data_5WFY # _entry.id 5WFY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5WFY pdb_00005wfy 10.2210/pdb5wfy/pdb WWPDB D_1000228962 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-09-26 2 'Structure model' 2 0 2018-11-14 3 'Structure model' 2 1 2020-01-01 4 'Structure model' 3 0 2023-11-15 5 'Structure model' 3 1 2024-10-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Atomic model' 2 2 'Structure model' 'Data collection' 3 2 'Structure model' 'Database references' 4 3 'Structure model' 'Author supporting evidence' 5 4 'Structure model' 'Atomic model' 6 4 'Structure model' 'Data collection' 7 4 'Structure model' 'Database references' 8 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' atom_site 2 2 'Structure model' citation 3 3 'Structure model' pdbx_audit_support 4 4 'Structure model' atom_site 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' database_2 8 5 'Structure model' pdbx_entry_details 9 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_atom_site.B_iso_or_equiv' 2 2 'Structure model' '_atom_site.Cartn_x' 3 2 'Structure model' '_atom_site.Cartn_y' 4 2 'Structure model' '_atom_site.Cartn_z' 5 2 'Structure model' '_atom_site.auth_atom_id' 6 2 'Structure model' '_atom_site.label_atom_id' 7 2 'Structure model' '_citation.journal_volume' 8 2 'Structure model' '_citation.page_first' 9 2 'Structure model' '_citation.page_last' 10 3 'Structure model' '_pdbx_audit_support.funding_organization' 11 4 'Structure model' '_atom_site.Cartn_x' 12 4 'Structure model' '_atom_site.Cartn_y' 13 4 'Structure model' '_atom_site.Cartn_z' 14 4 'Structure model' '_atom_site.auth_atom_id' 15 4 'Structure model' '_atom_site.label_atom_id' 16 4 'Structure model' '_database_2.pdbx_DOI' 17 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5WFY _pdbx_database_status.recvd_initial_deposition_date 2017-07-13 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Shi, K.' 1 0000-0003-4175-3714 'Aihara, H.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nucleic Acids Res.' _citation.journal_id_ASTM NARHAD _citation.journal_id_CSD 0389 _citation.journal_id_ISSN 1362-4962 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 46 _citation.language ? _citation.page_first 10474 _citation.page_last 10488 _citation.title 'T4 DNA ligase structure reveals a prototypical ATP-dependent ligase with a unique mode of sliding clamp interaction.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1093/nar/gky776 _citation.pdbx_database_id_PubMed 30169742 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Shi, K.' 1 ? primary 'Bohl, T.E.' 2 ? primary 'Park, J.' 3 ? primary 'Zasada, A.' 4 ? primary 'Malik, S.' 5 ? primary 'Banerjee, S.' 6 ? primary 'Tran, V.' 7 ? primary 'Li, N.' 8 ? primary 'Yin, Z.' 9 ? primary 'Kurniawan, F.' 10 ? primary 'Orellana, K.' 11 ? primary 'Aihara, H.' 12 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'DNA ligase' 15857.651 1 6.5.1.1 ? 'DNA binding domain (UNP residues 1-129)' ? 2 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 3 water nat water 18.015 128 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Polydeoxyribonucleotide synthase [ATP]' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)ILKILNEIASIGSTKQKQAILEKNKDNELLKRVYRLTYSRGLQYYIKKWPKPGIATQSFG(MSE)LTLTD(MSE) LDFIEFTLATRKLTGNAAIEELTGYITDGKKDDVEVLRRV(MSE)(MSE)RDLECGASVSIANKVWPGLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MILKILNEIASIGSTKQKQAILEKNKDNELLKRVYRLTYSRGLQYYIKKWPKPGIATQSFGMLTLTDMLDFIEFTLATRK LTGNAAIEELTGYITDGKKDDVEVLRRVMMRDLECGASVSIANKVWPGLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 GLYCEROL GOL 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 ILE n 1 3 LEU n 1 4 LYS n 1 5 ILE n 1 6 LEU n 1 7 ASN n 1 8 GLU n 1 9 ILE n 1 10 ALA n 1 11 SER n 1 12 ILE n 1 13 GLY n 1 14 SER n 1 15 THR n 1 16 LYS n 1 17 GLN n 1 18 LYS n 1 19 GLN n 1 20 ALA n 1 21 ILE n 1 22 LEU n 1 23 GLU n 1 24 LYS n 1 25 ASN n 1 26 LYS n 1 27 ASP n 1 28 ASN n 1 29 GLU n 1 30 LEU n 1 31 LEU n 1 32 LYS n 1 33 ARG n 1 34 VAL n 1 35 TYR n 1 36 ARG n 1 37 LEU n 1 38 THR n 1 39 TYR n 1 40 SER n 1 41 ARG n 1 42 GLY n 1 43 LEU n 1 44 GLN n 1 45 TYR n 1 46 TYR n 1 47 ILE n 1 48 LYS n 1 49 LYS n 1 50 TRP n 1 51 PRO n 1 52 LYS n 1 53 PRO n 1 54 GLY n 1 55 ILE n 1 56 ALA n 1 57 THR n 1 58 GLN n 1 59 SER n 1 60 PHE n 1 61 GLY n 1 62 MSE n 1 63 LEU n 1 64 THR n 1 65 LEU n 1 66 THR n 1 67 ASP n 1 68 MSE n 1 69 LEU n 1 70 ASP n 1 71 PHE n 1 72 ILE n 1 73 GLU n 1 74 PHE n 1 75 THR n 1 76 LEU n 1 77 ALA n 1 78 THR n 1 79 ARG n 1 80 LYS n 1 81 LEU n 1 82 THR n 1 83 GLY n 1 84 ASN n 1 85 ALA n 1 86 ALA n 1 87 ILE n 1 88 GLU n 1 89 GLU n 1 90 LEU n 1 91 THR n 1 92 GLY n 1 93 TYR n 1 94 ILE n 1 95 THR n 1 96 ASP n 1 97 GLY n 1 98 LYS n 1 99 LYS n 1 100 ASP n 1 101 ASP n 1 102 VAL n 1 103 GLU n 1 104 VAL n 1 105 LEU n 1 106 ARG n 1 107 ARG n 1 108 VAL n 1 109 MSE n 1 110 MSE n 1 111 ARG n 1 112 ASP n 1 113 LEU n 1 114 GLU n 1 115 CYS n 1 116 GLY n 1 117 ALA n 1 118 SER n 1 119 VAL n 1 120 SER n 1 121 ILE n 1 122 ALA n 1 123 ASN n 1 124 LYS n 1 125 VAL n 1 126 TRP n 1 127 PRO n 1 128 GLY n 1 129 LEU n 1 130 GLU n 1 131 HIS n 1 132 HIS n 1 133 HIS n 1 134 HIS n 1 135 HIS n 1 136 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 136 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 30 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Enterobacteria phage T4' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10665 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 1 MSE MSE A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 ASN 7 7 7 ASN ASN A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 TRP 50 50 50 TRP TRP A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 MSE 62 62 62 MSE MSE A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 MSE 68 68 68 MSE MSE A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 PHE 74 74 74 PHE PHE A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 ASN 84 84 84 ASN ASN A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 TYR 93 93 93 TYR TYR A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 ASP 101 101 101 ASP ASP A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 ARG 106 106 106 ARG ARG A . n A 1 107 ARG 107 107 107 ARG ARG A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 MSE 109 109 109 MSE MSE A . n A 1 110 MSE 110 110 110 MSE MSE A . n A 1 111 ARG 111 111 111 ARG ARG A . n A 1 112 ASP 112 112 112 ASP ASP A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 CYS 115 115 115 CYS CYS A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 SER 118 118 118 SER SER A . n A 1 119 VAL 119 119 119 VAL VAL A . n A 1 120 SER 120 120 120 SER SER A . n A 1 121 ILE 121 121 121 ILE ILE A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 ASN 123 123 123 ASN ASN A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 VAL 125 125 125 VAL VAL A . n A 1 126 TRP 126 126 126 TRP TRP A . n A 1 127 PRO 127 127 127 PRO PRO A . n A 1 128 GLY 128 128 128 GLY GLY A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 HIS 131 131 131 HIS HIS A . n A 1 132 HIS 132 132 132 HIS HIS A . n A 1 133 HIS 133 133 ? ? ? A . n A 1 134 HIS 134 134 ? ? ? A . n A 1 135 HIS 135 135 ? ? ? A . n A 1 136 HIS 136 136 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 GOL 1 201 1 GOL GOL A . C 3 HOH 1 301 107 HOH HOH A . C 3 HOH 2 302 63 HOH HOH A . C 3 HOH 3 303 75 HOH HOH A . C 3 HOH 4 304 44 HOH HOH A . C 3 HOH 5 305 130 HOH HOH A . C 3 HOH 6 306 66 HOH HOH A . C 3 HOH 7 307 36 HOH HOH A . C 3 HOH 8 308 16 HOH HOH A . C 3 HOH 9 309 28 HOH HOH A . C 3 HOH 10 310 120 HOH HOH A . C 3 HOH 11 311 133 HOH HOH A . C 3 HOH 12 312 128 HOH HOH A . C 3 HOH 13 313 87 HOH HOH A . C 3 HOH 14 314 67 HOH HOH A . C 3 HOH 15 315 104 HOH HOH A . C 3 HOH 16 316 41 HOH HOH A . C 3 HOH 17 317 132 HOH HOH A . C 3 HOH 18 318 59 HOH HOH A . C 3 HOH 19 319 90 HOH HOH A . C 3 HOH 20 320 83 HOH HOH A . C 3 HOH 21 321 3 HOH HOH A . C 3 HOH 22 322 100 HOH HOH A . C 3 HOH 23 323 55 HOH HOH A . C 3 HOH 24 324 14 HOH HOH A . C 3 HOH 25 325 97 HOH HOH A . C 3 HOH 26 326 38 HOH HOH A . C 3 HOH 27 327 22 HOH HOH A . C 3 HOH 28 328 2 HOH HOH A . C 3 HOH 29 329 15 HOH HOH A . C 3 HOH 30 330 86 HOH HOH A . C 3 HOH 31 331 9 HOH HOH A . C 3 HOH 32 332 42 HOH HOH A . C 3 HOH 33 333 10 HOH HOH A . C 3 HOH 34 334 123 HOH HOH A . C 3 HOH 35 335 109 HOH HOH A . C 3 HOH 36 336 17 HOH HOH A . C 3 HOH 37 337 6 HOH HOH A . C 3 HOH 38 338 93 HOH HOH A . C 3 HOH 39 339 12 HOH HOH A . C 3 HOH 40 340 69 HOH HOH A . C 3 HOH 41 341 72 HOH HOH A . C 3 HOH 42 342 81 HOH HOH A . C 3 HOH 43 343 101 HOH HOH A . C 3 HOH 44 344 71 HOH HOH A . C 3 HOH 45 345 23 HOH HOH A . C 3 HOH 46 346 43 HOH HOH A . C 3 HOH 47 347 46 HOH HOH A . C 3 HOH 48 348 31 HOH HOH A . C 3 HOH 49 349 8 HOH HOH A . C 3 HOH 50 350 119 HOH HOH A . C 3 HOH 51 351 85 HOH HOH A . C 3 HOH 52 352 24 HOH HOH A . C 3 HOH 53 353 52 HOH HOH A . C 3 HOH 54 354 76 HOH HOH A . C 3 HOH 55 355 126 HOH HOH A . C 3 HOH 56 356 19 HOH HOH A . C 3 HOH 57 357 84 HOH HOH A . C 3 HOH 58 358 105 HOH HOH A . C 3 HOH 59 359 94 HOH HOH A . C 3 HOH 60 360 20 HOH HOH A . C 3 HOH 61 361 5 HOH HOH A . C 3 HOH 62 362 30 HOH HOH A . C 3 HOH 63 363 103 HOH HOH A . C 3 HOH 64 364 53 HOH HOH A . C 3 HOH 65 365 95 HOH HOH A . C 3 HOH 66 366 106 HOH HOH A . C 3 HOH 67 367 48 HOH HOH A . C 3 HOH 68 368 117 HOH HOH A . C 3 HOH 69 369 4 HOH HOH A . C 3 HOH 70 370 70 HOH HOH A . C 3 HOH 71 371 58 HOH HOH A . C 3 HOH 72 372 45 HOH HOH A . C 3 HOH 73 373 134 HOH HOH A . C 3 HOH 74 374 37 HOH HOH A . C 3 HOH 75 375 111 HOH HOH A . C 3 HOH 76 376 1 HOH HOH A . C 3 HOH 77 377 62 HOH HOH A . C 3 HOH 78 378 65 HOH HOH A . C 3 HOH 79 379 35 HOH HOH A . C 3 HOH 80 380 13 HOH HOH A . C 3 HOH 81 381 39 HOH HOH A . C 3 HOH 82 382 96 HOH HOH A . C 3 HOH 83 383 99 HOH HOH A . C 3 HOH 84 384 64 HOH HOH A . C 3 HOH 85 385 26 HOH HOH A . C 3 HOH 86 386 11 HOH HOH A . C 3 HOH 87 387 27 HOH HOH A . C 3 HOH 88 388 51 HOH HOH A . C 3 HOH 89 389 29 HOH HOH A . C 3 HOH 90 390 88 HOH HOH A . C 3 HOH 91 391 114 HOH HOH A . C 3 HOH 92 392 110 HOH HOH A . C 3 HOH 93 393 56 HOH HOH A . C 3 HOH 94 394 40 HOH HOH A . C 3 HOH 95 395 127 HOH HOH A . C 3 HOH 96 396 113 HOH HOH A . C 3 HOH 97 397 49 HOH HOH A . C 3 HOH 98 398 33 HOH HOH A . C 3 HOH 99 399 34 HOH HOH A . C 3 HOH 100 400 60 HOH HOH A . C 3 HOH 101 401 50 HOH HOH A . C 3 HOH 102 402 25 HOH HOH A . C 3 HOH 103 403 73 HOH HOH A . C 3 HOH 104 404 108 HOH HOH A . C 3 HOH 105 405 82 HOH HOH A . C 3 HOH 106 406 21 HOH HOH A . C 3 HOH 107 407 78 HOH HOH A . C 3 HOH 108 408 102 HOH HOH A . C 3 HOH 109 409 91 HOH HOH A . C 3 HOH 110 410 115 HOH HOH A . C 3 HOH 111 411 118 HOH HOH A . C 3 HOH 112 412 80 HOH HOH A . C 3 HOH 113 413 68 HOH HOH A . C 3 HOH 114 414 89 HOH HOH A . C 3 HOH 115 415 92 HOH HOH A . C 3 HOH 116 416 131 HOH HOH A . C 3 HOH 117 417 116 HOH HOH A . C 3 HOH 118 418 54 HOH HOH A . C 3 HOH 119 419 124 HOH HOH A . C 3 HOH 120 420 47 HOH HOH A . C 3 HOH 121 421 112 HOH HOH A . C 3 HOH 122 422 77 HOH HOH A . C 3 HOH 123 423 74 HOH HOH A . C 3 HOH 124 424 122 HOH HOH A . C 3 HOH 125 425 57 HOH HOH A . C 3 HOH 126 426 121 HOH HOH A . C 3 HOH 127 427 79 HOH HOH A . C 3 HOH 128 428 125 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.12_2829 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? SHELXD ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 92.35 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5WFY _cell.details ? _cell.formula_units_Z ? _cell.length_a 28.811 _cell.length_a_esd ? _cell.length_b 40.801 _cell.length_b_esd ? _cell.length_c 51.072 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5WFY _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5WFY _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.92 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 35.93 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details PEG3350 _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-06-22 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-E' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.979 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-E _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5WFY _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.40 _reflns.d_resolution_low 51.03 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 23239 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F 0 _reflns.observed_criterion_sigma_I 0 _reflns.percent_possible_obs 98.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.7 _reflns.pdbx_Rmerge_I_obs 0.095 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.095 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 16.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.40 _reflns_shell.d_res_low 1.48 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.3 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 3313 _reflns_shell.percent_possible_all 97.5 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.346 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 7.5 _reflns_shell.pdbx_Rsym_value 1.346 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5WFY _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.400 _refine.ls_d_res_low 51.029 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 23228 _refine.ls_number_reflns_R_free 2308 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.75 _refine.ls_percent_reflns_R_free 5.10 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1443 _refine.ls_R_factor_R_free 0.1815 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1423 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details Random _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 18.36 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.18 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1055 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 6 _refine_hist.number_atoms_solvent 128 _refine_hist.number_atoms_total 1189 _refine_hist.d_res_high 1.400 _refine_hist.d_res_low 51.029 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 ? 1085 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.862 ? 1458 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 12.805 ? 418 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.072 ? 167 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 180 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.4002 1.4306 . . 160 2626 97.00 . . . 0.3322 . 0.3032 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.4306 1.4639 . . 130 2643 97.00 . . . 0.3951 . 0.2621 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.4639 1.5005 . . 128 2729 98.00 . . . 0.3012 . 0.2458 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.5005 1.5411 . . 156 2602 98.00 . . . 0.2489 . 0.2127 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.5411 1.5864 . . 161 2623 98.00 . . . 0.2228 . 0.1988 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.5864 1.6376 . . 131 2714 98.00 . . . 0.2393 . 0.1887 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.6376 1.6962 . . 124 2712 99.00 . . . 0.2421 . 0.1706 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.6962 1.7641 . . 139 2697 99.00 . . . 0.1953 . 0.1476 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7641 1.8444 . . 161 2675 99.00 . . . 0.1945 . 0.1341 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8444 1.9416 . . 133 2672 99.00 . . . 0.1850 . 0.1113 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9416 2.0633 . . 150 2717 100.00 . . . 0.1741 . 0.1073 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0633 2.2226 . . 134 2707 100.00 . . . 0.1850 . 0.1067 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2226 2.4462 . . 151 2688 100.00 . . . 0.1490 . 0.1081 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4462 2.8002 . . 132 2713 100.00 . . . 0.1793 . 0.1230 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8002 3.5278 . . 166 2705 100.00 . . . 0.1410 . 0.1293 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.5278 51.0629 . . 152 2689 100.00 . . . 0.1453 . 0.1455 . . . . . . . . . . # _struct.entry_id 5WFY _struct.title 'Crystal structure of DNA-binding domain of the bacteriophage T4 ligase' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5WFY _struct_keywords.text 'LIGASE-DNA COMPLEX, LIGASE' _struct_keywords.pdbx_keywords LIGASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DNLI_BPT4 _struct_ref.pdbx_db_accession P00970 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MILKILNEIASIGSTKQKQAILEKNKDNELLKRVYRLTYSRGLQYYIKKWPKPGIATQSFGMLTLTDMLDFIEFTLATRK LTGNAAIEELTGYITDGKKDDVEVLRRVMMRDLECGASVSIANKVWPGL ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5WFY _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 129 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00970 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 129 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 129 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5WFY GLU A 130 ? UNP P00970 ? ? 'expression tag' 130 1 1 5WFY HIS A 131 ? UNP P00970 ? ? 'expression tag' 131 2 1 5WFY HIS A 132 ? UNP P00970 ? ? 'expression tag' 132 3 1 5WFY HIS A 133 ? UNP P00970 ? ? 'expression tag' 133 4 1 5WFY HIS A 134 ? UNP P00970 ? ? 'expression tag' 134 5 1 5WFY HIS A 135 ? UNP P00970 ? ? 'expression tag' 135 6 1 5WFY HIS A 136 ? UNP P00970 ? ? 'expression tag' 136 7 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'native gel electrophoresis' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 MSE A 1 ? SER A 11 ? MSE A 1 SER A 11 1 ? 11 HELX_P HELX_P2 AA2 SER A 14 ? ASN A 25 ? SER A 14 ASN A 25 1 ? 12 HELX_P HELX_P3 AA3 ASN A 28 ? SER A 40 ? ASN A 28 SER A 40 1 ? 13 HELX_P HELX_P4 AA4 THR A 64 ? THR A 75 ? THR A 64 THR A 75 1 ? 12 HELX_P HELX_P5 AA5 THR A 82 ? GLY A 97 ? THR A 82 GLY A 97 1 ? 16 HELX_P HELX_P6 AA6 LYS A 98 ? ARG A 111 ? LYS A 98 ARG A 111 1 ? 14 HELX_P HELX_P7 AA7 SER A 118 ? TRP A 126 ? SER A 118 TRP A 126 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A MSE 1 C ? ? ? 1_555 A ILE 2 N ? ? A MSE 1 A ILE 2 1_555 ? ? ? ? ? ? ? 1.322 ? ? covale2 covale both ? A GLY 61 C ? ? ? 1_555 A MSE 62 N ? ? A GLY 61 A MSE 62 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale3 covale both ? A MSE 62 C ? ? ? 1_555 A LEU 63 N ? ? A MSE 62 A LEU 63 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale4 covale both ? A ASP 67 C ? ? ? 1_555 A MSE 68 N ? ? A ASP 67 A MSE 68 1_555 ? ? ? ? ? ? ? 1.320 ? ? covale5 covale both ? A MSE 68 C ? ? ? 1_555 A LEU 69 N ? ? A MSE 68 A LEU 69 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale6 covale both ? A VAL 108 C ? ? ? 1_555 A MSE 109 N A ? A VAL 108 A MSE 109 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale7 covale both ? A VAL 108 C ? ? ? 1_555 A MSE 109 N B ? A VAL 108 A MSE 109 1_555 ? ? ? ? ? ? ? 1.324 ? ? covale8 covale both ? A MSE 109 C A ? ? 1_555 A MSE 110 N ? ? A MSE 109 A MSE 110 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale9 covale both ? A MSE 109 C B ? ? 1_555 A MSE 110 N ? ? A MSE 109 A MSE 110 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale10 covale both ? A MSE 110 C ? ? ? 1_555 A ARG 111 N ? ? A MSE 110 A ARG 111 1_555 ? ? ? ? ? ? ? 1.337 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 MSE A 1 ? . . . . MSE A 1 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 2 MSE A 62 ? . . . . MSE A 62 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 3 MSE A 68 ? . . . . MSE A 68 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 4 MSE A 109 A . . . . MSE A 109 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 5 MSE A 109 B . . . . MSE A 109 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 6 MSE A 110 ? . . . . MSE A 110 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id GOL _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 6 _struct_site.details 'binding site for residue GOL A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 GLN A 44 ? GLN A 44 . ? 1_555 ? 2 AC1 6 TYR A 45 ? TYR A 45 . ? 1_555 ? 3 AC1 6 TYR A 46 ? TYR A 46 . ? 1_555 ? 4 AC1 6 ARG A 111 ? ARG A 111 . ? 1_555 ? 5 AC1 6 HOH C . ? HOH A 314 . ? 1_555 ? 6 AC1 6 HOH C . ? HOH A 321 . ? 1_555 ? # _pdbx_entry_details.entry_id 5WFY _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 396 ? ? O A HOH 419 ? ? 1.83 2 1 O A HOH 358 ? ? O A HOH 409 ? ? 1.99 3 1 O A HOH 332 ? ? O A HOH 358 ? ? 2.17 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 HZ2 A LYS 16 ? ? 1_555 O A HOH 362 ? ? 1_545 1.56 2 1 O A HOH 307 ? ? 1_555 O A HOH 358 ? ? 1_655 2.00 3 1 O A LYS 24 ? ? 1_555 NH2 A ARG 41 ? ? 1_455 2.19 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id SER _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 118 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -108.69 _pdbx_validate_torsion.psi -151.42 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 1 A MSE 1 ? MET 'modified residue' 2 A MSE 62 A MSE 62 ? MET 'modified residue' 3 A MSE 68 A MSE 68 ? MET 'modified residue' 4 A MSE 109 A MSE 109 ? MET 'modified residue' 5 A MSE 110 A MSE 110 ? MET 'modified residue' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 133 ? A HIS 133 2 1 Y 1 A HIS 134 ? A HIS 134 3 1 Y 1 A HIS 135 ? A HIS 135 4 1 Y 1 A HIS 136 ? A HIS 136 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 GOL C1 C N N 137 GOL O1 O N N 138 GOL C2 C N N 139 GOL O2 O N N 140 GOL C3 C N N 141 GOL O3 O N N 142 GOL H11 H N N 143 GOL H12 H N N 144 GOL HO1 H N N 145 GOL H2 H N N 146 GOL HO2 H N N 147 GOL H31 H N N 148 GOL H32 H N N 149 GOL HO3 H N N 150 HIS N N N N 151 HIS CA C N S 152 HIS C C N N 153 HIS O O N N 154 HIS CB C N N 155 HIS CG C Y N 156 HIS ND1 N Y N 157 HIS CD2 C Y N 158 HIS CE1 C Y N 159 HIS NE2 N Y N 160 HIS OXT O N N 161 HIS H H N N 162 HIS H2 H N N 163 HIS HA H N N 164 HIS HB2 H N N 165 HIS HB3 H N N 166 HIS HD1 H N N 167 HIS HD2 H N N 168 HIS HE1 H N N 169 HIS HE2 H N N 170 HIS HXT H N N 171 HOH O O N N 172 HOH H1 H N N 173 HOH H2 H N N 174 ILE N N N N 175 ILE CA C N S 176 ILE C C N N 177 ILE O O N N 178 ILE CB C N S 179 ILE CG1 C N N 180 ILE CG2 C N N 181 ILE CD1 C N N 182 ILE OXT O N N 183 ILE H H N N 184 ILE H2 H N N 185 ILE HA H N N 186 ILE HB H N N 187 ILE HG12 H N N 188 ILE HG13 H N N 189 ILE HG21 H N N 190 ILE HG22 H N N 191 ILE HG23 H N N 192 ILE HD11 H N N 193 ILE HD12 H N N 194 ILE HD13 H N N 195 ILE HXT H N N 196 LEU N N N N 197 LEU CA C N S 198 LEU C C N N 199 LEU O O N N 200 LEU CB C N N 201 LEU CG C N N 202 LEU CD1 C N N 203 LEU CD2 C N N 204 LEU OXT O N N 205 LEU H H N N 206 LEU H2 H N N 207 LEU HA H N N 208 LEU HB2 H N N 209 LEU HB3 H N N 210 LEU HG H N N 211 LEU HD11 H N N 212 LEU HD12 H N N 213 LEU HD13 H N N 214 LEU HD21 H N N 215 LEU HD22 H N N 216 LEU HD23 H N N 217 LEU HXT H N N 218 LYS N N N N 219 LYS CA C N S 220 LYS C C N N 221 LYS O O N N 222 LYS CB C N N 223 LYS CG C N N 224 LYS CD C N N 225 LYS CE C N N 226 LYS NZ N N N 227 LYS OXT O N N 228 LYS H H N N 229 LYS H2 H N N 230 LYS HA H N N 231 LYS HB2 H N N 232 LYS HB3 H N N 233 LYS HG2 H N N 234 LYS HG3 H N N 235 LYS HD2 H N N 236 LYS HD3 H N N 237 LYS HE2 H N N 238 LYS HE3 H N N 239 LYS HZ1 H N N 240 LYS HZ2 H N N 241 LYS HZ3 H N N 242 LYS HXT H N N 243 MSE N N N N 244 MSE CA C N S 245 MSE C C N N 246 MSE O O N N 247 MSE OXT O N N 248 MSE CB C N N 249 MSE CG C N N 250 MSE SE SE N N 251 MSE CE C N N 252 MSE H H N N 253 MSE H2 H N N 254 MSE HA H N N 255 MSE HXT H N N 256 MSE HB2 H N N 257 MSE HB3 H N N 258 MSE HG2 H N N 259 MSE HG3 H N N 260 MSE HE1 H N N 261 MSE HE2 H N N 262 MSE HE3 H N N 263 PHE N N N N 264 PHE CA C N S 265 PHE C C N N 266 PHE O O N N 267 PHE CB C N N 268 PHE CG C Y N 269 PHE CD1 C Y N 270 PHE CD2 C Y N 271 PHE CE1 C Y N 272 PHE CE2 C Y N 273 PHE CZ C Y N 274 PHE OXT O N N 275 PHE H H N N 276 PHE H2 H N N 277 PHE HA H N N 278 PHE HB2 H N N 279 PHE HB3 H N N 280 PHE HD1 H N N 281 PHE HD2 H N N 282 PHE HE1 H N N 283 PHE HE2 H N N 284 PHE HZ H N N 285 PHE HXT H N N 286 PRO N N N N 287 PRO CA C N S 288 PRO C C N N 289 PRO O O N N 290 PRO CB C N N 291 PRO CG C N N 292 PRO CD C N N 293 PRO OXT O N N 294 PRO H H N N 295 PRO HA H N N 296 PRO HB2 H N N 297 PRO HB3 H N N 298 PRO HG2 H N N 299 PRO HG3 H N N 300 PRO HD2 H N N 301 PRO HD3 H N N 302 PRO HXT H N N 303 SER N N N N 304 SER CA C N S 305 SER C C N N 306 SER O O N N 307 SER CB C N N 308 SER OG O N N 309 SER OXT O N N 310 SER H H N N 311 SER H2 H N N 312 SER HA H N N 313 SER HB2 H N N 314 SER HB3 H N N 315 SER HG H N N 316 SER HXT H N N 317 THR N N N N 318 THR CA C N S 319 THR C C N N 320 THR O O N N 321 THR CB C N R 322 THR OG1 O N N 323 THR CG2 C N N 324 THR OXT O N N 325 THR H H N N 326 THR H2 H N N 327 THR HA H N N 328 THR HB H N N 329 THR HG1 H N N 330 THR HG21 H N N 331 THR HG22 H N N 332 THR HG23 H N N 333 THR HXT H N N 334 TRP N N N N 335 TRP CA C N S 336 TRP C C N N 337 TRP O O N N 338 TRP CB C N N 339 TRP CG C Y N 340 TRP CD1 C Y N 341 TRP CD2 C Y N 342 TRP NE1 N Y N 343 TRP CE2 C Y N 344 TRP CE3 C Y N 345 TRP CZ2 C Y N 346 TRP CZ3 C Y N 347 TRP CH2 C Y N 348 TRP OXT O N N 349 TRP H H N N 350 TRP H2 H N N 351 TRP HA H N N 352 TRP HB2 H N N 353 TRP HB3 H N N 354 TRP HD1 H N N 355 TRP HE1 H N N 356 TRP HE3 H N N 357 TRP HZ2 H N N 358 TRP HZ3 H N N 359 TRP HH2 H N N 360 TRP HXT H N N 361 TYR N N N N 362 TYR CA C N S 363 TYR C C N N 364 TYR O O N N 365 TYR CB C N N 366 TYR CG C Y N 367 TYR CD1 C Y N 368 TYR CD2 C Y N 369 TYR CE1 C Y N 370 TYR CE2 C Y N 371 TYR CZ C Y N 372 TYR OH O N N 373 TYR OXT O N N 374 TYR H H N N 375 TYR H2 H N N 376 TYR HA H N N 377 TYR HB2 H N N 378 TYR HB3 H N N 379 TYR HD1 H N N 380 TYR HD2 H N N 381 TYR HE1 H N N 382 TYR HE2 H N N 383 TYR HH H N N 384 TYR HXT H N N 385 VAL N N N N 386 VAL CA C N S 387 VAL C C N N 388 VAL O O N N 389 VAL CB C N N 390 VAL CG1 C N N 391 VAL CG2 C N N 392 VAL OXT O N N 393 VAL H H N N 394 VAL H2 H N N 395 VAL HA H N N 396 VAL HB H N N 397 VAL HG11 H N N 398 VAL HG12 H N N 399 VAL HG13 H N N 400 VAL HG21 H N N 401 VAL HG22 H N N 402 VAL HG23 H N N 403 VAL HXT H N N 404 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 GOL C1 O1 sing N N 129 GOL C1 C2 sing N N 130 GOL C1 H11 sing N N 131 GOL C1 H12 sing N N 132 GOL O1 HO1 sing N N 133 GOL C2 O2 sing N N 134 GOL C2 C3 sing N N 135 GOL C2 H2 sing N N 136 GOL O2 HO2 sing N N 137 GOL C3 O3 sing N N 138 GOL C3 H31 sing N N 139 GOL C3 H32 sing N N 140 GOL O3 HO3 sing N N 141 HIS N CA sing N N 142 HIS N H sing N N 143 HIS N H2 sing N N 144 HIS CA C sing N N 145 HIS CA CB sing N N 146 HIS CA HA sing N N 147 HIS C O doub N N 148 HIS C OXT sing N N 149 HIS CB CG sing N N 150 HIS CB HB2 sing N N 151 HIS CB HB3 sing N N 152 HIS CG ND1 sing Y N 153 HIS CG CD2 doub Y N 154 HIS ND1 CE1 doub Y N 155 HIS ND1 HD1 sing N N 156 HIS CD2 NE2 sing Y N 157 HIS CD2 HD2 sing N N 158 HIS CE1 NE2 sing Y N 159 HIS CE1 HE1 sing N N 160 HIS NE2 HE2 sing N N 161 HIS OXT HXT sing N N 162 HOH O H1 sing N N 163 HOH O H2 sing N N 164 ILE N CA sing N N 165 ILE N H sing N N 166 ILE N H2 sing N N 167 ILE CA C sing N N 168 ILE CA CB sing N N 169 ILE CA HA sing N N 170 ILE C O doub N N 171 ILE C OXT sing N N 172 ILE CB CG1 sing N N 173 ILE CB CG2 sing N N 174 ILE CB HB sing N N 175 ILE CG1 CD1 sing N N 176 ILE CG1 HG12 sing N N 177 ILE CG1 HG13 sing N N 178 ILE CG2 HG21 sing N N 179 ILE CG2 HG22 sing N N 180 ILE CG2 HG23 sing N N 181 ILE CD1 HD11 sing N N 182 ILE CD1 HD12 sing N N 183 ILE CD1 HD13 sing N N 184 ILE OXT HXT sing N N 185 LEU N CA sing N N 186 LEU N H sing N N 187 LEU N H2 sing N N 188 LEU CA C sing N N 189 LEU CA CB sing N N 190 LEU CA HA sing N N 191 LEU C O doub N N 192 LEU C OXT sing N N 193 LEU CB CG sing N N 194 LEU CB HB2 sing N N 195 LEU CB HB3 sing N N 196 LEU CG CD1 sing N N 197 LEU CG CD2 sing N N 198 LEU CG HG sing N N 199 LEU CD1 HD11 sing N N 200 LEU CD1 HD12 sing N N 201 LEU CD1 HD13 sing N N 202 LEU CD2 HD21 sing N N 203 LEU CD2 HD22 sing N N 204 LEU CD2 HD23 sing N N 205 LEU OXT HXT sing N N 206 LYS N CA sing N N 207 LYS N H sing N N 208 LYS N H2 sing N N 209 LYS CA C sing N N 210 LYS CA CB sing N N 211 LYS CA HA sing N N 212 LYS C O doub N N 213 LYS C OXT sing N N 214 LYS CB CG sing N N 215 LYS CB HB2 sing N N 216 LYS CB HB3 sing N N 217 LYS CG CD sing N N 218 LYS CG HG2 sing N N 219 LYS CG HG3 sing N N 220 LYS CD CE sing N N 221 LYS CD HD2 sing N N 222 LYS CD HD3 sing N N 223 LYS CE NZ sing N N 224 LYS CE HE2 sing N N 225 LYS CE HE3 sing N N 226 LYS NZ HZ1 sing N N 227 LYS NZ HZ2 sing N N 228 LYS NZ HZ3 sing N N 229 LYS OXT HXT sing N N 230 MSE N CA sing N N 231 MSE N H sing N N 232 MSE N H2 sing N N 233 MSE CA C sing N N 234 MSE CA CB sing N N 235 MSE CA HA sing N N 236 MSE C O doub N N 237 MSE C OXT sing N N 238 MSE OXT HXT sing N N 239 MSE CB CG sing N N 240 MSE CB HB2 sing N N 241 MSE CB HB3 sing N N 242 MSE CG SE sing N N 243 MSE CG HG2 sing N N 244 MSE CG HG3 sing N N 245 MSE SE CE sing N N 246 MSE CE HE1 sing N N 247 MSE CE HE2 sing N N 248 MSE CE HE3 sing N N 249 PHE N CA sing N N 250 PHE N H sing N N 251 PHE N H2 sing N N 252 PHE CA C sing N N 253 PHE CA CB sing N N 254 PHE CA HA sing N N 255 PHE C O doub N N 256 PHE C OXT sing N N 257 PHE CB CG sing N N 258 PHE CB HB2 sing N N 259 PHE CB HB3 sing N N 260 PHE CG CD1 doub Y N 261 PHE CG CD2 sing Y N 262 PHE CD1 CE1 sing Y N 263 PHE CD1 HD1 sing N N 264 PHE CD2 CE2 doub Y N 265 PHE CD2 HD2 sing N N 266 PHE CE1 CZ doub Y N 267 PHE CE1 HE1 sing N N 268 PHE CE2 CZ sing Y N 269 PHE CE2 HE2 sing N N 270 PHE CZ HZ sing N N 271 PHE OXT HXT sing N N 272 PRO N CA sing N N 273 PRO N CD sing N N 274 PRO N H sing N N 275 PRO CA C sing N N 276 PRO CA CB sing N N 277 PRO CA HA sing N N 278 PRO C O doub N N 279 PRO C OXT sing N N 280 PRO CB CG sing N N 281 PRO CB HB2 sing N N 282 PRO CB HB3 sing N N 283 PRO CG CD sing N N 284 PRO CG HG2 sing N N 285 PRO CG HG3 sing N N 286 PRO CD HD2 sing N N 287 PRO CD HD3 sing N N 288 PRO OXT HXT sing N N 289 SER N CA sing N N 290 SER N H sing N N 291 SER N H2 sing N N 292 SER CA C sing N N 293 SER CA CB sing N N 294 SER CA HA sing N N 295 SER C O doub N N 296 SER C OXT sing N N 297 SER CB OG sing N N 298 SER CB HB2 sing N N 299 SER CB HB3 sing N N 300 SER OG HG sing N N 301 SER OXT HXT sing N N 302 THR N CA sing N N 303 THR N H sing N N 304 THR N H2 sing N N 305 THR CA C sing N N 306 THR CA CB sing N N 307 THR CA HA sing N N 308 THR C O doub N N 309 THR C OXT sing N N 310 THR CB OG1 sing N N 311 THR CB CG2 sing N N 312 THR CB HB sing N N 313 THR OG1 HG1 sing N N 314 THR CG2 HG21 sing N N 315 THR CG2 HG22 sing N N 316 THR CG2 HG23 sing N N 317 THR OXT HXT sing N N 318 TRP N CA sing N N 319 TRP N H sing N N 320 TRP N H2 sing N N 321 TRP CA C sing N N 322 TRP CA CB sing N N 323 TRP CA HA sing N N 324 TRP C O doub N N 325 TRP C OXT sing N N 326 TRP CB CG sing N N 327 TRP CB HB2 sing N N 328 TRP CB HB3 sing N N 329 TRP CG CD1 doub Y N 330 TRP CG CD2 sing Y N 331 TRP CD1 NE1 sing Y N 332 TRP CD1 HD1 sing N N 333 TRP CD2 CE2 doub Y N 334 TRP CD2 CE3 sing Y N 335 TRP NE1 CE2 sing Y N 336 TRP NE1 HE1 sing N N 337 TRP CE2 CZ2 sing Y N 338 TRP CE3 CZ3 doub Y N 339 TRP CE3 HE3 sing N N 340 TRP CZ2 CH2 doub Y N 341 TRP CZ2 HZ2 sing N N 342 TRP CZ3 CH2 sing Y N 343 TRP CZ3 HZ3 sing N N 344 TRP CH2 HH2 sing N N 345 TRP OXT HXT sing N N 346 TYR N CA sing N N 347 TYR N H sing N N 348 TYR N H2 sing N N 349 TYR CA C sing N N 350 TYR CA CB sing N N 351 TYR CA HA sing N N 352 TYR C O doub N N 353 TYR C OXT sing N N 354 TYR CB CG sing N N 355 TYR CB HB2 sing N N 356 TYR CB HB3 sing N N 357 TYR CG CD1 doub Y N 358 TYR CG CD2 sing Y N 359 TYR CD1 CE1 sing Y N 360 TYR CD1 HD1 sing N N 361 TYR CD2 CE2 doub Y N 362 TYR CD2 HD2 sing N N 363 TYR CE1 CZ doub Y N 364 TYR CE1 HE1 sing N N 365 TYR CE2 CZ sing Y N 366 TYR CE2 HE2 sing N N 367 TYR CZ OH sing N N 368 TYR OH HH sing N N 369 TYR OXT HXT sing N N 370 VAL N CA sing N N 371 VAL N H sing N N 372 VAL N H2 sing N N 373 VAL CA C sing N N 374 VAL CA CB sing N N 375 VAL CA HA sing N N 376 VAL C O doub N N 377 VAL C OXT sing N N 378 VAL CB CG1 sing N N 379 VAL CB CG2 sing N N 380 VAL CB HB sing N N 381 VAL CG1 HG11 sing N N 382 VAL CG1 HG12 sing N N 383 VAL CG1 HG13 sing N N 384 VAL CG2 HG21 sing N N 385 VAL CG2 HG22 sing N N 386 VAL CG2 HG23 sing N N 387 VAL OXT HXT sing N N 388 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number GM118047 _pdbx_audit_support.ordinal 1 # _atom_sites.entry_id 5WFY _atom_sites.fract_transf_matrix[1][1] 0.034709 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.001425 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.024509 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019597 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S SE # loop_