? SER A 49 ? GLU A 31 SER A 49 1 ? 19 HELX_P HELX_P4 AA4 ASP A 64 ? THR A 79 ? ASP A 83 THR A 98 1 ? 16 HELX_P HELX_P5 AA5 GLU A 107 ? LYS A 120 ? GLU A 126 LYS A 139 1 ? 14 HELX_P HELX_P6 AA6 LYS A 139 ? ASP A 141 ? LYS A 158 ASP A 160 5 ? 3 HELX_P HELX_P7 AA7 ASP A 145 ? ARG A 166 ? ASP A 164 ARG A 185 1 ? 22 HELX_P HELX_P8 AA8 LEU A 168 ? SER A 175 ? LEU A 187 SER A 194 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 41 NE2 ? ? ? 1_555 C MN . MN ? ? A HIS 41 A MN 302 1_555 ? ? ? ? ? ? ? 2.347 ? ? metalc2 metalc ? ? A GLU 61 OE1 ? ? ? 1_555 B MN . MN ? ? A GLU 80 A MN 301 1_555 ? ? ? ? ? ? ? 2.168 ? ? metalc3 metalc ? ? A ASP 89 OD2 ? ? ? 1_555 B MN . MN ? ? A ASP 108 A MN 301 1_555 ? ? ? ? ? ? ? 2.176 ? ? metalc4 metalc ? ? A ASP 89 OD1 ? ? ? 1_555 C MN . MN ? ? A ASP 108 A MN 302 1_555 ? ? ? ? ? ? ? 2.186 ? ? metalc5 metalc ? ? A GLU 100 OE1 ? ? ? 1_555 C MN . MN ? ? A GLU 119 A MN 302 1_555 ? ? ? ? ? ? ? 2.127 ? ? metalc6 metalc ? ? A ILE 101 O ? ? ? 1_555 C MN . MN ? ? A ILE 120 A MN 302 1_555 ? ? ? ? ? ? ? 2.048 ? ? metalc7 metalc ? ? B MN . MN ? ? ? 1_555 D 9KU . O1 ? ? A MN 301 A 9KU 303 1_555 ? ? ? ? ? ? ? 2.055 ? ? metalc8 metalc ? ? B MN . MN ? ? ? 1_555 D 9KU . O2 ? ? A MN 301 A 9KU 303 1_555 ? ? ? ? ? ? ? 2.004 ? ? metalc9 metalc ? ? B MN . MN ? ? ? 1_555 E HOH . O ? ? A MN 301 A HOH 402 1_555 ? ? ? ? ? ? ? 2.607 ? ? metalc10 metalc ? ? B MN . MN ? ? ? 1_555 E HOH . O ? ? A MN 301 A HOH 404 1_555 ? ? ? ? ? ? ? 2.376 ? ? metalc11 metalc ? ? C MN . MN ? ? ? 1_555 D 9KU . O2 ? ? A MN 302 A 9KU 303 1_555 ? ? ? ? ? ? ? 2.275 ? ? metalc12 metalc ? ? C MN . MN ? ? ? 1_555 D 9KU . O4 ? ? A MN 302 A 9KU 303 1_555 ? ? ? ? ? ? ? 2.039 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 41 ? A HIS 41 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 OD1 ? A ASP 89 ? A ASP 108 ? 1_555 72.4 ? 2 NE2 ? A HIS 41 ? A HIS 41 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 OE1 ? A GLU 100 ? A GLU 119 ? 1_555 162.7 ? 3 OD1 ? A ASP 89 ? A ASP 108 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 OE1 ? A GLU 100 ? A GLU 119 ? 1_555 90.4 ? 4 NE2 ? A HIS 41 ? A HIS 41 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? A ILE 101 ? A ILE 120 ? 1_555 91.4 ? 5 OD1 ? A ASP 89 ? A ASP 108 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? A ILE 101 ? A ILE 120 ? 1_555 94.6 ? 6 OE1 ? A GLU 100 ? A GLU 119 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? A ILE 101 ? A ILE 120 ? 1_555 87.8 ? 7 NE2 ? A HIS 41 ? A HIS 41 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O2 ? D 9KU . ? A 9KU 303 ? 1_555 88.1 ? 8 OD1 ? A ASP 89 ? A ASP 108 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O2 ? D 9KU . ? A 9KU 303 ? 1_555 98.3 ? 9 OE1 ? A GLU 100 ? A GLU 119 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O2 ? D 9KU . ? A 9KU 303 ? 1_555 96.8 ? 10 O ? A ILE 101 ? A ILE 120 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O2 ? D 9KU . ? A 9KU 303 ? 1_555 166.2 ? 11 NE2 ? A HIS 41 ? A HIS 41 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O4 ? D 9KU . ? A 9KU 303 ? 1_555 88.0 ? 12 OD1 ? A ASP 89 ? A ASP 108 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O4 ? D 9KU . ? A 9KU 303 ? 1_555 158.7 ? 13 OE1 ? A GLU 100 ? A GLU 119 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O4 ? D 9KU . ? A 9KU 303 ? 1_555 109.3 ? 14 O ? A ILE 101 ? A ILE 120 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O4 ? D 9KU . ? A 9KU 303 ? 1_555 93.9 ? 15 O2 ? D 9KU . ? A 9KU 303 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O4 ? D 9KU . ? A 9KU 303 ? 1_555 72.3 ? 16 OE1 ? A GLU 61 ? A GLU 80 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 OD2 ? A ASP 89 ? A ASP 108 ? 1_555 85.5 ? 17 OE1 ? A GLU 61 ? A GLU 80 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O1 ? D 9KU . ? A 9KU 303 ? 1_555 106.3 ? 18 OD2 ? A ASP 89 ? A ASP 108 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O1 ? D 9KU . ? A 9KU 303 ? 1_555 162.2 ? 19 OE1 ? A GLU 61 ? A GLU 80 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O2 ? D 9KU . ? A 9KU 303 ? 1_555 116.1 ? 20 OD2 ? A ASP 89 ? A ASP 108 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O2 ? D 9KU . ? A 9KU 303 ? 1_555 104.5 ? 21 O1 ? D 9KU . ? A 9KU 303 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O2 ? D 9KU . ? A 9KU 303 ? 1_555 82.6 ? 22 OE1 ? A GLU 61 ? A GLU 80 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O ? E HOH . ? A HOH 402 ? 1_555 147.9 ? 23 OD2 ? A ASP 89 ? A ASP 108 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O ? E HOH . ? A HOH 402 ? 1_555 82.3 ? 24 O1 ? D 9KU . ? A 9KU 303 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O ? E HOH . ? A HOH 402 ? 1_555 80.7 ? 25 O2 ? D 9KU . ? A 9KU 303 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O ? E HOH . ? A HOH 402 ? 1_555 95.8 ? 26 OE1 ? A GLU 61 ? A GLU 80 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O ? E HOH . ? A HOH 404 ? 1_555 79.0 ? 27 OD2 ? A ASP 89 ? A ASP 108 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O ? E HOH . ? A HOH 404 ? 1_555 76.6 ? 28 O1 ? D 9KU . ? A 9KU 303 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O ? E HOH . ? A HOH 404 ? 1_555 92.4 ? 29 O2 ? D 9KU . ? A 9KU 303 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O ? E HOH . ? A HOH 404 ? 1_555 164.9 ? 30 O ? E HOH . ? A HOH 402 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O ? E HOH . ? A HOH 404 ? 1_555 69.4 ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 57 ? ILE A 59 ? PHE A 76 ILE A 78 AA1 2 LEU A 90 ? ASP A 92 ? LEU A 109 ASP A 111 AA1 3 ARG A 97 ? THR A 104 ? ARG A 116 THR A 123 AA1 4 HIS A 125 ? SER A 130 ? HIS A 144 SER A 149 AA1 5 GLU A 135 ? ALA A 137 ? GLU A 154 ALA A 156 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 58 ? N GLU A 77 O TYR A 91 ? O TYR A 110 AA1 2 3 N ASP A 92 ? N ASP A 111 O ARG A 97 ? O ARG A 116 AA1 3 4 N PHE A 98 ? N PHE A 117 O HIS A 125 ? O HIS A 144 AA1 4 5 N ILE A 128 ? N ILE A 147 O MET A 136 ? O MET A 155 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A MN 301 ? 7 'binding site for residue MN A 301' AC2 Software A MN 302 ? 6 'binding site for residue MN A 302' AC3 Software A 9KU 303 ? 17 'binding site for residue 9KU A 303' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 HIS A 41 ? HIS A 41 . ? 1_555 ? 2 AC1 7 GLU A 61 ? GLU A 80 . ? 1_555 ? 3 AC1 7 ASP A 89 ? ASP A 108 . ? 1_555 ? 4 AC1 7 MN C . ? MN A 302 . ? 1_555 ? 5 AC1 7 9KU D . ? 9KU A 303 . ? 1_555 ? 6 AC1 7 HOH E . ? HOH A 402 . ? 1_555 ? 7 AC1 7 HOH E . ? HOH A 404 . ? 1_555 ? 8 AC2 6 HIS A 41 ? HIS A 41 . ? 1_555 ? 9 AC2 6 ASP A 89 ? ASP A 108 . ? 1_555 ? 10 AC2 6 GLU A 100 ? GLU A 119 . ? 1_555 ? 11 AC2 6 ILE A 101 ? ILE A 120 . ? 1_555 ? 12 AC2 6 MN B . ? MN A 301 . ? 1_555 ? 13 AC2 6 9KU D . ? 9KU A 303 . ? 1_555 ? 14 AC3 17 ALA A 20 ? ALA A 20 . ? 1_555 ? 15 AC3 17 MET A 21 ? MET A 21 . ? 1_555 ? 16 AC3 17 TYR A 24 ? TYR A 24 . ? 1_555 ? 17 AC3 17 LYS A 34 ? LYS A 34 . ? 1_555 ? 18 AC3 17 ILE A 38 ? ILE A 38 . ? 1_555 ? 19 AC3 17 HIS A 41 ? HIS A 41 . ? 1_555 ? 20 AC3 17 GLU A 61 ? GLU A 80 . ? 1_555 ? 21 AC3 17 ASP A 89 ? ASP A 108 . ? 1_555 ? 22 AC3 17 GLU A 100 ? GLU A 119 . ? 1_555 ? 23 AC3 17 ILE A 101 ? ILE A 120 . ? 1_555 ? 24 AC3 17 TYR A 111 ? TYR A 130 . ? 1_555 ? 25 AC3 17 LYS A 115 ? LYS A 134 . ? 1_555 ? 26 AC3 17 MN B . ? MN A 301 . ? 1_555 ? 27 AC3 17 MN C . ? MN A 302 . ? 1_555 ? 28 AC3 17 HOH E . ? HOH A 402 . ? 1_555 ? 29 AC3 17 HOH E . ? HOH A 406 . ? 1_555 ? 30 AC3 17 HOH E . ? HOH A 416 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 125 ? ? -86.80 -138.95 2 1 LYS A 139 ? ? 64.72 -29.59 3 1 THR A 162 ? ? 60.89 -57.76 # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 58.9434 _pdbx_refine_tls.origin_y 78.4755 _pdbx_refine_tls.origin_z 6.8861 _pdbx_refine_tls.T[1][1] 0.4628 _pdbx_refine_tls.T[2][2] 0.3588 _pdbx_refine_tls.T[3][3] 0.5025 _pdbx_refine_tls.T[1][2] 0.0407 _pdbx_refine_tls.T[1][3] 0.0874 _pdbx_refine_tls.T[2][3] -0.0585 _pdbx_refine_tls.L[1][1] 3.7285 _pdbx_refine_tls.L[2][2] 2.0355 _pdbx_refine_tls.L[3][3] 4.8028 _pdbx_refine_tls.L[1][2] -1.0074 _pdbx_refine_tls.L[1][3] -0.5298 _pdbx_refine_tls.L[2][3] 0.4749 _pdbx_refine_tls.S[1][1] 0.0410 _pdbx_refine_tls.S[2][2] -0.1003 _pdbx_refine_tls.S[3][3] 0.0119 _pdbx_refine_tls.S[1][2] -0.1649 _pdbx_refine_tls.S[1][3] 0.2633 _pdbx_refine_tls.S[2][3] 0.2810 _pdbx_refine_tls.S[2][1] 0.1022 _pdbx_refine_tls.S[3][1] -0.3289 _pdbx_refine_tls.S[3][2] -0.4030 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 1 A 196 all ? ? ? ? ? 'X-RAY DIFFRACTION' 2 1 B 1 B 2 all ? ? ? ? ? 'X-RAY DIFFRACTION' 3 1 C 1 C 24 all ? ? ? ? ? 'X-RAY DIFFRACTION' 4 1 D 1 D 1 all ? ? ? ? ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 197 ? A ALA 178 2 1 Y 1 A ALA 198 ? A ALA 179 3 1 Y 1 A ALA 199 ? A ALA 180 4 1 Y 1 A GLU 200 ? A GLU 181 5 1 Y 1 A LEU 201 ? A LEU 182 6 1 Y 1 A ALA 202 ? A ALA 183 7 1 Y 1 A LEU 203 ? A LEU 184 8 1 Y 1 A VAL 204 ? A VAL 185 9 1 Y 1 A PRO 205 ? A PRO 186 10 1 Y 1 A ARG 206 ? A ARG 187 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 9KU C1 C N N 1 9KU C10 C Y N 2 9KU C11 C Y N 3 9KU C12 C Y N 4 9KU C13 C Y N 5 9KU C14 C Y N 6 9KU C15 C Y N 7 9KU C16 C Y N 8 9KU C17 C Y N 9 9KU C18 C Y N 10 9KU C19 C N N 11 9KU C2 C N N 12 9KU C20 C N N 13 9KU C21 C N N 14 9KU C3 C N N 15 9KU C4 C N N 16 9KU C5 C N N 17 9KU C6 C N S 18 9KU C7 C N N 19 9KU C8 C N N 20 9KU C9 C Y N 21 9KU N1 N N N 22 9KU N2 N N N 23 9KU N3 N N N 24 9KU O1 O N N 25 9KU O2 O N N 26 9KU O3 O N N 27 9KU O4 O N N 28 9KU O5 O N N 29 9KU O6 O N N 30 9KU H1 H N N 31 9KU H2 H N N 32 9KU H3 H N N 33 9KU H4 H N N 34 9KU H5 H N N 35 9KU H6 H N N 36 9KU H7 H N N 37 9KU H8 H N N 38 9KU H9 H N N 39 9KU H10 H N N 40 9KU H11 H N N 41 9KU H12 H N N 42 9KU H13 H N N 43 9KU H14 H N N 44 9KU H15 H N N 45 9KU H16 H N N 46 9KU H17 H N N 47 9KU H18 H N N 48 9KU H19 H N N 49 ALA N N N N 50 ALA CA C N S 51 ALA C C N N 52 ALA O O N N 53 ALA CB C N N 54 ALA OXT O N N 55 ALA H H N N 56 ALA H2 H N N 57 ALA HA H N N 58 ALA HB1 H N N 59 ALA HB2 H N N 60 ALA HB3 H N N 61 ALA HXT H N N 62 ARG N N N N 63 ARG CA C N S 64 ARG C C N N 65 ARG O O N N 66 ARG CB C N N 67 ARG CG C N N 68 ARG CD C N N 69 ARG NE N N N 70 ARG CZ C N N 71 ARG NH1 N N N 72 ARG NH2 N N N 73 ARG OXT O N N 74 ARG H H N N 75 ARG H2 H N N 76 ARG HA H N N 77 ARG HB2 H N N 78 ARG HB3 H N N 79 ARG HG2 H N N 80 ARG HG3 H N N 81 ARG HD2 H N N 82 ARG HD3 H N N 83 ARG HE H N N 84 ARG HH11 H N N 85 ARG HH12 H N N 86 ARG HH21 H N N 87 ARG HH22 H N N 88 ARG HXT H N N 89 ASN N N N N 90 ASN CA C N S 91 ASN C C N N 92 ASN O O N N 93 ASN CB C N N 94 ASN CG C N N 95 ASN OD1 O N N 96 ASN ND2 N N N 97 ASN OXT O N N 98 ASN H H N N 99 ASN H2 H N N 100 ASN HA H N N 101 ASN HB2 H N N 102 ASN HB3 H N N 103 ASN HD21 H N N 104 ASN HD22 H N N 105 ASN HXT H N N 106 ASP N N N N 107 ASP CA C N S 108 ASP C C N N 109 ASP O O N N 110 ASP CB C N N 111 ASP CG C N N 112 ASP OD1 O N N 113 ASP OD2 O N N 114 ASP OXT O N N 115 ASP H H N N 116 ASP H2 H N N 117 ASP HA H N N 118 ASP HB2 H N N 119 ASP HB3 H N N 120 ASP HD2 H N N 121 ASP HXT H N N 122 CYS N N N N 123 CYS CA C N R 124 CYS C C N N 125 CYS O O N N 126 CYS CB C N N 127 CYS SG S N N 128 CYS OXT O N N 129 CYS H H N N 130 CYS H2 H N N 131 CYS HA H N N 132 CYS HB2 H N N 133 CYS HB3 H N N 134 CYS HG H N N 135 CYS HXT H N N 136 GLN N N N N 137 GLN CA C N S 138 GLN C C N N 139 GLN O O N N 140 GLN CB C N N 141 GLN CG C N N 142 GLN CD C N N 143 GLN OE1 O N N 144 GLN NE2 N N N 145 GLN OXT O N N 146 GLN H H N N 147 GLN H2 H N N 148 GLN HA H N N 149 GLN HB2 H N N 150 GLN HB3 H N N 151 GLN HG2 H N N 152 GLN HG3 H N N 153 GLN HE21 H N N 154 GLN HE22 H N N 155 GLN HXT H N N 156 GLU N N N N 157 GLU CA C N S 158 GLU C C N N 159 GLU O O N N 160 GLU CB C N N 161 GLU CG C N N 162 GLU CD C N N 163 GLU OE1 O N N 164 GLU OE2 O N N 165 GLU OXT O N N 166 GLU H H N N 167 GLU H2 H N N 168 GLU HA H N N 169 GLU HB2 H N N 170 GLU HB3 H N N 171 GLU HG2 H N N 172 GLU HG3 H N N 173 GLU HE2 H N N 174 GLU HXT H N N 175 GLY N N N N 176 GLY CA C N N 177 GLY C C N N 178 GLY O O N N 179 GLY OXT O N N 180 GLY H H N N 181 GLY H2 H N N 182 GLY HA2 H N N 183 GLY HA3 H N N 184 GLY HXT H N N 185 HIS N N N N 186 HIS CA C N S 187 HIS C C N N 188 HIS O O N N 189 HIS CB C N N 190 HIS CG C Y N 191 HIS ND1 N Y N 192 HIS CD2 C Y N 193 HIS CE1 C Y N 194 HIS NE2 N Y N 195 HIS OXT O N N 196 HIS H H N N 197 HIS H2 H N N 198 HIS HA H N N 199 HIS HB2 H N N 200 HIS HB3 H N N 201 HIS HD1 H N N 202 HIS HD2 H N N 203 HIS HE1 H N N 204 HIS HE2 H N N 205 HIS HXT H N N 206 HOH O O N N 207 HOH H1 H N N 208 HOH H2 H N N 209 ILE N N N N 210 ILE CA C N S 211 ILE C C N N 212 ILE O O N N 213 ILE CB C N S 214 ILE CG1 C N N 215 ILE CG2 C N N 216 ILE CD1 C N N 217 ILE OXT O N N 218 ILE H H N N 219 ILE H2 H N N 220 ILE HA H N N 221 ILE HB H N N 222 ILE HG12 H N N 223 ILE HG13 H N N 224 ILE HG21 H N N 225 ILE HG22 H N N 226 ILE HG23 H N N 227 ILE HD11 H N N 228 ILE HD12 H N N 229 ILE HD13 H N N 230 ILE HXT H N N 231 LEU N N N N 232 LEU CA C N S 233 LEU C C N N 234 LEU O O N N 235 LEU CB C N N 236 LEU CG C N N 237 LEU CD1 C N N 238 LEU CD2 C N N 239 LEU OXT O N N 240 LEU H H N N 241 LEU H2 H N N 242 LEU HA H N N 243 LEU HB2 H N N 244 LEU HB3 H N N 245 LEU HG H N N 246 LEU HD11 H N N 247 LEU HD12 H N N 248 LEU HD13 H N N 249 LEU HD21 H N N 250 LEU HD22 H N N 251 LEU HD23 H N N 252 LEU HXT H N N 253 LYS N N N N 254 LYS CA C N S 255 LYS C C N N 256 LYS O O N N 257 LYS CB C N N 258 LYS CG C N N 259 LYS CD C N N 260 LYS CE C N N 261 LYS NZ N N N 262 LYS OXT O N N 263 LYS H H N N 264 LYS H2 H N N 265 LYS HA H N N 266 LYS HB2 H N N 267 LYS HB3 H N N 268 LYS HG2 H N N 269 LYS HG3 H N N 270 LYS HD2 H N N 271 LYS HD3 H N N 272 LYS HE2 H N N 273 LYS HE3 H N N 274 LYS HZ1 H N N 275 LYS HZ2 H N N 276 LYS HZ3 H N N 277 LYS HXT H N N 278 MET N N N N 279 MET CA C N S 280 MET C C N N 281 MET O O N N 282 MET CB C N N 283 MET CG C N N 284 MET SD S N N 285 MET CE C N N 286 MET OXT O N N 287 MET H H N N 288 MET H2 H N N 289 MET HA H N N 290 MET HB2 H N N 291 MET HB3 H N N 292 MET HG2 H N N 293 MET HG3 H N N 294 MET HE1 H N N 295 MET HE2 H N N 296 MET HE3 H N N 297 MET HXT H N N 298 MN MN MN N N 299 PHE N N N N 300 PHE CA C N S 301 PHE C C N N 302 PHE O O N N 303 PHE CB C N N 304 PHE CG C Y N 305 PHE CD1 C Y N 306 PHE CD2 C Y N 307 PHE CE1 C Y N 308 PHE CE2 C Y N 309 PHE CZ C Y N 310 PHE OXT O N N 311 PHE H H N N 312 PHE H2 H N N 313 PHE HA H N N 314 PHE HB2 H N N 315 PHE HB3 H N N 316 PHE HD1 H N N 317 PHE HD2 H N N 318 PHE HE1 H N N 319 PHE HE2 H N N 320 PHE HZ H N N 321 PHE HXT H N N 322 PRO N N N N 323 PRO CA C N S 324 PRO C C N N 325 PRO O O N N 326 PRO CB C N N 327 PRO CG C N N 328 PRO CD C N N 329 PRO OXT O N N 330 PRO H H N N 331 PRO HA H N N 332 PRO HB2 H N N 333 PRO HB3 H N N 334 PRO HG2 H N N 335 PRO HG3 H N N 336 PRO HD2 H N N 337 PRO HD3 H N N 338 PRO HXT H N N 339 SER N N N N 340 SER CA C N S 341 SER C C N N 342 SER O O N N 343 SER CB C N N 344 SER OG O N N 345 SER OXT O N N 346 SER H H N N 347 SER H2 H N N 348 SER HA H N N 349 SER HB2 H N N 350 SER HB3 H N N 351 SER HG H N N 352 SER HXT H N N 353 THR N N N N 354 THR CA C N S 355 THR C C N N 356 THR O O N N 357 THR CB C N R 358 THR OG1 O N N 359 THR CG2 C N N 360 THR OXT O N N 361 THR H H N N 362 THR H2 H N N 363 THR HA H N N 364 THR HB H N N 365 THR HG1 H N N 366 THR HG21 H N N 367 THR HG22 H N N 368 THR HG23 H N N 369 THR HXT H N N 370 TRP N N N N 371 TRP CA C N S 372 TRP C C N N 373 TRP O O N N 374 TRP CB C N N 375 TRP CG C Y N 376 TRP CD1 C Y N 377 TRP CD2 C Y N 378 TRP NE1 N Y N 379 TRP CE2 C Y N 380 TRP CE3 C Y N 381 TRP CZ2 C Y N 382 TRP CZ3 C Y N 383 TRP CH2 C Y N 384 TRP OXT O N N 385 TRP H H N N 386 TRP H2 H N N 387 TRP HA H N N 388 TRP HB2 H N N 389 TRP HB3 H N N 390 TRP HD1 H N N 391 TRP HE1 H N N 392 TRP HE3 H N N 393 TRP HZ2 H N N 394 TRP HZ3 H N N 395 TRP HH2 H N N 396 TRP HXT H N N 397 TYR N N N N 398 TYR CA C N S 399 TYR C C N N 400 TYR O O N N 401 TYR CB C N N 402 TYR CG C Y N 403 TYR CD1 C Y N 404 TYR CD2 C Y N 405 TYR CE1 C Y N 406 TYR CE2 C Y N 407 TYR CZ C Y N 408 TYR OH O N N 409 TYR OXT O N N 410 TYR H H N N 411 TYR H2 H N N 412 TYR HA H N N 413 TYR HB2 H N N 414 TYR HB3 H N N 415 TYR HD1 H N N 416 TYR HD2 H N N 417 TYR HE1 H N N 418 TYR HE2 H N N 419 TYR HH H N N 420 TYR HXT H N N 421 VAL N N N N 422 VAL CA C N S 423 VAL C C N N 424 VAL O O N N 425 VAL CB C N N 426 VAL CG1 C N N 427 VAL CG2 C N N 428 VAL OXT O N N 429 VAL H H N N 430 VAL H2 H N N 431 VAL HA H N N 432 VAL HB H N N 433 VAL HG11 H N N 434 VAL HG12 H N N 435 VAL HG13 H N N 436 VAL HG21 H N N 437 VAL HG22 H N N 438 VAL HG23 H N N 439 VAL HXT H N N 440 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 9KU C20 C19 sing N N 1 9KU C20 C21 sing N N 2 9KU O1 C1 doub N N 3 9KU C19 N2 sing N N 4 9KU C21 C6 sing N N 5 9KU C1 N3 sing N N 6 9KU C1 C2 sing N N 7 9KU N3 C5 sing N N 8 9KU O2 C2 sing N N 9 9KU C2 C3 doub N N 10 9KU C5 C6 sing N N 11 9KU C5 N1 doub N N 12 9KU N2 C6 sing N N 13 9KU N2 C7 sing N N 14 9KU C8 C7 sing N N 15 9KU C8 O5 sing N N 16 9KU C3 N1 sing N N 17 9KU C3 C4 sing N N 18 9KU C7 O6 doub N N 19 9KU O4 C4 doub N N 20 9KU C4 O3 sing N N 21 9KU O5 C9 sing N N 22 9KU C10 C9 doub Y N 23 9KU C10 C11 sing Y N 24 9KU C9 C14 sing Y N 25 9KU C11 C12 doub Y N 26 9KU C14 C15 doub Y N 27 9KU C14 C13 sing Y N 28 9KU C15 C16 sing Y N 29 9KU C12 C13 sing Y N 30 9KU C13 C18 doub Y N 31 9KU C16 C17 doub Y N 32 9KU C18 C17 sing Y N 33 9KU C10 H1 sing N N 34 9KU C11 H2 sing N N 35 9KU C12 H3 sing N N 36 9KU C15 H4 sing N N 37 9KU C16 H5 sing N N 38 9KU C17 H6 sing N N 39 9KU C18 H7 sing N N 40 9KU C19 H8 sing N N 41 9KU C19 H9 sing N N 42 9KU C20 H10 sing N N 43 9KU C20 H11 sing N N 44 9KU C21 H12 sing N N 45 9KU C21 H13 sing N N 46 9KU C6 H14 sing N N 47 9KU C8 H15 sing N N 48 9KU C8 H16 sing N N 49 9KU N3 H17 sing N N 50 9KU O2 H18 sing N N 51 9KU O3 H19 sing N N 52 ALA N CA sing N N 53 ALA N H sing N N 54 ALA N H2 sing N N 55 ALA CA C sing N N 56 ALA CA CB sing N N 57 ALA CA HA sing N N 58 ALA C O doub N N 59 ALA C OXT sing N N 60 ALA CB HB1 sing N N 61 ALA CB HB2 sing N N 62 ALA CB HB3 sing N N 63 ALA OXT HXT sing N N 64 ARG N CA sing N N 65 ARG N H sing N N 66 ARG N H2 sing N N 67 ARG CA C sing N N 68 ARG CA CB sing N N 69 ARG CA HA sing N N 70 ARG C O doub N N 71 ARG C OXT sing N N 72 ARG CB CG sing N N 73 ARG CB HB2 sing N N 74 ARG CB HB3 sing N N 75 ARG CG CD sing N N 76 ARG CG HG2 sing N N 77 ARG CG HG3 sing N N 78 ARG CD NE sing N N 79 ARG CD HD2 sing N N 80 ARG CD HD3 sing N N 81 ARG NE CZ sing N N 82 ARG NE HE sing N N 83 ARG CZ NH1 sing N N 84 ARG CZ NH2 doub N N 85 ARG NH1 HH11 sing N N 86 ARG NH1 HH12 sing N N 87 ARG NH2 HH21 sing N N 88 ARG NH2 HH22 sing N N 89 ARG OXT HXT sing N N 90 ASN N CA sing N N 91 ASN N H sing N N 92 ASN N H2 sing N N 93 ASN CA C sing N N 94 ASN CA CB sing N N 95 ASN CA HA sing N N 96 ASN C O doub N N 97 ASN C OXT sing N N 98 ASN CB CG sing N N 99 ASN CB HB2 sing N N 100 ASN CB HB3 sing N N 101 ASN CG OD1 doub N N 102 ASN CG ND2 sing N N 103 ASN ND2 HD21 sing N N 104 ASN ND2 HD22 sing N N 105 ASN OXT HXT sing N N 106 ASP N CA sing N N 107 ASP N H sing N N 108 ASP N H2 sing N N 109 ASP CA C sing N N 110 ASP CA CB sing N N 111 ASP CA HA sing N N 112 ASP C O doub N N 113 ASP C OXT sing N N 114 ASP CB CG sing N N 115 ASP CB HB2 sing N N 116 ASP CB HB3 sing N N 117 ASP CG OD1 doub N N 118 ASP CG OD2 sing N N 119 ASP OD2 HD2 sing N N 120 ASP OXT HXT sing N N 121 CYS N CA sing N N 122 CYS N H sing N N 123 CYS N H2 sing N N 124 CYS CA C sing N N 125 CYS CA CB sing N N 126 CYS CA HA sing N N 127 CYS C O doub N N 128 CYS C OXT sing N N 129 CYS CB SG sing N N 130 CYS CB HB2 sing N N 131 CYS CB HB3 sing N N 132 CYS SG HG sing N N 133 CYS OXT HXT sing N N 134 GLN N CA sing N N 135 GLN N H sing N N 136 GLN N H2 sing N N 137 GLN CA C sing N N 138 GLN CA CB sing N N 139 GLN CA HA sing N N 140 GLN C O doub N N 141 GLN C OXT sing N N 142 GLN CB CG sing N N 143 GLN CB HB2 sing N N 144 GLN CB HB3 sing N N 145 GLN CG CD sing N N 146 GLN CG HG2 sing N N 147 GLN CG HG3 sing N N 148 GLN CD OE1 doub N N 149 GLN CD NE2 sing N N 150 GLN NE2 HE21 sing N N 151 GLN NE2 HE22 sing N N 152 GLN OXT HXT sing N N 153 GLU N CA sing N N 154 GLU N H sing N N 155 GLU N H2 sing N N 156 GLU CA C sing N N 157 GLU CA CB sing N N 158 GLU CA HA sing N N 159 GLU C O doub N N 160 GLU C OXT sing N N 161 GLU CB CG sing N N 162 GLU CB HB2 sing N N 163 GLU CB HB3 sing N N 164 GLU CG CD sing N N 165 GLU CG HG2 sing N N 166 GLU CG HG3 sing N N 167 GLU CD OE1 doub N N 168 GLU CD OE2 sing N N 169 GLU OE2 HE2 sing N N 170 GLU OXT HXT sing N N 171 GLY N CA sing N N 172 GLY N H sing N N 173 GLY N H2 sing N N 174 GLY CA C sing N N 175 GLY CA HA2 sing N N 176 GLY CA HA3 sing N N 177 GLY C O doub N N 178 GLY C OXT sing N N 179 GLY OXT HXT sing N N 180 HIS N CA sing N N 181 HIS N H sing N N 182 HIS N H2 sing N N 183 HIS CA C sing N N 184 HIS CA CB sing N N 185 HIS CA HA sing N N 186 HIS C O doub N N 187 HIS C OXT sing N N 188 HIS CB CG sing N N 189 HIS CB HB2 sing N N 190 HIS CB HB3 sing N N 191 HIS CG ND1 sing Y N 192 HIS CG CD2 doub Y N 193 HIS ND1 CE1 doub Y N 194 HIS ND1 HD1 sing N N 195 HIS CD2 NE2 sing Y N 196 HIS CD2 HD2 sing N N 197 HIS CE1 NE2 sing Y N 198 HIS CE1 HE1 sing N N 199 HIS NE2 HE2 sing N N 200 HIS OXT HXT sing N N 201 HOH O H1 sing N N 202 HOH O H2 sing N N 203 ILE N CA sing N N 204 ILE N H sing N N 205 ILE N H2 sing N N 206 ILE CA C sing N N 207 ILE CA CB sing N N 208 ILE CA HA sing N N 209 ILE C O doub N N 210 ILE C OXT sing N N 211 ILE CB CG1 sing N N 212 ILE CB CG2 sing N N 213 ILE CB HB sing N N 214 ILE CG1 CD1 sing N N 215 ILE CG1 HG12 sing N N 216 ILE CG1 HG13 sing N N 217 ILE CG2 HG21 sing N N 218 ILE CG2 HG22 sing N N 219 ILE CG2 HG23 sing N N 220 ILE CD1 HD11 sing N N 221 ILE CD1 HD12 sing N N 222 ILE CD1 HD13 sing N N 223 ILE OXT HXT sing N N 224 LEU N CA sing N N 225 LEU N H sing N N 226 LEU N H2 sing N N 227 LEU CA C sing N N 228 LEU CA CB sing N N 229 LEU CA HA sing N N 230 LEU C O doub N N 231 LEU C OXT sing N N 232 LEU CB CG sing N N 233 LEU CB HB2 sing N N 234 LEU CB HB3 sing N N 235 LEU CG CD1 sing N N 236 LEU CG CD2 sing N N 237 LEU CG HG sing N N 238 LEU CD1 HD11 sing N N 239 LEU CD1 HD12 sing N N 240 LEU CD1 HD13 sing N N 241 LEU CD2 HD21 sing N N 242 LEU CD2 HD22 sing N N 243 LEU CD2 HD23 sing N N 244 LEU OXT HXT sing N N 245 LYS N CA sing N N 246 LYS N H sing N N 247 LYS N H2 sing N N 248 LYS CA C sing N N 249 LYS CA CB sing N N 250 LYS CA HA sing N N 251 LYS C O doub N N 252 LYS C OXT sing N N 253 LYS CB CG sing N N 254 LYS CB HB2 sing N N 255 LYS CB HB3 sing N N 256 LYS CG CD sing N N 257 LYS CG HG2 sing N N 258 LYS CG HG3 sing N N 259 LYS CD CE sing N N 260 LYS CD HD2 sing N N 261 LYS CD HD3 sing N N 262 LYS CE NZ sing N N 263 LYS CE HE2 sing N N 264 LYS CE HE3 sing N N 265 LYS NZ HZ1 sing N N 266 LYS NZ HZ2 sing N N 267 LYS NZ HZ3 sing N N 268 LYS OXT HXT sing N N 269 MET N CA sing N N 270 MET N H sing N N 271 MET N H2 sing N N 272 MET CA C sing N N 273 MET CA CB sing N N 274 MET CA HA sing N N 275 MET C O doub N N 276 MET C OXT sing N N 277 MET CB CG sing N N 278 MET CB HB2 sing N N 279 MET CB HB3 sing N N 280 MET CG SD sing N N 281 MET CG HG2 sing N N 282 MET CG HG3 sing N N 283 MET SD CE sing N N 284 MET CE HE1 sing N N 285 MET CE HE2 sing N N 286 MET CE HE3 sing N N 287 MET OXT HXT sing N N 288 PHE N CA sing N N 289 PHE N H sing N N 290 PHE N H2 sing N N 291 PHE CA C sing N N 292 PHE CA CB sing N N 293 PHE CA HA sing N N 294 PHE C O doub N N 295 PHE C OXT sing N N 296 PHE CB CG sing N N 297 PHE CB HB2 sing N N 298 PHE CB HB3 sing N N 299 PHE CG CD1 doub Y N 300 PHE CG CD2 sing Y N 301 PHE CD1 CE1 sing Y N 302 PHE CD1 HD1 sing N N 303 PHE CD2 CE2 doub Y N 304 PHE CD2 HD2 sing N N 305 PHE CE1 CZ doub Y N 306 PHE CE1 HE1 sing N N 307 PHE CE2 CZ sing Y N 308 PHE CE2 HE2 sing N N 309 PHE CZ HZ sing N N 310 PHE OXT HXT sing N N 311 PRO N CA sing N N 312 PRO N CD sing N N 313 PRO N H sing N N 314 PRO CA C sing N N 315 PRO CA CB sing N N 316 PRO CA HA sing N N 317 PRO C O doub N N 318 PRO C OXT sing N N 319 PRO CB CG sing N N 320 PRO CB HB2 sing N N 321 PRO CB HB3 sing N N 322 PRO CG CD sing N N 323 PRO CG HG2 sing N N 324 PRO CG HG3 sing N N 325 PRO CD HD2 sing N N 326 PRO CD HD3 sing N N 327 PRO OXT HXT sing N N 328 SER N CA sing N N 329 SER N H sing N N 330 SER N H2 sing N N 331 SER CA C sing N N 332 SER CA CB sing N N 333 SER CA HA sing N N 334 SER C O doub N N 335 SER C OXT sing N N 336 SER CB OG sing N N 337 SER CB HB2 sing N N 338 SER CB HB3 sing N N 339 SER OG HG sing N N 340 SER OXT HXT sing N N 341 THR N CA sing N N 342 THR N H sing N N 343 THR N H2 sing N N 344 THR CA C sing N N 345 THR CA CB sing N N 346 THR CA HA sing N N 347 THR C O doub N N 348 THR C OXT sing N N 349 THR CB OG1 sing N N 350 THR CB CG2 sing N N 351 THR CB HB sing N N 352 THR OG1 HG1 sing N N 353 THR CG2 HG21 sing N N 354 THR CG2 HG22 sing N N 355 THR CG2 HG23 sing N N 356 THR OXT HXT sing N N 357 TRP N CA sing N N 358 TRP N H sing N N 359 TRP N H2 sing N N 360 TRP CA C sing N N 361 TRP CA CB sing N N 362 TRP CA HA sing N N 363 TRP C O doub N N 364 TRP C OXT sing N N 365 TRP CB CG sing N N 366 TRP CB HB2 sing N N 367 TRP CB HB3 sing N N 368 TRP CG CD1 doub Y N 369 TRP CG CD2 sing Y N 370 TRP CD1 NE1 sing Y N 371 TRP CD1 HD1 sing N N 372 TRP CD2 CE2 doub Y N 373 TRP CD2 CE3 sing Y N 374 TRP NE1 CE2 sing Y N 375 TRP NE1 HE1 sing N N 376 TRP CE2 CZ2 sing Y N 377 TRP CE3 CZ3 doub Y N 378 TRP CE3 HE3 sing N N 379 TRP CZ2 CH2 doub Y N 380 TRP CZ2 HZ2 sing N N 381 TRP CZ3 CH2 sing Y N 382 TRP CZ3 HZ3 sing N N 383 TRP CH2 HH2 sing N N 384 TRP OXT HXT sing N N 385 TYR N CA sing N N 386 TYR N H sing N N 387 TYR N H2 sing N N 388 TYR CA C sing N N 389 TYR CA CB sing N N 390 TYR CA HA sing N N 391 TYR C O doub N N 392 TYR C OXT sing N N 393 TYR CB CG sing N N 394 TYR CB HB2 sing N N 395 TYR CB HB3 sing N N 396 TYR CG CD1 doub Y N 397 TYR CG CD2 sing Y N 398 TYR CD1 CE1 sing Y N 399 TYR CD1 HD1 sing N N 400 TYR CD2 CE2 doub Y N 401 TYR CD2 HD2 sing N N 402 TYR CE1 CZ doub Y N 403 TYR CE1 HE1 sing N N 404 TYR CE2 CZ sing Y N 405 TYR CE2 HE2 sing N N 406 TYR CZ OH sing N N 407 TYR OH HH sing N N 408 TYR OXT HXT sing N N 409 VAL N CA sing N N 410 VAL N H sing N N 411 VAL N H2 sing N N 412 VAL CA C sing N N 413 VAL CA CB sing N N 414 VAL CA HA sing N N 415 VAL C O doub N N 416 VAL C OXT sing N N 417 VAL CB CG1 sing N N 418 VAL CB CG2 sing N N 419 VAL CB HB sing N N 420 VAL CG1 HG11 sing N N 421 VAL CG1 HG12 sing N N 422 VAL CG1 HG13 sing N N 423 VAL CG2 HG21 sing N N 424 VAL CG2 HG22 sing N N 425 VAL CG2 HG23 sing N N 426 VAL OXT HXT sing N N 427 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' R01AI098757 1 ;St. Jude Children's Research Hospital (ALSAC) ; 'United States' ? 2 ;St. Jude Children's Research Hospital (ALSAC) ; 'United States' ? 3 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id 9KU _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id 9KU _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _atom_sites.entry_id 5WCS _atom_sites.fract_transf_matrix[1][1] 0.013393 _atom_sites.fract_transf_matrix[1][2] 0.007732 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015465 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007954 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C MN N O S # loop_