data_5WFY
# 
_entry.id   5WFY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.397 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   5WFY         pdb_00005wfy 10.2210/pdb5wfy/pdb 
WWPDB D_1000228962 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2018-09-26 
2 'Structure model' 2 0 2018-11-14 
3 'Structure model' 2 1 2020-01-01 
4 'Structure model' 3 0 2023-11-15 
5 'Structure model' 3 1 2024-10-23 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Atomic model'               
2 2 'Structure model' 'Data collection'            
3 2 'Structure model' 'Database references'        
4 3 'Structure model' 'Author supporting evidence' 
5 4 'Structure model' 'Atomic model'               
6 4 'Structure model' 'Data collection'            
7 4 'Structure model' 'Database references'        
8 5 'Structure model' 'Structure summary'          
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' atom_site                 
2 2 'Structure model' citation                  
3 3 'Structure model' pdbx_audit_support        
4 4 'Structure model' atom_site                 
5 4 'Structure model' chem_comp_atom            
6 4 'Structure model' chem_comp_bond            
7 4 'Structure model' database_2                
8 5 'Structure model' pdbx_entry_details        
9 5 'Structure model' pdbx_modification_feature 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_atom_site.B_iso_or_equiv'                
2  2 'Structure model' '_atom_site.Cartn_x'                       
3  2 'Structure model' '_atom_site.Cartn_y'                       
4  2 'Structure model' '_atom_site.Cartn_z'                       
5  2 'Structure model' '_atom_site.auth_atom_id'                  
6  2 'Structure model' '_atom_site.label_atom_id'                 
7  2 'Structure model' '_citation.journal_volume'                 
8  2 'Structure model' '_citation.page_first'                     
9  2 'Structure model' '_citation.page_last'                      
10 3 'Structure model' '_pdbx_audit_support.funding_organization' 
11 4 'Structure model' '_atom_site.Cartn_x'                       
12 4 'Structure model' '_atom_site.Cartn_y'                       
13 4 'Structure model' '_atom_site.Cartn_z'                       
14 4 'Structure model' '_atom_site.auth_atom_id'                  
15 4 'Structure model' '_atom_site.label_atom_id'                 
16 4 'Structure model' '_database_2.pdbx_DOI'                     
17 4 'Structure model' '_database_2.pdbx_database_accession'      
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5WFY 
_pdbx_database_status.recvd_initial_deposition_date   2017-07-13 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Shi, K.'    1 0000-0003-4175-3714 
'Aihara, H.' 2 ?                   
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_id_ASTM           NARHAD 
_citation.journal_id_CSD            0389 
_citation.journal_id_ISSN           1362-4962 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            46 
_citation.language                  ? 
_citation.page_first                10474 
_citation.page_last                 10488 
_citation.title                     
'T4 DNA ligase structure reveals a prototypical ATP-dependent ligase with a unique mode of sliding clamp interaction.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1093/nar/gky776 
_citation.pdbx_database_id_PubMed   30169742 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Shi, K.'       1  ? 
primary 'Bohl, T.E.'    2  ? 
primary 'Park, J.'      3  ? 
primary 'Zasada, A.'    4  ? 
primary 'Malik, S.'     5  ? 
primary 'Banerjee, S.'  6  ? 
primary 'Tran, V.'      7  ? 
primary 'Li, N.'        8  ? 
primary 'Yin, Z.'       9  ? 
primary 'Kurniawan, F.' 10 ? 
primary 'Orellana, K.'  11 ? 
primary 'Aihara, H.'    12 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA ligase' 15857.651 1   6.5.1.1 ? 'DNA binding domain (UNP residues 1-129)' ? 
2 non-polymer syn GLYCEROL     92.094    1   ?       ? ?                                         ? 
3 water       nat water        18.015    128 ?       ? ?                                         ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Polydeoxyribonucleotide synthase [ATP]' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;(MSE)ILKILNEIASIGSTKQKQAILEKNKDNELLKRVYRLTYSRGLQYYIKKWPKPGIATQSFG(MSE)LTLTD(MSE)
LDFIEFTLATRKLTGNAAIEELTGYITDGKKDDVEVLRRV(MSE)(MSE)RDLECGASVSIANKVWPGLEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MILKILNEIASIGSTKQKQAILEKNKDNELLKRVYRLTYSRGLQYYIKKWPKPGIATQSFGMLTLTDMLDFIEFTLATRK
LTGNAAIEELTGYITDGKKDDVEVLRRVMMRDLECGASVSIANKVWPGLEHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 GLYCEROL GOL 
3 water    HOH 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MSE n 
1 2   ILE n 
1 3   LEU n 
1 4   LYS n 
1 5   ILE n 
1 6   LEU n 
1 7   ASN n 
1 8   GLU n 
1 9   ILE n 
1 10  ALA n 
1 11  SER n 
1 12  ILE n 
1 13  GLY n 
1 14  SER n 
1 15  THR n 
1 16  LYS n 
1 17  GLN n 
1 18  LYS n 
1 19  GLN n 
1 20  ALA n 
1 21  ILE n 
1 22  LEU n 
1 23  GLU n 
1 24  LYS n 
1 25  ASN n 
1 26  LYS n 
1 27  ASP n 
1 28  ASN n 
1 29  GLU n 
1 30  LEU n 
1 31  LEU n 
1 32  LYS n 
1 33  ARG n 
1 34  VAL n 
1 35  TYR n 
1 36  ARG n 
1 37  LEU n 
1 38  THR n 
1 39  TYR n 
1 40  SER n 
1 41  ARG n 
1 42  GLY n 
1 43  LEU n 
1 44  GLN n 
1 45  TYR n 
1 46  TYR n 
1 47  ILE n 
1 48  LYS n 
1 49  LYS n 
1 50  TRP n 
1 51  PRO n 
1 52  LYS n 
1 53  PRO n 
1 54  GLY n 
1 55  ILE n 
1 56  ALA n 
1 57  THR n 
1 58  GLN n 
1 59  SER n 
1 60  PHE n 
1 61  GLY n 
1 62  MSE n 
1 63  LEU n 
1 64  THR n 
1 65  LEU n 
1 66  THR n 
1 67  ASP n 
1 68  MSE n 
1 69  LEU n 
1 70  ASP n 
1 71  PHE n 
1 72  ILE n 
1 73  GLU n 
1 74  PHE n 
1 75  THR n 
1 76  LEU n 
1 77  ALA n 
1 78  THR n 
1 79  ARG n 
1 80  LYS n 
1 81  LEU n 
1 82  THR n 
1 83  GLY n 
1 84  ASN n 
1 85  ALA n 
1 86  ALA n 
1 87  ILE n 
1 88  GLU n 
1 89  GLU n 
1 90  LEU n 
1 91  THR n 
1 92  GLY n 
1 93  TYR n 
1 94  ILE n 
1 95  THR n 
1 96  ASP n 
1 97  GLY n 
1 98  LYS n 
1 99  LYS n 
1 100 ASP n 
1 101 ASP n 
1 102 VAL n 
1 103 GLU n 
1 104 VAL n 
1 105 LEU n 
1 106 ARG n 
1 107 ARG n 
1 108 VAL n 
1 109 MSE n 
1 110 MSE n 
1 111 ARG n 
1 112 ASP n 
1 113 LEU n 
1 114 GLU n 
1 115 CYS n 
1 116 GLY n 
1 117 ALA n 
1 118 SER n 
1 119 VAL n 
1 120 SER n 
1 121 ILE n 
1 122 ALA n 
1 123 ASN n 
1 124 LYS n 
1 125 VAL n 
1 126 TRP n 
1 127 PRO n 
1 128 GLY n 
1 129 LEU n 
1 130 GLU n 
1 131 HIS n 
1 132 HIS n 
1 133 HIS n 
1 134 HIS n 
1 135 HIS n 
1 136 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   136 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 30 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Enterobacteria phage T4' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10665 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE         ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE        ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL         'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE        ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER            ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE       ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ?                               'C6 H15 N2 O2 1' 147.195 
MSE 'L-peptide linking' n SELENOMETHIONINE ?                               'C5 H11 N O2 Se' 196.106 
PHE 'L-peptide linking' y PHENYLALANINE    ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE        ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN       ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE         ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ?                               'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MSE 1   1   1   MSE MSE A . n 
A 1 2   ILE 2   2   2   ILE ILE A . n 
A 1 3   LEU 3   3   3   LEU LEU A . n 
A 1 4   LYS 4   4   4   LYS LYS A . n 
A 1 5   ILE 5   5   5   ILE ILE A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   ASN 7   7   7   ASN ASN A . n 
A 1 8   GLU 8   8   8   GLU GLU A . n 
A 1 9   ILE 9   9   9   ILE ILE A . n 
A 1 10  ALA 10  10  10  ALA ALA A . n 
A 1 11  SER 11  11  11  SER SER A . n 
A 1 12  ILE 12  12  12  ILE ILE A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  SER 14  14  14  SER SER A . n 
A 1 15  THR 15  15  15  THR THR A . n 
A 1 16  LYS 16  16  16  LYS LYS A . n 
A 1 17  GLN 17  17  17  GLN GLN A . n 
A 1 18  LYS 18  18  18  LYS LYS A . n 
A 1 19  GLN 19  19  19  GLN GLN A . n 
A 1 20  ALA 20  20  20  ALA ALA A . n 
A 1 21  ILE 21  21  21  ILE ILE A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  GLU 23  23  23  GLU GLU A . n 
A 1 24  LYS 24  24  24  LYS LYS A . n 
A 1 25  ASN 25  25  25  ASN ASN A . n 
A 1 26  LYS 26  26  26  LYS LYS A . n 
A 1 27  ASP 27  27  27  ASP ASP A . n 
A 1 28  ASN 28  28  28  ASN ASN A . n 
A 1 29  GLU 29  29  29  GLU GLU A . n 
A 1 30  LEU 30  30  30  LEU LEU A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  LYS 32  32  32  LYS LYS A . n 
A 1 33  ARG 33  33  33  ARG ARG A . n 
A 1 34  VAL 34  34  34  VAL VAL A . n 
A 1 35  TYR 35  35  35  TYR TYR A . n 
A 1 36  ARG 36  36  36  ARG ARG A . n 
A 1 37  LEU 37  37  37  LEU LEU A . n 
A 1 38  THR 38  38  38  THR THR A . n 
A 1 39  TYR 39  39  39  TYR TYR A . n 
A 1 40  SER 40  40  40  SER SER A . n 
A 1 41  ARG 41  41  41  ARG ARG A . n 
A 1 42  GLY 42  42  42  GLY GLY A . n 
A 1 43  LEU 43  43  43  LEU LEU A . n 
A 1 44  GLN 44  44  44  GLN GLN A . n 
A 1 45  TYR 45  45  45  TYR TYR A . n 
A 1 46  TYR 46  46  46  TYR TYR A . n 
A 1 47  ILE 47  47  47  ILE ILE A . n 
A 1 48  LYS 48  48  48  LYS LYS A . n 
A 1 49  LYS 49  49  49  LYS LYS A . n 
A 1 50  TRP 50  50  50  TRP TRP A . n 
A 1 51  PRO 51  51  51  PRO PRO A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  PRO 53  53  53  PRO PRO A . n 
A 1 54  GLY 54  54  54  GLY GLY A . n 
A 1 55  ILE 55  55  55  ILE ILE A . n 
A 1 56  ALA 56  56  56  ALA ALA A . n 
A 1 57  THR 57  57  57  THR THR A . n 
A 1 58  GLN 58  58  58  GLN GLN A . n 
A 1 59  SER 59  59  59  SER SER A . n 
A 1 60  PHE 60  60  60  PHE PHE A . n 
A 1 61  GLY 61  61  61  GLY GLY A . n 
A 1 62  MSE 62  62  62  MSE MSE A . n 
A 1 63  LEU 63  63  63  LEU LEU A . n 
A 1 64  THR 64  64  64  THR THR A . n 
A 1 65  LEU 65  65  65  LEU LEU A . n 
A 1 66  THR 66  66  66  THR THR A . n 
A 1 67  ASP 67  67  67  ASP ASP A . n 
A 1 68  MSE 68  68  68  MSE MSE A . n 
A 1 69  LEU 69  69  69  LEU LEU A . n 
A 1 70  ASP 70  70  70  ASP ASP A . n 
A 1 71  PHE 71  71  71  PHE PHE A . n 
A 1 72  ILE 72  72  72  ILE ILE A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  PHE 74  74  74  PHE PHE A . n 
A 1 75  THR 75  75  75  THR THR A . n 
A 1 76  LEU 76  76  76  LEU LEU A . n 
A 1 77  ALA 77  77  77  ALA ALA A . n 
A 1 78  THR 78  78  78  THR THR A . n 
A 1 79  ARG 79  79  79  ARG ARG A . n 
A 1 80  LYS 80  80  80  LYS LYS A . n 
A 1 81  LEU 81  81  81  LEU LEU A . n 
A 1 82  THR 82  82  82  THR THR A . n 
A 1 83  GLY 83  83  83  GLY GLY A . n 
A 1 84  ASN 84  84  84  ASN ASN A . n 
A 1 85  ALA 85  85  85  ALA ALA A . n 
A 1 86  ALA 86  86  86  ALA ALA A . n 
A 1 87  ILE 87  87  87  ILE ILE A . n 
A 1 88  GLU 88  88  88  GLU GLU A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  LEU 90  90  90  LEU LEU A . n 
A 1 91  THR 91  91  91  THR THR A . n 
A 1 92  GLY 92  92  92  GLY GLY A . n 
A 1 93  TYR 93  93  93  TYR TYR A . n 
A 1 94  ILE 94  94  94  ILE ILE A . n 
A 1 95  THR 95  95  95  THR THR A . n 
A 1 96  ASP 96  96  96  ASP ASP A . n 
A 1 97  GLY 97  97  97  GLY GLY A . n 
A 1 98  LYS 98  98  98  LYS LYS A . n 
A 1 99  LYS 99  99  99  LYS LYS A . n 
A 1 100 ASP 100 100 100 ASP ASP A . n 
A 1 101 ASP 101 101 101 ASP ASP A . n 
A 1 102 VAL 102 102 102 VAL VAL A . n 
A 1 103 GLU 103 103 103 GLU GLU A . n 
A 1 104 VAL 104 104 104 VAL VAL A . n 
A 1 105 LEU 105 105 105 LEU LEU A . n 
A 1 106 ARG 106 106 106 ARG ARG A . n 
A 1 107 ARG 107 107 107 ARG ARG A . n 
A 1 108 VAL 108 108 108 VAL VAL A . n 
A 1 109 MSE 109 109 109 MSE MSE A . n 
A 1 110 MSE 110 110 110 MSE MSE A . n 
A 1 111 ARG 111 111 111 ARG ARG A . n 
A 1 112 ASP 112 112 112 ASP ASP A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 GLU 114 114 114 GLU GLU A . n 
A 1 115 CYS 115 115 115 CYS CYS A . n 
A 1 116 GLY 116 116 116 GLY GLY A . n 
A 1 117 ALA 117 117 117 ALA ALA A . n 
A 1 118 SER 118 118 118 SER SER A . n 
A 1 119 VAL 119 119 119 VAL VAL A . n 
A 1 120 SER 120 120 120 SER SER A . n 
A 1 121 ILE 121 121 121 ILE ILE A . n 
A 1 122 ALA 122 122 122 ALA ALA A . n 
A 1 123 ASN 123 123 123 ASN ASN A . n 
A 1 124 LYS 124 124 124 LYS LYS A . n 
A 1 125 VAL 125 125 125 VAL VAL A . n 
A 1 126 TRP 126 126 126 TRP TRP A . n 
A 1 127 PRO 127 127 127 PRO PRO A . n 
A 1 128 GLY 128 128 128 GLY GLY A . n 
A 1 129 LEU 129 129 129 LEU LEU A . n 
A 1 130 GLU 130 130 130 GLU GLU A . n 
A 1 131 HIS 131 131 131 HIS HIS A . n 
A 1 132 HIS 132 132 132 HIS HIS A . n 
A 1 133 HIS 133 133 ?   ?   ?   A . n 
A 1 134 HIS 134 134 ?   ?   ?   A . n 
A 1 135 HIS 135 135 ?   ?   ?   A . n 
A 1 136 HIS 136 136 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 GOL 1   201 1   GOL GOL A . 
C 3 HOH 1   301 107 HOH HOH A . 
C 3 HOH 2   302 63  HOH HOH A . 
C 3 HOH 3   303 75  HOH HOH A . 
C 3 HOH 4   304 44  HOH HOH A . 
C 3 HOH 5   305 130 HOH HOH A . 
C 3 HOH 6   306 66  HOH HOH A . 
C 3 HOH 7   307 36  HOH HOH A . 
C 3 HOH 8   308 16  HOH HOH A . 
C 3 HOH 9   309 28  HOH HOH A . 
C 3 HOH 10  310 120 HOH HOH A . 
C 3 HOH 11  311 133 HOH HOH A . 
C 3 HOH 12  312 128 HOH HOH A . 
C 3 HOH 13  313 87  HOH HOH A . 
C 3 HOH 14  314 67  HOH HOH A . 
C 3 HOH 15  315 104 HOH HOH A . 
C 3 HOH 16  316 41  HOH HOH A . 
C 3 HOH 17  317 132 HOH HOH A . 
C 3 HOH 18  318 59  HOH HOH A . 
C 3 HOH 19  319 90  HOH HOH A . 
C 3 HOH 20  320 83  HOH HOH A . 
C 3 HOH 21  321 3   HOH HOH A . 
C 3 HOH 22  322 100 HOH HOH A . 
C 3 HOH 23  323 55  HOH HOH A . 
C 3 HOH 24  324 14  HOH HOH A . 
C 3 HOH 25  325 97  HOH HOH A . 
C 3 HOH 26  326 38  HOH HOH A . 
C 3 HOH 27  327 22  HOH HOH A . 
C 3 HOH 28  328 2   HOH HOH A . 
C 3 HOH 29  329 15  HOH HOH A . 
C 3 HOH 30  330 86  HOH HOH A . 
C 3 HOH 31  331 9   HOH HOH A . 
C 3 HOH 32  332 42  HOH HOH A . 
C 3 HOH 33  333 10  HOH HOH A . 
C 3 HOH 34  334 123 HOH HOH A . 
C 3 HOH 35  335 109 HOH HOH A . 
C 3 HOH 36  336 17  HOH HOH A . 
C 3 HOH 37  337 6   HOH HOH A . 
C 3 HOH 38  338 93  HOH HOH A . 
C 3 HOH 39  339 12  HOH HOH A . 
C 3 HOH 40  340 69  HOH HOH A . 
C 3 HOH 41  341 72  HOH HOH A . 
C 3 HOH 42  342 81  HOH HOH A . 
C 3 HOH 43  343 101 HOH HOH A . 
C 3 HOH 44  344 71  HOH HOH A . 
C 3 HOH 45  345 23  HOH HOH A . 
C 3 HOH 46  346 43  HOH HOH A . 
C 3 HOH 47  347 46  HOH HOH A . 
C 3 HOH 48  348 31  HOH HOH A . 
C 3 HOH 49  349 8   HOH HOH A . 
C 3 HOH 50  350 119 HOH HOH A . 
C 3 HOH 51  351 85  HOH HOH A . 
C 3 HOH 52  352 24  HOH HOH A . 
C 3 HOH 53  353 52  HOH HOH A . 
C 3 HOH 54  354 76  HOH HOH A . 
C 3 HOH 55  355 126 HOH HOH A . 
C 3 HOH 56  356 19  HOH HOH A . 
C 3 HOH 57  357 84  HOH HOH A . 
C 3 HOH 58  358 105 HOH HOH A . 
C 3 HOH 59  359 94  HOH HOH A . 
C 3 HOH 60  360 20  HOH HOH A . 
C 3 HOH 61  361 5   HOH HOH A . 
C 3 HOH 62  362 30  HOH HOH A . 
C 3 HOH 63  363 103 HOH HOH A . 
C 3 HOH 64  364 53  HOH HOH A . 
C 3 HOH 65  365 95  HOH HOH A . 
C 3 HOH 66  366 106 HOH HOH A . 
C 3 HOH 67  367 48  HOH HOH A . 
C 3 HOH 68  368 117 HOH HOH A . 
C 3 HOH 69  369 4   HOH HOH A . 
C 3 HOH 70  370 70  HOH HOH A . 
C 3 HOH 71  371 58  HOH HOH A . 
C 3 HOH 72  372 45  HOH HOH A . 
C 3 HOH 73  373 134 HOH HOH A . 
C 3 HOH 74  374 37  HOH HOH A . 
C 3 HOH 75  375 111 HOH HOH A . 
C 3 HOH 76  376 1   HOH HOH A . 
C 3 HOH 77  377 62  HOH HOH A . 
C 3 HOH 78  378 65  HOH HOH A . 
C 3 HOH 79  379 35  HOH HOH A . 
C 3 HOH 80  380 13  HOH HOH A . 
C 3 HOH 81  381 39  HOH HOH A . 
C 3 HOH 82  382 96  HOH HOH A . 
C 3 HOH 83  383 99  HOH HOH A . 
C 3 HOH 84  384 64  HOH HOH A . 
C 3 HOH 85  385 26  HOH HOH A . 
C 3 HOH 86  386 11  HOH HOH A . 
C 3 HOH 87  387 27  HOH HOH A . 
C 3 HOH 88  388 51  HOH HOH A . 
C 3 HOH 89  389 29  HOH HOH A . 
C 3 HOH 90  390 88  HOH HOH A . 
C 3 HOH 91  391 114 HOH HOH A . 
C 3 HOH 92  392 110 HOH HOH A . 
C 3 HOH 93  393 56  HOH HOH A . 
C 3 HOH 94  394 40  HOH HOH A . 
C 3 HOH 95  395 127 HOH HOH A . 
C 3 HOH 96  396 113 HOH HOH A . 
C 3 HOH 97  397 49  HOH HOH A . 
C 3 HOH 98  398 33  HOH HOH A . 
C 3 HOH 99  399 34  HOH HOH A . 
C 3 HOH 100 400 60  HOH HOH A . 
C 3 HOH 101 401 50  HOH HOH A . 
C 3 HOH 102 402 25  HOH HOH A . 
C 3 HOH 103 403 73  HOH HOH A . 
C 3 HOH 104 404 108 HOH HOH A . 
C 3 HOH 105 405 82  HOH HOH A . 
C 3 HOH 106 406 21  HOH HOH A . 
C 3 HOH 107 407 78  HOH HOH A . 
C 3 HOH 108 408 102 HOH HOH A . 
C 3 HOH 109 409 91  HOH HOH A . 
C 3 HOH 110 410 115 HOH HOH A . 
C 3 HOH 111 411 118 HOH HOH A . 
C 3 HOH 112 412 80  HOH HOH A . 
C 3 HOH 113 413 68  HOH HOH A . 
C 3 HOH 114 414 89  HOH HOH A . 
C 3 HOH 115 415 92  HOH HOH A . 
C 3 HOH 116 416 131 HOH HOH A . 
C 3 HOH 117 417 116 HOH HOH A . 
C 3 HOH 118 418 54  HOH HOH A . 
C 3 HOH 119 419 124 HOH HOH A . 
C 3 HOH 120 420 47  HOH HOH A . 
C 3 HOH 121 421 112 HOH HOH A . 
C 3 HOH 122 422 77  HOH HOH A . 
C 3 HOH 123 423 74  HOH HOH A . 
C 3 HOH 124 424 122 HOH HOH A . 
C 3 HOH 125 425 57  HOH HOH A . 
C 3 HOH 126 426 121 HOH HOH A . 
C 3 HOH 127 427 79  HOH HOH A . 
C 3 HOH 128 428 125 HOH HOH A . 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.12_2829 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .         2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? .         3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? SHELXD ? ? ? .         4 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   92.35 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5WFY 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     28.811 
_cell.length_a_esd                 ? 
_cell.length_b                     40.801 
_cell.length_b_esd                 ? 
_cell.length_c                     51.072 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        2 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5WFY 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5WFY 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            1.92 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         35.93 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    PEG3350 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-06-22 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 24-ID-E' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.979 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-E 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5WFY 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.40 
_reflns.d_resolution_low                 51.03 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       23239 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       0 
_reflns.observed_criterion_sigma_I       0 
_reflns.percent_possible_obs             98.9 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.7 
_reflns.pdbx_Rmerge_I_obs                0.095 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.095 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            16.3 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.997 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.40 
_reflns_shell.d_res_low                   1.48 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.3 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           3313 
_reflns_shell.percent_possible_all        97.5 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                1.346 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             7.5 
_reflns_shell.pdbx_Rsym_value             1.346 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5WFY 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.400 
_refine.ls_d_res_low                             51.029 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     23228 
_refine.ls_number_reflns_R_free                  2308 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    98.75 
_refine.ls_percent_reflns_R_free                 5.10 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1443 
_refine.ls_R_factor_R_free                       0.1815 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1423 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            Random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 18.36 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.18 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1055 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         6 
_refine_hist.number_atoms_solvent             128 
_refine_hist.number_atoms_total               1189 
_refine_hist.d_res_high                       1.400 
_refine_hist.d_res_low                        51.029 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.007  ? 1085 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.862  ? 1458 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 12.805 ? 418  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.072  ? 167  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.005  ? 180  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.4002 1.4306  . . 160 2626 97.00  . . . 0.3322 . 0.3032 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.4306 1.4639  . . 130 2643 97.00  . . . 0.3951 . 0.2621 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.4639 1.5005  . . 128 2729 98.00  . . . 0.3012 . 0.2458 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.5005 1.5411  . . 156 2602 98.00  . . . 0.2489 . 0.2127 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.5411 1.5864  . . 161 2623 98.00  . . . 0.2228 . 0.1988 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.5864 1.6376  . . 131 2714 98.00  . . . 0.2393 . 0.1887 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.6376 1.6962  . . 124 2712 99.00  . . . 0.2421 . 0.1706 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.6962 1.7641  . . 139 2697 99.00  . . . 0.1953 . 0.1476 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.7641 1.8444  . . 161 2675 99.00  . . . 0.1945 . 0.1341 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.8444 1.9416  . . 133 2672 99.00  . . . 0.1850 . 0.1113 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9416 2.0633  . . 150 2717 100.00 . . . 0.1741 . 0.1073 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0633 2.2226  . . 134 2707 100.00 . . . 0.1850 . 0.1067 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2226 2.4462  . . 151 2688 100.00 . . . 0.1490 . 0.1081 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4462 2.8002  . . 132 2713 100.00 . . . 0.1793 . 0.1230 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8002 3.5278  . . 166 2705 100.00 . . . 0.1410 . 0.1293 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5278 51.0629 . . 152 2689 100.00 . . . 0.1453 . 0.1455 . . . . . . . . . . 
# 
_struct.entry_id                     5WFY 
_struct.title                        'Crystal structure of DNA-binding domain of the bacteriophage T4 ligase' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5WFY 
_struct_keywords.text            'LIGASE-DNA COMPLEX, LIGASE' 
_struct_keywords.pdbx_keywords   LIGASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    DNLI_BPT4 
_struct_ref.pdbx_db_accession          P00970 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MILKILNEIASIGSTKQKQAILEKNKDNELLKRVYRLTYSRGLQYYIKKWPKPGIATQSFGMLTLTDMLDFIEFTLATRK
LTGNAAIEELTGYITDGKKDDVEVLRRVMMRDLECGASVSIANKVWPGL
;
_struct_ref.pdbx_align_begin           1 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              5WFY 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 129 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P00970 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  129 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       129 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5WFY GLU A 130 ? UNP P00970 ? ? 'expression tag' 130 1 
1 5WFY HIS A 131 ? UNP P00970 ? ? 'expression tag' 131 2 
1 5WFY HIS A 132 ? UNP P00970 ? ? 'expression tag' 132 3 
1 5WFY HIS A 133 ? UNP P00970 ? ? 'expression tag' 133 4 
1 5WFY HIS A 134 ? UNP P00970 ? ? 'expression tag' 134 5 
1 5WFY HIS A 135 ? UNP P00970 ? ? 'expression tag' 135 6 
1 5WFY HIS A 136 ? UNP P00970 ? ? 'expression tag' 136 7 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'native gel electrophoresis' 
_pdbx_struct_assembly_auth_evidence.details                ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 MSE A 1   ? SER A 11  ? MSE A 1   SER A 11  1 ? 11 
HELX_P HELX_P2 AA2 SER A 14  ? ASN A 25  ? SER A 14  ASN A 25  1 ? 12 
HELX_P HELX_P3 AA3 ASN A 28  ? SER A 40  ? ASN A 28  SER A 40  1 ? 13 
HELX_P HELX_P4 AA4 THR A 64  ? THR A 75  ? THR A 64  THR A 75  1 ? 12 
HELX_P HELX_P5 AA5 THR A 82  ? GLY A 97  ? THR A 82  GLY A 97  1 ? 16 
HELX_P HELX_P6 AA6 LYS A 98  ? ARG A 111 ? LYS A 98  ARG A 111 1 ? 14 
HELX_P HELX_P7 AA7 SER A 118 ? TRP A 126 ? SER A 118 TRP A 126 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1  covale both ? A MSE 1   C ? ? ? 1_555 A ILE 2   N ? ? A MSE 1   A ILE 2   1_555 ? ? ? ? ? ? ? 1.322 ? ? 
covale2  covale both ? A GLY 61  C ? ? ? 1_555 A MSE 62  N ? ? A GLY 61  A MSE 62  1_555 ? ? ? ? ? ? ? 1.332 ? ? 
covale3  covale both ? A MSE 62  C ? ? ? 1_555 A LEU 63  N ? ? A MSE 62  A LEU 63  1_555 ? ? ? ? ? ? ? 1.325 ? ? 
covale4  covale both ? A ASP 67  C ? ? ? 1_555 A MSE 68  N ? ? A ASP 67  A MSE 68  1_555 ? ? ? ? ? ? ? 1.320 ? ? 
covale5  covale both ? A MSE 68  C ? ? ? 1_555 A LEU 69  N ? ? A MSE 68  A LEU 69  1_555 ? ? ? ? ? ? ? 1.334 ? ? 
covale6  covale both ? A VAL 108 C ? ? ? 1_555 A MSE 109 N A ? A VAL 108 A MSE 109 1_555 ? ? ? ? ? ? ? 1.328 ? ? 
covale7  covale both ? A VAL 108 C ? ? ? 1_555 A MSE 109 N B ? A VAL 108 A MSE 109 1_555 ? ? ? ? ? ? ? 1.324 ? ? 
covale8  covale both ? A MSE 109 C A ? ? 1_555 A MSE 110 N ? ? A MSE 109 A MSE 110 1_555 ? ? ? ? ? ? ? 1.329 ? ? 
covale9  covale both ? A MSE 109 C B ? ? 1_555 A MSE 110 N ? ? A MSE 109 A MSE 110 1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale10 covale both ? A MSE 110 C ? ? ? 1_555 A ARG 111 N ? ? A MSE 110 A ARG 111 1_555 ? ? ? ? ? ? ? 1.337 ? ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_modification_feature.ordinal 
_pdbx_modification_feature.label_comp_id 
_pdbx_modification_feature.label_asym_id 
_pdbx_modification_feature.label_seq_id 
_pdbx_modification_feature.label_alt_id 
_pdbx_modification_feature.modified_residue_label_comp_id 
_pdbx_modification_feature.modified_residue_label_asym_id 
_pdbx_modification_feature.modified_residue_label_seq_id 
_pdbx_modification_feature.modified_residue_label_alt_id 
_pdbx_modification_feature.auth_comp_id 
_pdbx_modification_feature.auth_asym_id 
_pdbx_modification_feature.auth_seq_id 
_pdbx_modification_feature.PDB_ins_code 
_pdbx_modification_feature.symmetry 
_pdbx_modification_feature.modified_residue_auth_comp_id 
_pdbx_modification_feature.modified_residue_auth_asym_id 
_pdbx_modification_feature.modified_residue_auth_seq_id 
_pdbx_modification_feature.modified_residue_PDB_ins_code 
_pdbx_modification_feature.modified_residue_symmetry 
_pdbx_modification_feature.comp_id_linking_atom 
_pdbx_modification_feature.modified_residue_id_linking_atom 
_pdbx_modification_feature.modified_residue_id 
_pdbx_modification_feature.ref_pcm_id 
_pdbx_modification_feature.ref_comp_id 
_pdbx_modification_feature.type 
_pdbx_modification_feature.category 
1 MSE A 1   ? . . . . MSE A 1   ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 
2 MSE A 62  ? . . . . MSE A 62  ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 
3 MSE A 68  ? . . . . MSE A 68  ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 
4 MSE A 109 A . . . . MSE A 109 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 
5 MSE A 109 B . . . . MSE A 109 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 
6 MSE A 110 ? . . . . MSE A 110 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    GOL 
_struct_site.pdbx_auth_seq_id     201 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    6 
_struct_site.details              'binding site for residue GOL A 201' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 6 GLN A 44  ? GLN A 44  . ? 1_555 ? 
2 AC1 6 TYR A 45  ? TYR A 45  . ? 1_555 ? 
3 AC1 6 TYR A 46  ? TYR A 46  . ? 1_555 ? 
4 AC1 6 ARG A 111 ? ARG A 111 . ? 1_555 ? 
5 AC1 6 HOH C .   ? HOH A 314 . ? 1_555 ? 
6 AC1 6 HOH C .   ? HOH A 321 . ? 1_555 ? 
# 
_pdbx_entry_details.entry_id                   5WFY 
_pdbx_entry_details.compound_details           ? 
_pdbx_entry_details.source_details             ? 
_pdbx_entry_details.nonpolymer_details         ? 
_pdbx_entry_details.sequence_details           ? 
_pdbx_entry_details.has_ligand_of_interest     ? 
_pdbx_entry_details.has_protein_modification   Y 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O A HOH 396 ? ? O A HOH 419 ? ? 1.83 
2 1 O A HOH 358 ? ? O A HOH 409 ? ? 1.99 
3 1 O A HOH 332 ? ? O A HOH 358 ? ? 2.17 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 HZ2 A LYS 16  ? ? 1_555 O   A HOH 362 ? ? 1_545 1.56 
2 1 O   A HOH 307 ? ? 1_555 O   A HOH 358 ? ? 1_655 2.00 
3 1 O   A LYS 24  ? ? 1_555 NH2 A ARG 41  ? ? 1_455 2.19 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    SER 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     118 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -108.69 
_pdbx_validate_torsion.psi             -151.42 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A MSE 1   A MSE 1   ? MET 'modified residue' 
2 A MSE 62  A MSE 62  ? MET 'modified residue' 
3 A MSE 68  A MSE 68  ? MET 'modified residue' 
4 A MSE 109 A MSE 109 ? MET 'modified residue' 
5 A MSE 110 A MSE 110 ? MET 'modified residue' 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A HIS 133 ? A HIS 133 
2 1 Y 1 A HIS 134 ? A HIS 134 
3 1 Y 1 A HIS 135 ? A HIS 135 
4 1 Y 1 A HIS 136 ? A HIS 136 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N  N N 1   
ALA CA   C  N S 2   
ALA C    C  N N 3   
ALA O    O  N N 4   
ALA CB   C  N N 5   
ALA OXT  O  N N 6   
ALA H    H  N N 7   
ALA H2   H  N N 8   
ALA HA   H  N N 9   
ALA HB1  H  N N 10  
ALA HB2  H  N N 11  
ALA HB3  H  N N 12  
ALA HXT  H  N N 13  
ARG N    N  N N 14  
ARG CA   C  N S 15  
ARG C    C  N N 16  
ARG O    O  N N 17  
ARG CB   C  N N 18  
ARG CG   C  N N 19  
ARG CD   C  N N 20  
ARG NE   N  N N 21  
ARG CZ   C  N N 22  
ARG NH1  N  N N 23  
ARG NH2  N  N N 24  
ARG OXT  O  N N 25  
ARG H    H  N N 26  
ARG H2   H  N N 27  
ARG HA   H  N N 28  
ARG HB2  H  N N 29  
ARG HB3  H  N N 30  
ARG HG2  H  N N 31  
ARG HG3  H  N N 32  
ARG HD2  H  N N 33  
ARG HD3  H  N N 34  
ARG HE   H  N N 35  
ARG HH11 H  N N 36  
ARG HH12 H  N N 37  
ARG HH21 H  N N 38  
ARG HH22 H  N N 39  
ARG HXT  H  N N 40  
ASN N    N  N N 41  
ASN CA   C  N S 42  
ASN C    C  N N 43  
ASN O    O  N N 44  
ASN CB   C  N N 45  
ASN CG   C  N N 46  
ASN OD1  O  N N 47  
ASN ND2  N  N N 48  
ASN OXT  O  N N 49  
ASN H    H  N N 50  
ASN H2   H  N N 51  
ASN HA   H  N N 52  
ASN HB2  H  N N 53  
ASN HB3  H  N N 54  
ASN HD21 H  N N 55  
ASN HD22 H  N N 56  
ASN HXT  H  N N 57  
ASP N    N  N N 58  
ASP CA   C  N S 59  
ASP C    C  N N 60  
ASP O    O  N N 61  
ASP CB   C  N N 62  
ASP CG   C  N N 63  
ASP OD1  O  N N 64  
ASP OD2  O  N N 65  
ASP OXT  O  N N 66  
ASP H    H  N N 67  
ASP H2   H  N N 68  
ASP HA   H  N N 69  
ASP HB2  H  N N 70  
ASP HB3  H  N N 71  
ASP HD2  H  N N 72  
ASP HXT  H  N N 73  
CYS N    N  N N 74  
CYS CA   C  N R 75  
CYS C    C  N N 76  
CYS O    O  N N 77  
CYS CB   C  N N 78  
CYS SG   S  N N 79  
CYS OXT  O  N N 80  
CYS H    H  N N 81  
CYS H2   H  N N 82  
CYS HA   H  N N 83  
CYS HB2  H  N N 84  
CYS HB3  H  N N 85  
CYS HG   H  N N 86  
CYS HXT  H  N N 87  
GLN N    N  N N 88  
GLN CA   C  N S 89  
GLN C    C  N N 90  
GLN O    O  N N 91  
GLN CB   C  N N 92  
GLN CG   C  N N 93  
GLN CD   C  N N 94  
GLN OE1  O  N N 95  
GLN NE2  N  N N 96  
GLN OXT  O  N N 97  
GLN H    H  N N 98  
GLN H2   H  N N 99  
GLN HA   H  N N 100 
GLN HB2  H  N N 101 
GLN HB3  H  N N 102 
GLN HG2  H  N N 103 
GLN HG3  H  N N 104 
GLN HE21 H  N N 105 
GLN HE22 H  N N 106 
GLN HXT  H  N N 107 
GLU N    N  N N 108 
GLU CA   C  N S 109 
GLU C    C  N N 110 
GLU O    O  N N 111 
GLU CB   C  N N 112 
GLU CG   C  N N 113 
GLU CD   C  N N 114 
GLU OE1  O  N N 115 
GLU OE2  O  N N 116 
GLU OXT  O  N N 117 
GLU H    H  N N 118 
GLU H2   H  N N 119 
GLU HA   H  N N 120 
GLU HB2  H  N N 121 
GLU HB3  H  N N 122 
GLU HG2  H  N N 123 
GLU HG3  H  N N 124 
GLU HE2  H  N N 125 
GLU HXT  H  N N 126 
GLY N    N  N N 127 
GLY CA   C  N N 128 
GLY C    C  N N 129 
GLY O    O  N N 130 
GLY OXT  O  N N 131 
GLY H    H  N N 132 
GLY H2   H  N N 133 
GLY HA2  H  N N 134 
GLY HA3  H  N N 135 
GLY HXT  H  N N 136 
GOL C1   C  N N 137 
GOL O1   O  N N 138 
GOL C2   C  N N 139 
GOL O2   O  N N 140 
GOL C3   C  N N 141 
GOL O3   O  N N 142 
GOL H11  H  N N 143 
GOL H12  H  N N 144 
GOL HO1  H  N N 145 
GOL H2   H  N N 146 
GOL HO2  H  N N 147 
GOL H31  H  N N 148 
GOL H32  H  N N 149 
GOL HO3  H  N N 150 
HIS N    N  N N 151 
HIS CA   C  N S 152 
HIS C    C  N N 153 
HIS O    O  N N 154 
HIS CB   C  N N 155 
HIS CG   C  Y N 156 
HIS ND1  N  Y N 157 
HIS CD2  C  Y N 158 
HIS CE1  C  Y N 159 
HIS NE2  N  Y N 160 
HIS OXT  O  N N 161 
HIS H    H  N N 162 
HIS H2   H  N N 163 
HIS HA   H  N N 164 
HIS HB2  H  N N 165 
HIS HB3  H  N N 166 
HIS HD1  H  N N 167 
HIS HD2  H  N N 168 
HIS HE1  H  N N 169 
HIS HE2  H  N N 170 
HIS HXT  H  N N 171 
HOH O    O  N N 172 
HOH H1   H  N N 173 
HOH H2   H  N N 174 
ILE N    N  N N 175 
ILE CA   C  N S 176 
ILE C    C  N N 177 
ILE O    O  N N 178 
ILE CB   C  N S 179 
ILE CG1  C  N N 180 
ILE CG2  C  N N 181 
ILE CD1  C  N N 182 
ILE OXT  O  N N 183 
ILE H    H  N N 184 
ILE H2   H  N N 185 
ILE HA   H  N N 186 
ILE HB   H  N N 187 
ILE HG12 H  N N 188 
ILE HG13 H  N N 189 
ILE HG21 H  N N 190 
ILE HG22 H  N N 191 
ILE HG23 H  N N 192 
ILE HD11 H  N N 193 
ILE HD12 H  N N 194 
ILE HD13 H  N N 195 
ILE HXT  H  N N 196 
LEU N    N  N N 197 
LEU CA   C  N S 198 
LEU C    C  N N 199 
LEU O    O  N N 200 
LEU CB   C  N N 201 
LEU CG   C  N N 202 
LEU CD1  C  N N 203 
LEU CD2  C  N N 204 
LEU OXT  O  N N 205 
LEU H    H  N N 206 
LEU H2   H  N N 207 
LEU HA   H  N N 208 
LEU HB2  H  N N 209 
LEU HB3  H  N N 210 
LEU HG   H  N N 211 
LEU HD11 H  N N 212 
LEU HD12 H  N N 213 
LEU HD13 H  N N 214 
LEU HD21 H  N N 215 
LEU HD22 H  N N 216 
LEU HD23 H  N N 217 
LEU HXT  H  N N 218 
LYS N    N  N N 219 
LYS CA   C  N S 220 
LYS C    C  N N 221 
LYS O    O  N N 222 
LYS CB   C  N N 223 
LYS CG   C  N N 224 
LYS CD   C  N N 225 
LYS CE   C  N N 226 
LYS NZ   N  N N 227 
LYS OXT  O  N N 228 
LYS H    H  N N 229 
LYS H2   H  N N 230 
LYS HA   H  N N 231 
LYS HB2  H  N N 232 
LYS HB3  H  N N 233 
LYS HG2  H  N N 234 
LYS HG3  H  N N 235 
LYS HD2  H  N N 236 
LYS HD3  H  N N 237 
LYS HE2  H  N N 238 
LYS HE3  H  N N 239 
LYS HZ1  H  N N 240 
LYS HZ2  H  N N 241 
LYS HZ3  H  N N 242 
LYS HXT  H  N N 243 
MSE N    N  N N 244 
MSE CA   C  N S 245 
MSE C    C  N N 246 
MSE O    O  N N 247 
MSE OXT  O  N N 248 
MSE CB   C  N N 249 
MSE CG   C  N N 250 
MSE SE   SE N N 251 
MSE CE   C  N N 252 
MSE H    H  N N 253 
MSE H2   H  N N 254 
MSE HA   H  N N 255 
MSE HXT  H  N N 256 
MSE HB2  H  N N 257 
MSE HB3  H  N N 258 
MSE HG2  H  N N 259 
MSE HG3  H  N N 260 
MSE HE1  H  N N 261 
MSE HE2  H  N N 262 
MSE HE3  H  N N 263 
PHE N    N  N N 264 
PHE CA   C  N S 265 
PHE C    C  N N 266 
PHE O    O  N N 267 
PHE CB   C  N N 268 
PHE CG   C  Y N 269 
PHE CD1  C  Y N 270 
PHE CD2  C  Y N 271 
PHE CE1  C  Y N 272 
PHE CE2  C  Y N 273 
PHE CZ   C  Y N 274 
PHE OXT  O  N N 275 
PHE H    H  N N 276 
PHE H2   H  N N 277 
PHE HA   H  N N 278 
PHE HB2  H  N N 279 
PHE HB3  H  N N 280 
PHE HD1  H  N N 281 
PHE HD2  H  N N 282 
PHE HE1  H  N N 283 
PHE HE2  H  N N 284 
PHE HZ   H  N N 285 
PHE HXT  H  N N 286 
PRO N    N  N N 287 
PRO CA   C  N S 288 
PRO C    C  N N 289 
PRO O    O  N N 290 
PRO CB   C  N N 291 
PRO CG   C  N N 292 
PRO CD   C  N N 293 
PRO OXT  O  N N 294 
PRO H    H  N N 295 
PRO HA   H  N N 296 
PRO HB2  H  N N 297 
PRO HB3  H  N N 298 
PRO HG2  H  N N 299 
PRO HG3  H  N N 300 
PRO HD2  H  N N 301 
PRO HD3  H  N N 302 
PRO HXT  H  N N 303 
SER N    N  N N 304 
SER CA   C  N S 305 
SER C    C  N N 306 
SER O    O  N N 307 
SER CB   C  N N 308 
SER OG   O  N N 309 
SER OXT  O  N N 310 
SER H    H  N N 311 
SER H2   H  N N 312 
SER HA   H  N N 313 
SER HB2  H  N N 314 
SER HB3  H  N N 315 
SER HG   H  N N 316 
SER HXT  H  N N 317 
THR N    N  N N 318 
THR CA   C  N S 319 
THR C    C  N N 320 
THR O    O  N N 321 
THR CB   C  N R 322 
THR OG1  O  N N 323 
THR CG2  C  N N 324 
THR OXT  O  N N 325 
THR H    H  N N 326 
THR H2   H  N N 327 
THR HA   H  N N 328 
THR HB   H  N N 329 
THR HG1  H  N N 330 
THR HG21 H  N N 331 
THR HG22 H  N N 332 
THR HG23 H  N N 333 
THR HXT  H  N N 334 
TRP N    N  N N 335 
TRP CA   C  N S 336 
TRP C    C  N N 337 
TRP O    O  N N 338 
TRP CB   C  N N 339 
TRP CG   C  Y N 340 
TRP CD1  C  Y N 341 
TRP CD2  C  Y N 342 
TRP NE1  N  Y N 343 
TRP CE2  C  Y N 344 
TRP CE3  C  Y N 345 
TRP CZ2  C  Y N 346 
TRP CZ3  C  Y N 347 
TRP CH2  C  Y N 348 
TRP OXT  O  N N 349 
TRP H    H  N N 350 
TRP H2   H  N N 351 
TRP HA   H  N N 352 
TRP HB2  H  N N 353 
TRP HB3  H  N N 354 
TRP HD1  H  N N 355 
TRP HE1  H  N N 356 
TRP HE3  H  N N 357 
TRP HZ2  H  N N 358 
TRP HZ3  H  N N 359 
TRP HH2  H  N N 360 
TRP HXT  H  N N 361 
TYR N    N  N N 362 
TYR CA   C  N S 363 
TYR C    C  N N 364 
TYR O    O  N N 365 
TYR CB   C  N N 366 
TYR CG   C  Y N 367 
TYR CD1  C  Y N 368 
TYR CD2  C  Y N 369 
TYR CE1  C  Y N 370 
TYR CE2  C  Y N 371 
TYR CZ   C  Y N 372 
TYR OH   O  N N 373 
TYR OXT  O  N N 374 
TYR H    H  N N 375 
TYR H2   H  N N 376 
TYR HA   H  N N 377 
TYR HB2  H  N N 378 
TYR HB3  H  N N 379 
TYR HD1  H  N N 380 
TYR HD2  H  N N 381 
TYR HE1  H  N N 382 
TYR HE2  H  N N 383 
TYR HH   H  N N 384 
TYR HXT  H  N N 385 
VAL N    N  N N 386 
VAL CA   C  N S 387 
VAL C    C  N N 388 
VAL O    O  N N 389 
VAL CB   C  N N 390 
VAL CG1  C  N N 391 
VAL CG2  C  N N 392 
VAL OXT  O  N N 393 
VAL H    H  N N 394 
VAL H2   H  N N 395 
VAL HA   H  N N 396 
VAL HB   H  N N 397 
VAL HG11 H  N N 398 
VAL HG12 H  N N 399 
VAL HG13 H  N N 400 
VAL HG21 H  N N 401 
VAL HG22 H  N N 402 
VAL HG23 H  N N 403 
VAL HXT  H  N N 404 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLN N   CA   sing N N 83  
GLN N   H    sing N N 84  
GLN N   H2   sing N N 85  
GLN CA  C    sing N N 86  
GLN CA  CB   sing N N 87  
GLN CA  HA   sing N N 88  
GLN C   O    doub N N 89  
GLN C   OXT  sing N N 90  
GLN CB  CG   sing N N 91  
GLN CB  HB2  sing N N 92  
GLN CB  HB3  sing N N 93  
GLN CG  CD   sing N N 94  
GLN CG  HG2  sing N N 95  
GLN CG  HG3  sing N N 96  
GLN CD  OE1  doub N N 97  
GLN CD  NE2  sing N N 98  
GLN NE2 HE21 sing N N 99  
GLN NE2 HE22 sing N N 100 
GLN OXT HXT  sing N N 101 
GLU N   CA   sing N N 102 
GLU N   H    sing N N 103 
GLU N   H2   sing N N 104 
GLU CA  C    sing N N 105 
GLU CA  CB   sing N N 106 
GLU CA  HA   sing N N 107 
GLU C   O    doub N N 108 
GLU C   OXT  sing N N 109 
GLU CB  CG   sing N N 110 
GLU CB  HB2  sing N N 111 
GLU CB  HB3  sing N N 112 
GLU CG  CD   sing N N 113 
GLU CG  HG2  sing N N 114 
GLU CG  HG3  sing N N 115 
GLU CD  OE1  doub N N 116 
GLU CD  OE2  sing N N 117 
GLU OE2 HE2  sing N N 118 
GLU OXT HXT  sing N N 119 
GLY N   CA   sing N N 120 
GLY N   H    sing N N 121 
GLY N   H2   sing N N 122 
GLY CA  C    sing N N 123 
GLY CA  HA2  sing N N 124 
GLY CA  HA3  sing N N 125 
GLY C   O    doub N N 126 
GLY C   OXT  sing N N 127 
GLY OXT HXT  sing N N 128 
GOL C1  O1   sing N N 129 
GOL C1  C2   sing N N 130 
GOL C1  H11  sing N N 131 
GOL C1  H12  sing N N 132 
GOL O1  HO1  sing N N 133 
GOL C2  O2   sing N N 134 
GOL C2  C3   sing N N 135 
GOL C2  H2   sing N N 136 
GOL O2  HO2  sing N N 137 
GOL C3  O3   sing N N 138 
GOL C3  H31  sing N N 139 
GOL C3  H32  sing N N 140 
GOL O3  HO3  sing N N 141 
HIS N   CA   sing N N 142 
HIS N   H    sing N N 143 
HIS N   H2   sing N N 144 
HIS CA  C    sing N N 145 
HIS CA  CB   sing N N 146 
HIS CA  HA   sing N N 147 
HIS C   O    doub N N 148 
HIS C   OXT  sing N N 149 
HIS CB  CG   sing N N 150 
HIS CB  HB2  sing N N 151 
HIS CB  HB3  sing N N 152 
HIS CG  ND1  sing Y N 153 
HIS CG  CD2  doub Y N 154 
HIS ND1 CE1  doub Y N 155 
HIS ND1 HD1  sing N N 156 
HIS CD2 NE2  sing Y N 157 
HIS CD2 HD2  sing N N 158 
HIS CE1 NE2  sing Y N 159 
HIS CE1 HE1  sing N N 160 
HIS NE2 HE2  sing N N 161 
HIS OXT HXT  sing N N 162 
HOH O   H1   sing N N 163 
HOH O   H2   sing N N 164 
ILE N   CA   sing N N 165 
ILE N   H    sing N N 166 
ILE N   H2   sing N N 167 
ILE CA  C    sing N N 168 
ILE CA  CB   sing N N 169 
ILE CA  HA   sing N N 170 
ILE C   O    doub N N 171 
ILE C   OXT  sing N N 172 
ILE CB  CG1  sing N N 173 
ILE CB  CG2  sing N N 174 
ILE CB  HB   sing N N 175 
ILE CG1 CD1  sing N N 176 
ILE CG1 HG12 sing N N 177 
ILE CG1 HG13 sing N N 178 
ILE CG2 HG21 sing N N 179 
ILE CG2 HG22 sing N N 180 
ILE CG2 HG23 sing N N 181 
ILE CD1 HD11 sing N N 182 
ILE CD1 HD12 sing N N 183 
ILE CD1 HD13 sing N N 184 
ILE OXT HXT  sing N N 185 
LEU N   CA   sing N N 186 
LEU N   H    sing N N 187 
LEU N   H2   sing N N 188 
LEU CA  C    sing N N 189 
LEU CA  CB   sing N N 190 
LEU CA  HA   sing N N 191 
LEU C   O    doub N N 192 
LEU C   OXT  sing N N 193 
LEU CB  CG   sing N N 194 
LEU CB  HB2  sing N N 195 
LEU CB  HB3  sing N N 196 
LEU CG  CD1  sing N N 197 
LEU CG  CD2  sing N N 198 
LEU CG  HG   sing N N 199 
LEU CD1 HD11 sing N N 200 
LEU CD1 HD12 sing N N 201 
LEU CD1 HD13 sing N N 202 
LEU CD2 HD21 sing N N 203 
LEU CD2 HD22 sing N N 204 
LEU CD2 HD23 sing N N 205 
LEU OXT HXT  sing N N 206 
LYS N   CA   sing N N 207 
LYS N   H    sing N N 208 
LYS N   H2   sing N N 209 
LYS CA  C    sing N N 210 
LYS CA  CB   sing N N 211 
LYS CA  HA   sing N N 212 
LYS C   O    doub N N 213 
LYS C   OXT  sing N N 214 
LYS CB  CG   sing N N 215 
LYS CB  HB2  sing N N 216 
LYS CB  HB3  sing N N 217 
LYS CG  CD   sing N N 218 
LYS CG  HG2  sing N N 219 
LYS CG  HG3  sing N N 220 
LYS CD  CE   sing N N 221 
LYS CD  HD2  sing N N 222 
LYS CD  HD3  sing N N 223 
LYS CE  NZ   sing N N 224 
LYS CE  HE2  sing N N 225 
LYS CE  HE3  sing N N 226 
LYS NZ  HZ1  sing N N 227 
LYS NZ  HZ2  sing N N 228 
LYS NZ  HZ3  sing N N 229 
LYS OXT HXT  sing N N 230 
MSE N   CA   sing N N 231 
MSE N   H    sing N N 232 
MSE N   H2   sing N N 233 
MSE CA  C    sing N N 234 
MSE CA  CB   sing N N 235 
MSE CA  HA   sing N N 236 
MSE C   O    doub N N 237 
MSE C   OXT  sing N N 238 
MSE OXT HXT  sing N N 239 
MSE CB  CG   sing N N 240 
MSE CB  HB2  sing N N 241 
MSE CB  HB3  sing N N 242 
MSE CG  SE   sing N N 243 
MSE CG  HG2  sing N N 244 
MSE CG  HG3  sing N N 245 
MSE SE  CE   sing N N 246 
MSE CE  HE1  sing N N 247 
MSE CE  HE2  sing N N 248 
MSE CE  HE3  sing N N 249 
PHE N   CA   sing N N 250 
PHE N   H    sing N N 251 
PHE N   H2   sing N N 252 
PHE CA  C    sing N N 253 
PHE CA  CB   sing N N 254 
PHE CA  HA   sing N N 255 
PHE C   O    doub N N 256 
PHE C   OXT  sing N N 257 
PHE CB  CG   sing N N 258 
PHE CB  HB2  sing N N 259 
PHE CB  HB3  sing N N 260 
PHE CG  CD1  doub Y N 261 
PHE CG  CD2  sing Y N 262 
PHE CD1 CE1  sing Y N 263 
PHE CD1 HD1  sing N N 264 
PHE CD2 CE2  doub Y N 265 
PHE CD2 HD2  sing N N 266 
PHE CE1 CZ   doub Y N 267 
PHE CE1 HE1  sing N N 268 
PHE CE2 CZ   sing Y N 269 
PHE CE2 HE2  sing N N 270 
PHE CZ  HZ   sing N N 271 
PHE OXT HXT  sing N N 272 
PRO N   CA   sing N N 273 
PRO N   CD   sing N N 274 
PRO N   H    sing N N 275 
PRO CA  C    sing N N 276 
PRO CA  CB   sing N N 277 
PRO CA  HA   sing N N 278 
PRO C   O    doub N N 279 
PRO C   OXT  sing N N 280 
PRO CB  CG   sing N N 281 
PRO CB  HB2  sing N N 282 
PRO CB  HB3  sing N N 283 
PRO CG  CD   sing N N 284 
PRO CG  HG2  sing N N 285 
PRO CG  HG3  sing N N 286 
PRO CD  HD2  sing N N 287 
PRO CD  HD3  sing N N 288 
PRO OXT HXT  sing N N 289 
SER N   CA   sing N N 290 
SER N   H    sing N N 291 
SER N   H2   sing N N 292 
SER CA  C    sing N N 293 
SER CA  CB   sing N N 294 
SER CA  HA   sing N N 295 
SER C   O    doub N N 296 
SER C   OXT  sing N N 297 
SER CB  OG   sing N N 298 
SER CB  HB2  sing N N 299 
SER CB  HB3  sing N N 300 
SER OG  HG   sing N N 301 
SER OXT HXT  sing N N 302 
THR N   CA   sing N N 303 
THR N   H    sing N N 304 
THR N   H2   sing N N 305 
THR CA  C    sing N N 306 
THR CA  CB   sing N N 307 
THR CA  HA   sing N N 308 
THR C   O    doub N N 309 
THR C   OXT  sing N N 310 
THR CB  OG1  sing N N 311 
THR CB  CG2  sing N N 312 
THR CB  HB   sing N N 313 
THR OG1 HG1  sing N N 314 
THR CG2 HG21 sing N N 315 
THR CG2 HG22 sing N N 316 
THR CG2 HG23 sing N N 317 
THR OXT HXT  sing N N 318 
TRP N   CA   sing N N 319 
TRP N   H    sing N N 320 
TRP N   H2   sing N N 321 
TRP CA  C    sing N N 322 
TRP CA  CB   sing N N 323 
TRP CA  HA   sing N N 324 
TRP C   O    doub N N 325 
TRP C   OXT  sing N N 326 
TRP CB  CG   sing N N 327 
TRP CB  HB2  sing N N 328 
TRP CB  HB3  sing N N 329 
TRP CG  CD1  doub Y N 330 
TRP CG  CD2  sing Y N 331 
TRP CD1 NE1  sing Y N 332 
TRP CD1 HD1  sing N N 333 
TRP CD2 CE2  doub Y N 334 
TRP CD2 CE3  sing Y N 335 
TRP NE1 CE2  sing Y N 336 
TRP NE1 HE1  sing N N 337 
TRP CE2 CZ2  sing Y N 338 
TRP CE3 CZ3  doub Y N 339 
TRP CE3 HE3  sing N N 340 
TRP CZ2 CH2  doub Y N 341 
TRP CZ2 HZ2  sing N N 342 
TRP CZ3 CH2  sing Y N 343 
TRP CZ3 HZ3  sing N N 344 
TRP CH2 HH2  sing N N 345 
TRP OXT HXT  sing N N 346 
TYR N   CA   sing N N 347 
TYR N   H    sing N N 348 
TYR N   H2   sing N N 349 
TYR CA  C    sing N N 350 
TYR CA  CB   sing N N 351 
TYR CA  HA   sing N N 352 
TYR C   O    doub N N 353 
TYR C   OXT  sing N N 354 
TYR CB  CG   sing N N 355 
TYR CB  HB2  sing N N 356 
TYR CB  HB3  sing N N 357 
TYR CG  CD1  doub Y N 358 
TYR CG  CD2  sing Y N 359 
TYR CD1 CE1  sing Y N 360 
TYR CD1 HD1  sing N N 361 
TYR CD2 CE2  doub Y N 362 
TYR CD2 HD2  sing N N 363 
TYR CE1 CZ   doub Y N 364 
TYR CE1 HE1  sing N N 365 
TYR CE2 CZ   sing Y N 366 
TYR CE2 HE2  sing N N 367 
TYR CZ  OH   sing N N 368 
TYR OH  HH   sing N N 369 
TYR OXT HXT  sing N N 370 
VAL N   CA   sing N N 371 
VAL N   H    sing N N 372 
VAL N   H2   sing N N 373 
VAL CA  C    sing N N 374 
VAL CA  CB   sing N N 375 
VAL CA  HA   sing N N 376 
VAL C   O    doub N N 377 
VAL C   OXT  sing N N 378 
VAL CB  CG1  sing N N 379 
VAL CB  CG2  sing N N 380 
VAL CB  HB   sing N N 381 
VAL CG1 HG11 sing N N 382 
VAL CG1 HG12 sing N N 383 
VAL CG1 HG13 sing N N 384 
VAL CG2 HG21 sing N N 385 
VAL CG2 HG22 sing N N 386 
VAL CG2 HG23 sing N N 387 
VAL OXT HXT  sing N N 388 
# 
_pdbx_audit_support.funding_organization   
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           GM118047 
_pdbx_audit_support.ordinal                1 
# 
_atom_sites.entry_id                    5WFY 
_atom_sites.fract_transf_matrix[1][1]   0.034709 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001425 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.024509 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.019597 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
S  
SE 
# 
loop_