data_5WPN # _entry.id 5WPN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.389 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5WPN pdb_00005wpn 10.2210/pdb5wpn/pdb WWPDB D_1000228934 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-12-06 2 'Structure model' 1 1 2018-01-03 3 'Structure model' 1 2 2024-03-13 4 'Structure model' 1 3 2024-04-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_struct_conn_angle 6 3 'Structure model' struct_conn 7 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 3 'Structure model' '_database_2.pdbx_DOI' 5 3 'Structure model' '_database_2.pdbx_database_accession' 6 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 7 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 8 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 9 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 10 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 12 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_symmetry' 13 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_comp_id' 14 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 15 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_alt_id' 16 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 17 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_atom_id' 18 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_comp_id' 19 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_symmetry' 20 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 21 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 22 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 23 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 24 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 25 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 26 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry' 27 3 'Structure model' '_pdbx_struct_conn_angle.value' 28 3 'Structure model' '_struct_conn.pdbx_dist_value' 29 3 'Structure model' '_struct_conn.pdbx_ptnr1_label_alt_id' 30 3 'Structure model' '_struct_conn.pdbx_ptnr2_label_alt_id' 31 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 32 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 33 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 34 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 35 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 36 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 37 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 38 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 39 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 40 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 41 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 42 3 'Structure model' '_struct_conn.ptnr2_symmetry' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5WPN _pdbx_database_status.recvd_initial_deposition_date 2017-08-05 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'De Meulenaere, E.' 1 ? 'Bailey, J.B.' 2 ? 'Tezcan, F.A.' 3 ? 'Deheyn, D.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Biochem. J.' _citation.journal_id_ASTM BIJOAK _citation.journal_id_CSD 0043 _citation.journal_id_ISSN 1470-8728 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 474 _citation.language ? _citation.page_first 4193 _citation.page_last 4206 _citation.title 'First biochemical and crystallographic characterization of a fast-performing ferritin from a marine invertebrate.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1042/BCJ20170681 _citation.pdbx_database_id_PubMed 29127253 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'De Meulenaere, E.' 1 ? primary 'Bailey, J.B.' 2 ? primary 'Tezcan, F.A.' 3 ? primary 'Deheyn, D.D.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Ferritin 19824.100 1 1.16.3.1 N82D ? ? 2 non-polymer syn 'ZINC ION' 65.409 12 ? ? ? ? 3 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 4 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 5 non-polymer syn 'DI(HYDROXYETHYL)ETHER' 106.120 2 ? ? ? ? 6 non-polymer syn 1,2-ETHANEDIOL 62.068 1 ? ? ? ? 7 water nat water 18.015 288 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AQTQPRQNYASDVEAGINKQINLELYASYVYQSMAWFFDRDDIALKGFHKFFKHQSEEEREHAEKLMQYQNKRGGRIVLQ DIQKPERDEWGTGLEAMQVALALEKNVNQSLLDLHKVGAGHDDAHLCDFLEEHYLEEQVKSIKELSDYVTNLKRVGPGLG EYMFDKESLSS ; _entity_poly.pdbx_seq_one_letter_code_can ;AQTQPRQNYASDVEAGINKQINLELYASYVYQSMAWFFDRDDIALKGFHKFFKHQSEEEREHAEKLMQYQNKRGGRIVLQ DIQKPERDEWGTGLEAMQVALALEKNVNQSLLDLHKVGAGHDDAHLCDFLEEHYLEEQVKSIKELSDYVTNLKRVGPGLG EYMFDKESLSS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 'CALCIUM ION' CA 4 'CHLORIDE ION' CL 5 'DI(HYDROXYETHYL)ETHER' PEG 6 1,2-ETHANEDIOL EDO 7 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 GLN n 1 3 THR n 1 4 GLN n 1 5 PRO n 1 6 ARG n 1 7 GLN n 1 8 ASN n 1 9 TYR n 1 10 ALA n 1 11 SER n 1 12 ASP n 1 13 VAL n 1 14 GLU n 1 15 ALA n 1 16 GLY n 1 17 ILE n 1 18 ASN n 1 19 LYS n 1 20 GLN n 1 21 ILE n 1 22 ASN n 1 23 LEU n 1 24 GLU n 1 25 LEU n 1 26 TYR n 1 27 ALA n 1 28 SER n 1 29 TYR n 1 30 VAL n 1 31 TYR n 1 32 GLN n 1 33 SER n 1 34 MET n 1 35 ALA n 1 36 TRP n 1 37 PHE n 1 38 PHE n 1 39 ASP n 1 40 ARG n 1 41 ASP n 1 42 ASP n 1 43 ILE n 1 44 ALA n 1 45 LEU n 1 46 LYS n 1 47 GLY n 1 48 PHE n 1 49 HIS n 1 50 LYS n 1 51 PHE n 1 52 PHE n 1 53 LYS n 1 54 HIS n 1 55 GLN n 1 56 SER n 1 57 GLU n 1 58 GLU n 1 59 GLU n 1 60 ARG n 1 61 GLU n 1 62 HIS n 1 63 ALA n 1 64 GLU n 1 65 LYS n 1 66 LEU n 1 67 MET n 1 68 GLN n 1 69 TYR n 1 70 GLN n 1 71 ASN n 1 72 LYS n 1 73 ARG n 1 74 GLY n 1 75 GLY n 1 76 ARG n 1 77 ILE n 1 78 VAL n 1 79 LEU n 1 80 GLN n 1 81 ASP n 1 82 ILE n 1 83 GLN n 1 84 LYS n 1 85 PRO n 1 86 GLU n 1 87 ARG n 1 88 ASP n 1 89 GLU n 1 90 TRP n 1 91 GLY n 1 92 THR n 1 93 GLY n 1 94 LEU n 1 95 GLU n 1 96 ALA n 1 97 MET n 1 98 GLN n 1 99 VAL n 1 100 ALA n 1 101 LEU n 1 102 ALA n 1 103 LEU n 1 104 GLU n 1 105 LYS n 1 106 ASN n 1 107 VAL n 1 108 ASN n 1 109 GLN n 1 110 SER n 1 111 LEU n 1 112 LEU n 1 113 ASP n 1 114 LEU n 1 115 HIS n 1 116 LYS n 1 117 VAL n 1 118 GLY n 1 119 ALA n 1 120 GLY n 1 121 HIS n 1 122 ASP n 1 123 ASP n 1 124 ALA n 1 125 HIS n 1 126 LEU n 1 127 CYS n 1 128 ASP n 1 129 PHE n 1 130 LEU n 1 131 GLU n 1 132 GLU n 1 133 HIS n 1 134 TYR n 1 135 LEU n 1 136 GLU n 1 137 GLU n 1 138 GLN n 1 139 VAL n 1 140 LYS n 1 141 SER n 1 142 ILE n 1 143 LYS n 1 144 GLU n 1 145 LEU n 1 146 SER n 1 147 ASP n 1 148 TYR n 1 149 VAL n 1 150 THR n 1 151 ASN n 1 152 LEU n 1 153 LYS n 1 154 ARG n 1 155 VAL n 1 156 GLY n 1 157 PRO n 1 158 GLY n 1 159 LEU n 1 160 GLY n 1 161 GLU n 1 162 TYR n 1 163 MET n 1 164 PHE n 1 165 ASP n 1 166 LYS n 1 167 GLU n 1 168 SER n 1 169 LEU n 1 170 SER n 1 171 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 171 _entity_src_gen.gene_src_common_name 'Parchment tube worm' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Chaetopterus variopedatus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 34590 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PEG non-polymer . 'DI(HYDROXYETHYL)ETHER' ? 'C4 H10 O3' 106.120 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 ? ? ? A . n A 1 2 GLN 2 2 3 GLN GLN A . n A 1 3 THR 3 3 4 THR THR A . n A 1 4 GLN 4 4 5 GLN GLN A . n A 1 5 PRO 5 5 6 PRO PRO A . n A 1 6 ARG 6 6 7 ARG ARG A . n A 1 7 GLN 7 7 8 GLN GLN A . n A 1 8 ASN 8 8 9 ASN ASN A . n A 1 9 TYR 9 9 10 TYR TYR A . n A 1 10 ALA 10 10 11 ALA ALA A . n A 1 11 SER 11 11 12 SER SER A . n A 1 12 ASP 12 12 13 ASP ASP A . n A 1 13 VAL 13 13 14 VAL VAL A . n A 1 14 GLU 14 14 15 GLU GLU A . n A 1 15 ALA 15 15 16 ALA ALA A . n A 1 16 GLY 16 16 17 GLY GLY A . n A 1 17 ILE 17 17 18 ILE ILE A . n A 1 18 ASN 18 18 19 ASN ASN A . n A 1 19 LYS 19 19 20 LYS LYS A . n A 1 20 GLN 20 20 21 GLN GLN A . n A 1 21 ILE 21 21 22 ILE ILE A . n A 1 22 ASN 22 22 23 ASN ASN A . n A 1 23 LEU 23 23 24 LEU LEU A . n A 1 24 GLU 24 24 25 GLU GLU A . n A 1 25 LEU 25 25 26 LEU LEU A . n A 1 26 TYR 26 26 27 TYR TYR A . n A 1 27 ALA 27 27 28 ALA ALA A . n A 1 28 SER 28 28 29 SER SER A . n A 1 29 TYR 29 29 30 TYR TYR A . n A 1 30 VAL 30 30 31 VAL VAL A . n A 1 31 TYR 31 31 32 TYR TYR A . n A 1 32 GLN 32 32 33 GLN GLN A . n A 1 33 SER 33 33 34 SER SER A . n A 1 34 MET 34 34 35 MET MET A . n A 1 35 ALA 35 35 36 ALA ALA A . n A 1 36 TRP 36 36 37 TRP TRP A . n A 1 37 PHE 37 37 38 PHE PHE A . n A 1 38 PHE 38 38 39 PHE PHE A . n A 1 39 ASP 39 39 40 ASP ASP A . n A 1 40 ARG 40 40 41 ARG ARG A . n A 1 41 ASP 41 41 42 ASP ASP A . n A 1 42 ASP 42 42 43 ASP ASP A . n A 1 43 ILE 43 43 44 ILE ILE A . n A 1 44 ALA 44 44 45 ALA ALA A . n A 1 45 LEU 45 45 46 LEU LEU A . n A 1 46 LYS 46 46 47 LYS LYS A . n A 1 47 GLY 47 47 48 GLY GLY A . n A 1 48 PHE 48 48 49 PHE PHE A . n A 1 49 HIS 49 49 50 HIS HIS A . n A 1 50 LYS 50 50 51 LYS LYS A . n A 1 51 PHE 51 51 52 PHE PHE A . n A 1 52 PHE 52 52 53 PHE PHE A . n A 1 53 LYS 53 53 54 LYS LYS A . n A 1 54 HIS 54 54 55 HIS HIS A . n A 1 55 GLN 55 55 56 GLN GLN A . n A 1 56 SER 56 56 57 SER SER A . n A 1 57 GLU 57 57 58 GLU GLU A . n A 1 58 GLU 58 58 59 GLU GLU A . n A 1 59 GLU 59 59 60 GLU GLU A . n A 1 60 ARG 60 60 61 ARG ARG A . n A 1 61 GLU 61 61 62 GLU GLU A . n A 1 62 HIS 62 62 63 HIS HIS A . n A 1 63 ALA 63 63 64 ALA ALA A . n A 1 64 GLU 64 64 65 GLU GLU A . n A 1 65 LYS 65 65 66 LYS LYS A . n A 1 66 LEU 66 66 67 LEU LEU A . n A 1 67 MET 67 67 68 MET MET A . n A 1 68 GLN 68 68 69 GLN GLN A . n A 1 69 TYR 69 69 70 TYR TYR A . n A 1 70 GLN 70 70 71 GLN GLN A . n A 1 71 ASN 71 71 72 ASN ASN A . n A 1 72 LYS 72 72 73 LYS LYS A . n A 1 73 ARG 73 73 74 ARG ARG A . n A 1 74 GLY 74 74 75 GLY GLY A . n A 1 75 GLY 75 75 76 GLY GLY A . n A 1 76 ARG 76 76 77 ARG ARG A . n A 1 77 ILE 77 77 78 ILE ILE A . n A 1 78 VAL 78 78 79 VAL VAL A . n A 1 79 LEU 79 79 80 LEU LEU A . n A 1 80 GLN 80 80 81 GLN GLN A . n A 1 81 ASP 81 81 82 ASP ASP A . n A 1 82 ILE 82 82 83 ILE ILE A . n A 1 83 GLN 83 83 84 GLN GLN A . n A 1 84 LYS 84 84 85 LYS LYS A . n A 1 85 PRO 85 85 86 PRO PRO A . n A 1 86 GLU 86 86 87 GLU GLU A . n A 1 87 ARG 87 87 88 ARG ARG A . n A 1 88 ASP 88 88 89 ASP ASP A . n A 1 89 GLU 89 89 90 GLU GLU A . n A 1 90 TRP 90 90 91 TRP TRP A . n A 1 91 GLY 91 91 92 GLY GLY A . n A 1 92 THR 92 92 93 THR THR A . n A 1 93 GLY 93 93 94 GLY GLY A . n A 1 94 LEU 94 94 95 LEU LEU A . n A 1 95 GLU 95 95 96 GLU GLU A . n A 1 96 ALA 96 96 97 ALA ALA A . n A 1 97 MET 97 97 98 MET MET A . n A 1 98 GLN 98 98 99 GLN GLN A . n A 1 99 VAL 99 99 100 VAL VAL A . n A 1 100 ALA 100 100 101 ALA ALA A . n A 1 101 LEU 101 101 102 LEU LEU A . n A 1 102 ALA 102 102 103 ALA ALA A . n A 1 103 LEU 103 103 104 LEU LEU A . n A 1 104 GLU 104 104 105 GLU GLU A . n A 1 105 LYS 105 105 106 LYS LYS A . n A 1 106 ASN 106 106 107 ASN ASN A . n A 1 107 VAL 107 107 108 VAL VAL A . n A 1 108 ASN 108 108 109 ASN ASN A . n A 1 109 GLN 109 109 110 GLN GLN A . n A 1 110 SER 110 110 111 SER SER A . n A 1 111 LEU 111 111 112 LEU LEU A . n A 1 112 LEU 112 112 113 LEU LEU A . n A 1 113 ASP 113 113 114 ASP ASP A . n A 1 114 LEU 114 114 115 LEU LEU A . n A 1 115 HIS 115 115 116 HIS HIS A . n A 1 116 LYS 116 116 117 LYS LYS A . n A 1 117 VAL 117 117 118 VAL VAL A . n A 1 118 GLY 118 118 119 GLY GLY A . n A 1 119 ALA 119 119 120 ALA ALA A . n A 1 120 GLY 120 120 121 GLY GLY A . n A 1 121 HIS 121 121 122 HIS HIS A . n A 1 122 ASP 122 122 123 ASP ASP A . n A 1 123 ASP 123 123 124 ASP ASP A . n A 1 124 ALA 124 124 125 ALA ALA A . n A 1 125 HIS 125 125 126 HIS HIS A . n A 1 126 LEU 126 126 127 LEU LEU A . n A 1 127 CYS 127 127 128 CYS CYS A . n A 1 128 ASP 128 128 129 ASP ASP A . n A 1 129 PHE 129 129 130 PHE PHE A . n A 1 130 LEU 130 130 131 LEU LEU A . n A 1 131 GLU 131 131 132 GLU GLU A . n A 1 132 GLU 132 132 133 GLU GLU A . n A 1 133 HIS 133 133 134 HIS HIS A . n A 1 134 TYR 134 134 135 TYR TYR A . n A 1 135 LEU 135 135 136 LEU LEU A . n A 1 136 GLU 136 136 137 GLU GLU A . n A 1 137 GLU 137 137 138 GLU GLU A . n A 1 138 GLN 138 138 139 GLN GLN A . n A 1 139 VAL 139 139 140 VAL VAL A . n A 1 140 LYS 140 140 141 LYS LYS A . n A 1 141 SER 141 141 142 SER SER A . n A 1 142 ILE 142 142 143 ILE ILE A . n A 1 143 LYS 143 143 144 LYS LYS A . n A 1 144 GLU 144 144 145 GLU GLU A . n A 1 145 LEU 145 145 146 LEU LEU A . n A 1 146 SER 146 146 147 SER SER A . n A 1 147 ASP 147 147 148 ASP ASP A . n A 1 148 TYR 148 148 149 TYR TYR A . n A 1 149 VAL 149 149 150 VAL VAL A . n A 1 150 THR 150 150 151 THR THR A . n A 1 151 ASN 151 151 152 ASN ASN A . n A 1 152 LEU 152 152 153 LEU LEU A . n A 1 153 LYS 153 153 154 LYS LYS A . n A 1 154 ARG 154 154 155 ARG ARG A . n A 1 155 VAL 155 155 156 VAL VAL A . n A 1 156 GLY 156 156 157 GLY GLY A . n A 1 157 PRO 157 157 158 PRO PRO A . n A 1 158 GLY 158 158 159 GLY GLY A . n A 1 159 LEU 159 159 160 LEU LEU A . n A 1 160 GLY 160 160 161 GLY GLY A . n A 1 161 GLU 161 161 162 GLU GLU A . n A 1 162 TYR 162 162 163 TYR TYR A . n A 1 163 MET 163 163 164 MET MET A . n A 1 164 PHE 164 164 165 PHE PHE A . n A 1 165 ASP 165 165 166 ASP ASP A . n A 1 166 LYS 166 166 167 LYS LYS A . n A 1 167 GLU 167 167 168 GLU GLU A . n A 1 168 SER 168 168 169 SER SER A . n A 1 169 LEU 169 169 170 LEU LEU A . n A 1 170 SER 170 170 171 SER SER A . n A 1 171 SER 171 171 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 1 ZN ZN A . C 2 ZN 1 202 2 ZN ZN A . D 2 ZN 1 203 3 ZN ZN A . E 2 ZN 1 204 4 ZN ZN A . F 2 ZN 1 205 6 ZN ZN A . G 2 ZN 1 206 7 ZN ZN A . H 2 ZN 1 207 8 ZN ZN A . I 2 ZN 1 208 9 ZN ZN A . J 2 ZN 1 209 10 ZN ZN A . K 2 ZN 1 210 12 ZN ZN A . L 2 ZN 1 211 13 ZN ZN A . M 2 ZN 1 212 14 ZN ZN A . N 3 CA 1 213 15 CA CA A . O 4 CL 1 214 1 CL CL A . P 5 PEG 1 215 1 PEG PEG A . Q 5 PEG 1 216 2 PEG PEG A . R 6 EDO 1 217 2 EDO EDO A . S 7 HOH 1 301 138 HOH HOH A . S 7 HOH 2 302 322 HOH HOH A . S 7 HOH 3 303 349 HOH HOH A . S 7 HOH 4 304 320 HOH HOH A . S 7 HOH 5 305 321 HOH HOH A . S 7 HOH 6 306 11 HOH HOH A . S 7 HOH 7 307 318 HOH HOH A . S 7 HOH 8 308 101 HOH HOH A . S 7 HOH 9 309 108 HOH HOH A . S 7 HOH 10 310 264 HOH HOH A . S 7 HOH 11 311 119 HOH HOH A . S 7 HOH 12 312 291 HOH HOH A . S 7 HOH 13 313 180 HOH HOH A . S 7 HOH 14 314 319 HOH HOH A . S 7 HOH 15 315 257 HOH HOH A . S 7 HOH 16 316 170 HOH HOH A . S 7 HOH 17 317 155 HOH HOH A . S 7 HOH 18 318 183 HOH HOH A . S 7 HOH 19 319 146 HOH HOH A . S 7 HOH 20 320 104 HOH HOH A . S 7 HOH 21 321 91 HOH HOH A . S 7 HOH 22 322 348 HOH HOH A . S 7 HOH 23 323 222 HOH HOH A . S 7 HOH 24 324 190 HOH HOH A . S 7 HOH 25 325 172 HOH HOH A . S 7 HOH 26 326 33 HOH HOH A . S 7 HOH 27 327 117 HOH HOH A . S 7 HOH 28 328 10 HOH HOH A . S 7 HOH 29 329 96 HOH HOH A . S 7 HOH 30 330 136 HOH HOH A . S 7 HOH 31 331 153 HOH HOH A . S 7 HOH 32 332 156 HOH HOH A . S 7 HOH 33 333 287 HOH HOH A . S 7 HOH 34 334 128 HOH HOH A . S 7 HOH 35 335 28 HOH HOH A . S 7 HOH 36 336 292 HOH HOH A . S 7 HOH 37 337 97 HOH HOH A . S 7 HOH 38 338 312 HOH HOH A . S 7 HOH 39 339 126 HOH HOH A . S 7 HOH 40 340 56 HOH HOH A . S 7 HOH 41 341 206 HOH HOH A . S 7 HOH 42 342 231 HOH HOH A . S 7 HOH 43 343 39 HOH HOH A . S 7 HOH 44 344 81 HOH HOH A . S 7 HOH 45 345 7 HOH HOH A . S 7 HOH 46 346 150 HOH HOH A . S 7 HOH 47 347 37 HOH HOH A . S 7 HOH 48 348 88 HOH HOH A . S 7 HOH 49 349 13 HOH HOH A . S 7 HOH 50 350 107 HOH HOH A . S 7 HOH 51 351 35 HOH HOH A . S 7 HOH 52 352 83 HOH HOH A . S 7 HOH 53 353 324 HOH HOH A . S 7 HOH 54 354 3 HOH HOH A . S 7 HOH 55 355 2 HOH HOH A . S 7 HOH 56 356 40 HOH HOH A . S 7 HOH 57 357 214 HOH HOH A . S 7 HOH 58 358 207 HOH HOH A . S 7 HOH 59 359 46 HOH HOH A . S 7 HOH 60 360 358 HOH HOH A . S 7 HOH 61 361 16 HOH HOH A . S 7 HOH 62 362 239 HOH HOH A . S 7 HOH 63 363 19 HOH HOH A . S 7 HOH 64 364 6 HOH HOH A . S 7 HOH 65 365 75 HOH HOH A . S 7 HOH 66 366 50 HOH HOH A . S 7 HOH 67 367 132 HOH HOH A . S 7 HOH 68 368 234 HOH HOH A . S 7 HOH 69 369 366 HOH HOH A . S 7 HOH 70 370 359 HOH HOH A . S 7 HOH 71 371 109 HOH HOH A . S 7 HOH 72 372 14 HOH HOH A . S 7 HOH 73 373 202 HOH HOH A . S 7 HOH 74 374 178 HOH HOH A . S 7 HOH 75 375 82 HOH HOH A . S 7 HOH 76 376 267 HOH HOH A . S 7 HOH 77 377 42 HOH HOH A . S 7 HOH 78 378 8 HOH HOH A . S 7 HOH 79 379 32 HOH HOH A . S 7 HOH 80 380 25 HOH HOH A . S 7 HOH 81 381 4 HOH HOH A . S 7 HOH 82 382 18 HOH HOH A . S 7 HOH 83 383 113 HOH HOH A . S 7 HOH 84 384 342 HOH HOH A . S 7 HOH 85 385 274 HOH HOH A . S 7 HOH 86 386 24 HOH HOH A . S 7 HOH 87 387 52 HOH HOH A . S 7 HOH 88 388 60 HOH HOH A . S 7 HOH 89 389 45 HOH HOH A . S 7 HOH 90 390 72 HOH HOH A . S 7 HOH 91 391 69 HOH HOH A . S 7 HOH 92 392 70 HOH HOH A . S 7 HOH 93 393 92 HOH HOH A . S 7 HOH 94 394 78 HOH HOH A . S 7 HOH 95 395 143 HOH HOH A . S 7 HOH 96 396 51 HOH HOH A . S 7 HOH 97 397 73 HOH HOH A . S 7 HOH 98 398 124 HOH HOH A . S 7 HOH 99 399 61 HOH HOH A . S 7 HOH 100 400 94 HOH HOH A . S 7 HOH 101 401 79 HOH HOH A . S 7 HOH 102 402 17 HOH HOH A . S 7 HOH 103 403 12 HOH HOH A . S 7 HOH 104 404 44 HOH HOH A . S 7 HOH 105 405 161 HOH HOH A . S 7 HOH 106 406 106 HOH HOH A . S 7 HOH 107 407 62 HOH HOH A . S 7 HOH 108 408 93 HOH HOH A . S 7 HOH 109 409 154 HOH HOH A . S 7 HOH 110 410 21 HOH HOH A . S 7 HOH 111 411 89 HOH HOH A . S 7 HOH 112 412 84 HOH HOH A . S 7 HOH 113 413 194 HOH HOH A . S 7 HOH 114 414 335 HOH HOH A . S 7 HOH 115 415 133 HOH HOH A . S 7 HOH 116 416 53 HOH HOH A . S 7 HOH 117 417 115 HOH HOH A . S 7 HOH 118 418 210 HOH HOH A . S 7 HOH 119 419 77 HOH HOH A . S 7 HOH 120 420 29 HOH HOH A . S 7 HOH 121 421 54 HOH HOH A . S 7 HOH 122 422 293 HOH HOH A . S 7 HOH 123 423 38 HOH HOH A . S 7 HOH 124 424 26 HOH HOH A . S 7 HOH 125 425 204 HOH HOH A . S 7 HOH 126 426 184 HOH HOH A . S 7 HOH 127 427 36 HOH HOH A . S 7 HOH 128 428 304 HOH HOH A . S 7 HOH 129 429 120 HOH HOH A . S 7 HOH 130 430 20 HOH HOH A . S 7 HOH 131 431 186 HOH HOH A . S 7 HOH 132 432 203 HOH HOH A . S 7 HOH 133 433 9 HOH HOH A . S 7 HOH 134 434 99 HOH HOH A . S 7 HOH 135 435 48 HOH HOH A . S 7 HOH 136 436 330 HOH HOH A . S 7 HOH 137 437 140 HOH HOH A . S 7 HOH 138 438 134 HOH HOH A . S 7 HOH 139 439 74 HOH HOH A . S 7 HOH 140 440 164 HOH HOH A . S 7 HOH 141 441 59 HOH HOH A . S 7 HOH 142 442 299 HOH HOH A . S 7 HOH 143 443 15 HOH HOH A . S 7 HOH 144 444 31 HOH HOH A . S 7 HOH 145 445 277 HOH HOH A . S 7 HOH 146 446 47 HOH HOH A . S 7 HOH 147 447 367 HOH HOH A . S 7 HOH 148 448 301 HOH HOH A . S 7 HOH 149 449 22 HOH HOH A . S 7 HOH 150 450 163 HOH HOH A . S 7 HOH 151 451 57 HOH HOH A . S 7 HOH 152 452 127 HOH HOH A . S 7 HOH 153 453 323 HOH HOH A . S 7 HOH 154 454 309 HOH HOH A . S 7 HOH 155 455 65 HOH HOH A . S 7 HOH 156 456 116 HOH HOH A . S 7 HOH 157 457 105 HOH HOH A . S 7 HOH 158 458 229 HOH HOH A . S 7 HOH 159 459 217 HOH HOH A . S 7 HOH 160 460 152 HOH HOH A . S 7 HOH 161 461 125 HOH HOH A . S 7 HOH 162 462 314 HOH HOH A . S 7 HOH 163 463 187 HOH HOH A . S 7 HOH 164 464 357 HOH HOH A . S 7 HOH 165 465 166 HOH HOH A . S 7 HOH 166 466 165 HOH HOH A . S 7 HOH 167 467 336 HOH HOH A . S 7 HOH 168 468 27 HOH HOH A . S 7 HOH 169 469 175 HOH HOH A . S 7 HOH 170 470 76 HOH HOH A . S 7 HOH 171 471 66 HOH HOH A . S 7 HOH 172 472 173 HOH HOH A . S 7 HOH 173 473 129 HOH HOH A . S 7 HOH 174 474 102 HOH HOH A . S 7 HOH 175 475 266 HOH HOH A . S 7 HOH 176 476 228 HOH HOH A . S 7 HOH 177 477 122 HOH HOH A . S 7 HOH 178 478 370 HOH HOH A . S 7 HOH 179 479 185 HOH HOH A . S 7 HOH 180 480 252 HOH HOH A . S 7 HOH 181 481 249 HOH HOH A . S 7 HOH 182 482 30 HOH HOH A . S 7 HOH 183 483 237 HOH HOH A . S 7 HOH 184 484 317 HOH HOH A . S 7 HOH 185 485 281 HOH HOH A . S 7 HOH 186 486 315 HOH HOH A . S 7 HOH 187 487 311 HOH HOH A . S 7 HOH 188 488 90 HOH HOH A . S 7 HOH 189 489 5 HOH HOH A . S 7 HOH 190 490 240 HOH HOH A . S 7 HOH 191 491 58 HOH HOH A . S 7 HOH 192 492 114 HOH HOH A . S 7 HOH 193 493 191 HOH HOH A . S 7 HOH 194 494 288 HOH HOH A . S 7 HOH 195 495 369 HOH HOH A . S 7 HOH 196 496 199 HOH HOH A . S 7 HOH 197 497 224 HOH HOH A . S 7 HOH 198 498 208 HOH HOH A . S 7 HOH 199 499 248 HOH HOH A . S 7 HOH 200 500 220 HOH HOH A . S 7 HOH 201 501 272 HOH HOH A . S 7 HOH 202 502 71 HOH HOH A . S 7 HOH 203 503 188 HOH HOH A . S 7 HOH 204 504 11 HOH HOH A . S 7 HOH 205 505 64 HOH HOH A . S 7 HOH 206 506 205 HOH HOH A . S 7 HOH 207 507 189 HOH HOH A . S 7 HOH 208 508 361 HOH HOH A . S 7 HOH 209 509 162 HOH HOH A . S 7 HOH 210 510 294 HOH HOH A . S 7 HOH 211 511 235 HOH HOH A . S 7 HOH 212 512 41 HOH HOH A . S 7 HOH 213 513 230 HOH HOH A . S 7 HOH 214 514 316 HOH HOH A . S 7 HOH 215 515 270 HOH HOH A . S 7 HOH 216 516 141 HOH HOH A . S 7 HOH 217 517 275 HOH HOH A . S 7 HOH 218 518 160 HOH HOH A . S 7 HOH 219 519 310 HOH HOH A . S 7 HOH 220 520 368 HOH HOH A . S 7 HOH 221 521 121 HOH HOH A . S 7 HOH 222 522 111 HOH HOH A . S 7 HOH 223 523 159 HOH HOH A . S 7 HOH 224 524 43 HOH HOH A . S 7 HOH 225 525 211 HOH HOH A . S 7 HOH 226 526 268 HOH HOH A . S 7 HOH 227 527 227 HOH HOH A . S 7 HOH 228 528 212 HOH HOH A . S 7 HOH 229 529 63 HOH HOH A . S 7 HOH 230 530 209 HOH HOH A . S 7 HOH 231 531 297 HOH HOH A . S 7 HOH 232 532 290 HOH HOH A . S 7 HOH 233 533 147 HOH HOH A . S 7 HOH 234 534 144 HOH HOH A . S 7 HOH 235 535 23 HOH HOH A . S 7 HOH 236 536 198 HOH HOH A . S 7 HOH 237 537 296 HOH HOH A . S 7 HOH 238 538 242 HOH HOH A . S 7 HOH 239 539 332 HOH HOH A . S 7 HOH 240 540 331 HOH HOH A . S 7 HOH 241 541 181 HOH HOH A . S 7 HOH 242 542 49 HOH HOH A . S 7 HOH 243 543 241 HOH HOH A . S 7 HOH 244 544 236 HOH HOH A . S 7 HOH 245 545 213 HOH HOH A . S 7 HOH 246 546 260 HOH HOH A . S 7 HOH 247 547 118 HOH HOH A . S 7 HOH 248 548 289 HOH HOH A . S 7 HOH 249 549 254 HOH HOH A . S 7 HOH 250 550 151 HOH HOH A . S 7 HOH 251 551 283 HOH HOH A . S 7 HOH 252 552 86 HOH HOH A . S 7 HOH 253 553 313 HOH HOH A . S 7 HOH 254 554 103 HOH HOH A . S 7 HOH 255 555 192 HOH HOH A . S 7 HOH 256 556 200 HOH HOH A . S 7 HOH 257 557 339 HOH HOH A . S 7 HOH 258 558 130 HOH HOH A . S 7 HOH 259 559 226 HOH HOH A . S 7 HOH 260 560 196 HOH HOH A . S 7 HOH 261 561 219 HOH HOH A . S 7 HOH 262 562 148 HOH HOH A . S 7 HOH 263 563 135 HOH HOH A . S 7 HOH 264 564 218 HOH HOH A . S 7 HOH 265 565 131 HOH HOH A . S 7 HOH 266 566 169 HOH HOH A . S 7 HOH 267 567 168 HOH HOH A . S 7 HOH 268 568 137 HOH HOH A . S 7 HOH 269 569 182 HOH HOH A . S 7 HOH 270 570 145 HOH HOH A . S 7 HOH 271 571 195 HOH HOH A . S 7 HOH 272 572 215 HOH HOH A . S 7 HOH 273 573 285 HOH HOH A . S 7 HOH 274 574 67 HOH HOH A . S 7 HOH 275 575 284 HOH HOH A . S 7 HOH 276 576 238 HOH HOH A . S 7 HOH 277 577 123 HOH HOH A . S 7 HOH 278 578 149 HOH HOH A . S 7 HOH 279 579 171 HOH HOH A . S 7 HOH 280 580 362 HOH HOH A . S 7 HOH 281 581 110 HOH HOH A . S 7 HOH 282 582 256 HOH HOH A . S 7 HOH 283 583 341 HOH HOH A . S 7 HOH 284 584 157 HOH HOH A . S 7 HOH 285 585 233 HOH HOH A . S 7 HOH 286 586 193 HOH HOH A . S 7 HOH 287 587 340 HOH HOH A . S 7 HOH 288 588 328 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 19 ? CD ? A LYS 19 CD 2 1 Y 1 A LYS 19 ? CE ? A LYS 19 CE 3 1 Y 1 A LYS 19 ? NZ ? A LYS 19 NZ 4 1 Y 1 A LYS 50 ? NZ ? A LYS 50 NZ 5 1 Y 1 A LYS 65 ? CE ? A LYS 65 CE 6 1 Y 1 A LYS 65 ? NZ ? A LYS 65 NZ 7 1 Y 1 A LYS 116 ? CE ? A LYS 116 CE 8 1 Y 1 A LYS 116 ? NZ ? A LYS 116 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.11.1_2575 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? iMOSFLM ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5WPN _cell.details ? _cell.formula_units_Z ? _cell.length_a 181.870 _cell.length_a_esd ? _cell.length_b 181.870 _cell.length_b_esd ? _cell.length_c 181.870 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 96 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5WPN _symmetry.cell_setting ? _symmetry.Int_Tables_number 209 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'F 4 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5WPN _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.19 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 61.40 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 297 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;Reservoir: 500 uL total volume: 20 mM Tris (pH 8.5), 40 mM CaCl2, 6% PEG 400 Sitting Drop: 2 uL reservoir, 2 uL of 25 uM Chaetopterus variopedatus ferritin Soaking Solution (30 min): 10 mM Zn, 20 mM Tris (pH 8.5), 20 mM CaCl2, and 3% (v/v) PEG 400 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-01-14 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength 0.97946 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97946 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRL BEAMLINE BL12-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list ? _diffrn_source.pdbx_wavelength 0.97946 _diffrn_source.pdbx_synchrotron_beamline BL12-2 _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5WPN _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.57 _reflns.d_resolution_low 90.94 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 36446 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 25.1 _reflns.pdbx_Rmerge_I_obs 0.095 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 24.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.985 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.57 _reflns_shell.d_res_low 1.60 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.2 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 296 _reflns_shell.percent_possible_all 98.6 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.803 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 5.6 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.568 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5WPN _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.57 _refine.ls_d_res_low 45.467 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 36347 _refine.ls_number_reflns_R_free 1858 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.67 _refine.ls_percent_reflns_R_free 5.11 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1394 _refine.ls_R_factor_R_free 0.1628 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1381 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'homology model' _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details Random _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1376 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 32 _refine_hist.number_atoms_solvent 288 _refine_hist.number_atoms_total 1696 _refine_hist.d_res_high 1.57 _refine_hist.d_res_low 45.467 # _refine_ls_shell.R_factor_R_free 0.2447 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.d_res_high 1.57 _refine_ls_shell.d_res_low 1.61 _refine_ls_shell.number_reflns_R_free 137 _refine_ls_shell.number_reflns_R_work 2558 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? # _database_PDB_matrix.entry_id 5WPN _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 5WPN _struct.title 'Zn-bound Structure of Chaetopterus variopedatus Ferritin' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5WPN _struct_keywords.text 'Ferritin, OXIDOREDUCTASE' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 2 ? G N N 2 ? H N N 2 ? I N N 2 ? J N N 2 ? K N N 2 ? L N N 2 ? M N N 2 ? N N N 3 ? O N N 4 ? P N N 5 ? Q N N 5 ? R N N 6 ? S N N 7 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A075ML49_CHAVR _struct_ref.pdbx_db_accession A0A075ML49 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AQTQPRQNYASDVEAGINKQINLELYASYVYQSMAWFFDRDDIALKGFHKFFKHQSEEEREHAEKLMQYQNKRGGRIVLQ NIQKPERDEWGTGLEAMQVALALEKNVNQSLLDLHKVGAGHDDAHLCDFLEEHYLEEQVKSIKELSDYVTNLKRVGPGLG EYMFDKESLSS ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5WPN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 171 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A075ML49 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 172 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 171 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 5WPN _struct_ref_seq_dif.mon_id ASP _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 81 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code A0A075ML49 _struct_ref_seq_dif.db_mon_id ASN _struct_ref_seq_dif.pdbx_seq_db_seq_num 82 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 81 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details 24-meric _pdbx_struct_assembly.oligomeric_count 24 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 105420 ? 1 MORE -392 ? 1 'SSA (A^2)' 131530 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 5 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 6 'crystal symmetry operation' 6_555 z,-x,-y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 7 'crystal symmetry operation' 7_555 -z,-x,y 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 8 'crystal symmetry operation' 8_555 -z,x,-y 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 9 'crystal symmetry operation' 9_555 y,z,x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 10 'crystal symmetry operation' 10_555 -y,z,-x 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 11 'crystal symmetry operation' 11_555 y,-z,-x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 12 'crystal symmetry operation' 12_555 -y,-z,x 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 13 'crystal symmetry operation' 13_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 14 'crystal symmetry operation' 14_555 -y,-x,-z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 15 'crystal symmetry operation' 15_555 y,-x,z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 16 'crystal symmetry operation' 16_555 -y,x,z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 17 'crystal symmetry operation' 17_555 x,z,-y 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 18 'crystal symmetry operation' 18_555 -x,z,y -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 19 'crystal symmetry operation' 19_555 -x,-z,-y -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 20 'crystal symmetry operation' 20_555 x,-z,y 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 21 'crystal symmetry operation' 21_555 z,y,-x 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 22 'crystal symmetry operation' 22_555 z,-y,x 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 23 'crystal symmetry operation' 23_555 -z,y,x 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 24 'crystal symmetry operation' 24_555 -z,-y,-x 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 # _struct_biol.id 1 _struct_biol.details '24-meric cage-like protein by gel filtration' # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 10 ? PHE A 38 ? ALA A 10 PHE A 38 1 ? 29 HELX_P HELX_P2 AA2 LEU A 45 ? GLY A 74 ? LEU A 45 GLY A 74 1 ? 30 HELX_P HELX_P3 AA3 THR A 92 ? HIS A 121 ? THR A 92 HIS A 121 1 ? 30 HELX_P HELX_P4 AA4 ASP A 123 ? TYR A 134 ? ASP A 123 TYR A 134 1 ? 12 HELX_P HELX_P5 AA5 TYR A 134 ? GLY A 156 ? TYR A 134 GLY A 156 1 ? 23 HELX_P HELX_P6 AA6 GLY A 158 ? SER A 168 ? GLY A 158 SER A 168 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 12 OD2 ? ? ? 1_555 E ZN . ZN ? ? A ASP 12 A ZN 204 1_555 ? ? ? ? ? ? ? 1.922 ? ? metalc2 metalc ? ? A GLU 24 OE1 ? ? ? 1_555 B ZN . ZN ? ? A GLU 24 A ZN 201 1_555 ? ? ? ? ? ? ? 1.971 ? ? metalc3 metalc ? ? A HIS 49 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 49 A ZN 202 1_555 ? ? ? ? ? ? ? 2.183 ? ? metalc4 metalc ? ? A LYS 53 NZ ? ? ? 1_555 C ZN . ZN ? ? A LYS 53 A ZN 202 1_555 ? ? ? ? ? ? ? 1.915 ? ? metalc5 metalc ? ? A HIS 54 NE2 ? ? ? 1_555 K ZN . ZN ? ? A HIS 54 A ZN 210 1_555 ? ? ? ? ? ? ? 2.588 ? ? metalc6 metalc ? ? A GLU 58 OE2 C ? ? 1_555 L ZN . ZN ? ? A GLU 58 A ZN 211 1_555 ? ? ? ? ? ? ? 2.485 ? ? metalc7 metalc ? ? A GLU 59 OE2 ? ? ? 1_555 B ZN . ZN ? ? A GLU 59 A ZN 201 1_555 ? ? ? ? ? ? ? 2.075 ? ? metalc8 metalc ? ? A GLU 59 OE1 ? ? ? 1_555 D ZN . ZN ? ? A GLU 59 A ZN 203 1_555 ? ? ? ? ? ? ? 1.939 ? ? metalc9 metalc ? ? A HIS 62 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 62 A ZN 201 1_555 ? ? ? ? ? ? ? 2.095 ? ? metalc10 metalc ? ? A HIS 62 NE2 ? ? ? 1_555 L ZN . ZN ? ? A HIS 62 A ZN 211 1_555 ? ? ? ? ? ? ? 2.310 ? ? metalc11 metalc ? ? A ASP 81 OD2 ? ? ? 1_555 M ZN . ZN A ? A ASP 81 A ZN 212 1_555 ? ? ? ? ? ? ? 1.973 ? ? metalc12 metalc ? ? A ASP 81 OD2 ? ? ? 1_555 M ZN . ZN A ? A ASP 81 A ZN 212 70_554 ? ? ? ? ? ? ? 1.970 ? ? metalc13 metalc ? ? A ASP 81 OD1 ? ? ? 1_555 N CA . CA B ? A ASP 81 A CA 213 1_555 ? ? ? ? ? ? ? 2.911 ? ? metalc14 metalc ? ? A ASP 81 OD2 ? ? ? 1_555 N CA . CA B ? A ASP 81 A CA 213 1_555 ? ? ? ? ? ? ? 2.040 ? ? metalc15 metalc ? ? A ASP 81 OD1 ? ? ? 1_555 N CA . CA B ? A ASP 81 A CA 213 70_554 ? ? ? ? ? ? ? 2.911 ? ? metalc16 metalc ? ? A ASP 81 OD2 ? ? ? 1_555 N CA . CA B ? A ASP 81 A CA 213 70_554 ? ? ? ? ? ? ? 2.040 ? ? metalc17 metalc ? ? A GLN 83 OE1 ? ? ? 1_555 M ZN . ZN A ? A GLN 83 A ZN 212 24_555 ? ? ? ? ? ? ? 2.165 ? ? metalc18 metalc ? ? A GLN 83 OE1 ? ? ? 1_555 N CA . CA B ? A GLN 83 A CA 213 24_555 ? ? ? ? ? ? ? 2.163 ? ? metalc19 metalc ? ? A GLU 104 OE1 ? ? ? 1_555 D ZN . ZN ? ? A GLU 104 A ZN 203 1_555 ? ? ? ? ? ? ? 2.283 ? ? metalc20 metalc ? ? A GLU 104 OE2 ? ? ? 1_555 D ZN . ZN ? ? A GLU 104 A ZN 203 1_555 ? ? ? ? ? ? ? 2.151 ? ? metalc21 metalc ? ? A HIS 115 NE2 ? ? ? 1_555 F ZN . ZN ? ? A HIS 115 A ZN 205 1_555 ? ? ? ? ? ? ? 2.037 ? ? metalc22 metalc ? ? A HIS 121 NE2 ? ? ? 1_555 E ZN . ZN ? ? A HIS 121 A ZN 204 1_555 ? ? ? ? ? ? ? 1.870 ? ? metalc23 metalc ? ? A CYS 127 SG ? ? ? 1_555 F ZN . ZN ? ? A CYS 127 A ZN 205 1_555 ? ? ? ? ? ? ? 2.311 ? ? metalc24 metalc ? ? A CYS 127 SG ? ? ? 1_555 G ZN . ZN ? ? A CYS 127 A ZN 206 7_555 ? ? ? ? ? ? ? 2.305 ? ? metalc25 metalc ? ? A GLU 131 OE2 ? ? ? 1_555 G ZN . ZN ? ? A GLU 131 A ZN 206 1_555 ? ? ? ? ? ? ? 1.901 ? ? metalc26 metalc ? ? A GLU 131 OE1 ? ? ? 1_555 H ZN . ZN ? ? A GLU 131 A ZN 207 1_555 ? ? ? ? ? ? ? 2.329 ? ? metalc27 metalc ? ? A GLU 131 OE1 ? ? ? 1_555 H ZN . ZN ? ? A GLU 131 A ZN 207 7_555 ? ? ? ? ? ? ? 2.329 ? ? metalc28 metalc ? ? A HIS 133 NE2 ? ? ? 1_555 I ZN . ZN ? ? A HIS 133 A ZN 208 1_555 ? ? ? ? ? ? ? 2.006 ? ? metalc29 metalc ? ? A GLU 167 OE2 ? ? ? 1_555 J ZN . ZN A ? A GLU 167 A ZN 209 1_555 ? ? ? ? ? ? ? 1.916 ? ? metalc30 metalc ? ? A GLU 167 OE2 ? ? ? 1_555 J ZN . ZN A ? A GLU 167 A ZN 209 15_555 ? ? ? ? ? ? ? 2.033 ? ? metalc31 metalc ? ? B ZN . ZN ? ? ? 1_555 S HOH . O ? ? A ZN 201 A HOH 325 1_555 ? ? ? ? ? ? ? 1.952 ? ? metalc32 metalc ? ? B ZN . ZN ? ? ? 1_555 S HOH . O ? ? A ZN 201 A HOH 335 1_555 ? ? ? ? ? ? ? 2.210 ? ? metalc33 metalc ? ? C ZN . ZN ? ? ? 1_555 S HOH . O ? ? A ZN 202 A HOH 491 1_555 ? ? ? ? ? ? ? 2.070 ? ? metalc34 metalc ? ? C ZN . ZN ? ? ? 1_555 S HOH . O ? ? A ZN 202 A HOH 500 1_555 ? ? ? ? ? ? ? 2.312 ? ? metalc35 metalc ? ? D ZN . ZN ? ? ? 1_555 S HOH . O ? ? A ZN 203 A HOH 325 1_555 ? ? ? ? ? ? ? 1.907 ? ? metalc36 metalc ? ? D ZN . ZN ? ? ? 1_555 S HOH . O ? ? A ZN 203 A HOH 472 1_555 ? ? ? ? ? ? ? 2.096 ? ? metalc37 metalc ? ? E ZN . ZN ? ? ? 1_555 S HOH . O ? ? A ZN 204 A HOH 462 1_555 ? ? ? ? ? ? ? 2.287 ? ? metalc38 metalc ? ? E ZN . ZN ? ? ? 1_555 S HOH . O ? ? A ZN 204 A HOH 469 1_555 ? ? ? ? ? ? ? 2.181 ? ? metalc39 metalc ? ? E ZN . ZN ? ? ? 1_555 S HOH . O ? ? A ZN 204 A HOH 505 1_555 ? ? ? ? ? ? ? 2.265 ? ? metalc40 metalc ? ? F ZN . ZN ? ? ? 1_555 S HOH . O ? ? A ZN 205 A HOH 444 1_555 ? ? ? ? ? ? ? 2.043 ? ? metalc41 metalc ? ? G ZN . ZN ? ? ? 1_555 S HOH . O ? ? A ZN 206 A HOH 444 1_555 ? ? ? ? ? ? ? 1.779 ? ? metalc42 metalc ? ? G ZN . ZN ? ? ? 1_555 S HOH . O ? ? A ZN 206 A HOH 489 1_555 ? ? ? ? ? ? ? 2.031 ? ? metalc43 metalc ? ? G ZN . ZN ? ? ? 1_555 S HOH . O ? ? A ZN 206 A HOH 489 7_555 ? ? ? ? ? ? ? 2.031 ? ? metalc44 metalc ? ? H ZN . ZN ? ? ? 1_555 S HOH . O ? ? A ZN 207 A HOH 345 1_555 ? ? ? ? ? ? ? 2.316 ? ? metalc45 metalc ? ? H ZN . ZN ? ? ? 1_555 S HOH . O ? ? A ZN 207 A HOH 345 7_555 ? ? ? ? ? ? ? 2.316 ? ? metalc46 metalc ? ? I ZN . ZN ? ? ? 1_555 S HOH . O ? ? A ZN 208 A HOH 454 1_555 ? ? ? ? ? ? ? 1.783 ? ? metalc47 metalc ? ? I ZN . ZN ? ? ? 1_555 S HOH . O ? ? A ZN 208 A HOH 519 1_555 ? ? ? ? ? ? ? 2.180 ? ? metalc48 metalc ? ? I ZN . ZN ? ? ? 1_555 S HOH . O ? ? A ZN 208 A HOH 521 1_555 ? ? ? ? ? ? ? 2.231 ? ? metalc49 metalc ? ? J ZN . ZN A ? ? 1_555 S HOH . O ? ? A ZN 209 A HOH 314 16_555 ? ? ? ? ? ? ? 2.256 ? ? metalc50 metalc ? ? J ZN . ZN A ? ? 1_555 S HOH . O ? ? A ZN 209 A HOH 360 1_555 ? ? ? ? ? ? ? 1.846 ? ? metalc51 metalc ? ? J ZN . ZN A ? ? 1_555 S HOH . O ? ? A ZN 209 A HOH 360 16_555 ? ? ? ? ? ? ? 1.848 ? ? metalc52 metalc ? ? K ZN . ZN ? ? ? 1_555 S HOH . O ? ? A ZN 210 A HOH 303 1_555 ? ? ? ? ? ? ? 1.844 ? ? metalc53 metalc ? ? K ZN . ZN ? ? ? 1_555 S HOH . O ? ? A ZN 210 A HOH 304 1_555 ? ? ? ? ? ? ? 2.388 ? ? metalc54 metalc ? ? M ZN . ZN A ? ? 1_555 S HOH . O ? ? A ZN 212 A HOH 471 24_555 ? ? ? ? ? ? ? 2.287 ? ? metalc55 metalc ? ? N CA . CA B ? ? 1_555 S HOH . O ? ? A CA 213 A HOH 471 24_555 ? ? ? ? ? ? ? 2.184 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD2 ? A ASP 12 ? A ASP 12 ? 1_555 ZN ? E ZN . ? A ZN 204 ? 1_555 NE2 ? A HIS 121 ? A HIS 121 ? 1_555 121.8 ? 2 OD2 ? A ASP 12 ? A ASP 12 ? 1_555 ZN ? E ZN . ? A ZN 204 ? 1_555 O ? S HOH . ? A HOH 462 ? 1_555 97.3 ? 3 NE2 ? A HIS 121 ? A HIS 121 ? 1_555 ZN ? E ZN . ? A ZN 204 ? 1_555 O ? S HOH . ? A HOH 462 ? 1_555 89.6 ? 4 OD2 ? A ASP 12 ? A ASP 12 ? 1_555 ZN ? E ZN . ? A ZN 204 ? 1_555 O ? S HOH . ? A HOH 469 ? 1_555 95.4 ? 5 NE2 ? A HIS 121 ? A HIS 121 ? 1_555 ZN ? E ZN . ? A ZN 204 ? 1_555 O ? S HOH . ? A HOH 469 ? 1_555 113.2 ? 6 O ? S HOH . ? A HOH 462 ? 1_555 ZN ? E ZN . ? A ZN 204 ? 1_555 O ? S HOH . ? A HOH 469 ? 1_555 142.1 ? 7 OD2 ? A ASP 12 ? A ASP 12 ? 1_555 ZN ? E ZN . ? A ZN 204 ? 1_555 O ? S HOH . ? A HOH 505 ? 1_555 110.6 ? 8 NE2 ? A HIS 121 ? A HIS 121 ? 1_555 ZN ? E ZN . ? A ZN 204 ? 1_555 O ? S HOH . ? A HOH 505 ? 1_555 114.9 ? 9 O ? S HOH . ? A HOH 462 ? 1_555 ZN ? E ZN . ? A ZN 204 ? 1_555 O ? S HOH . ? A HOH 505 ? 1_555 45.9 ? 10 O ? S HOH . ? A HOH 469 ? 1_555 ZN ? E ZN . ? A ZN 204 ? 1_555 O ? S HOH . ? A HOH 505 ? 1_555 96.3 ? 11 OE1 ? A GLU 24 ? A GLU 24 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 OE2 ? A GLU 59 ? A GLU 59 ? 1_555 86.1 ? 12 OE1 ? A GLU 24 ? A GLU 24 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 62 ? A HIS 62 ? 1_555 109.4 ? 13 OE2 ? A GLU 59 ? A GLU 59 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 62 ? A HIS 62 ? 1_555 95.4 ? 14 OE1 ? A GLU 24 ? A GLU 24 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 O ? S HOH . ? A HOH 325 ? 1_555 133.6 ? 15 OE2 ? A GLU 59 ? A GLU 59 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 O ? S HOH . ? A HOH 325 ? 1_555 93.0 ? 16 ND1 ? A HIS 62 ? A HIS 62 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 O ? S HOH . ? A HOH 325 ? 1_555 116.8 ? 17 OE1 ? A GLU 24 ? A GLU 24 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 O ? S HOH . ? A HOH 335 ? 1_555 89.7 ? 18 OE2 ? A GLU 59 ? A GLU 59 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 O ? S HOH . ? A HOH 335 ? 1_555 171.9 ? 19 ND1 ? A HIS 62 ? A HIS 62 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 O ? S HOH . ? A HOH 335 ? 1_555 92.5 ? 20 O ? S HOH . ? A HOH 325 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 O ? S HOH . ? A HOH 335 ? 1_555 85.0 ? 21 NE2 ? A HIS 49 ? A HIS 49 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 NZ ? A LYS 53 ? A LYS 53 ? 1_555 98.9 ? 22 NE2 ? A HIS 49 ? A HIS 49 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 O ? S HOH . ? A HOH 491 ? 1_555 114.1 ? 23 NZ ? A LYS 53 ? A LYS 53 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 O ? S HOH . ? A HOH 491 ? 1_555 109.4 ? 24 NE2 ? A HIS 49 ? A HIS 49 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 O ? S HOH . ? A HOH 500 ? 1_555 108.9 ? 25 NZ ? A LYS 53 ? A LYS 53 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 O ? S HOH . ? A HOH 500 ? 1_555 106.3 ? 26 O ? S HOH . ? A HOH 491 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 O ? S HOH . ? A HOH 500 ? 1_555 117.3 ? 27 NE2 ? A HIS 54 ? A HIS 54 ? 1_555 ZN ? K ZN . ? A ZN 210 ? 1_555 O ? S HOH . ? A HOH 303 ? 1_555 73.8 ? 28 NE2 ? A HIS 54 ? A HIS 54 ? 1_555 ZN ? K ZN . ? A ZN 210 ? 1_555 O ? S HOH . ? A HOH 304 ? 1_555 88.8 ? 29 O ? S HOH . ? A HOH 303 ? 1_555 ZN ? K ZN . ? A ZN 210 ? 1_555 O ? S HOH . ? A HOH 304 ? 1_555 62.2 ? 30 OE2 C A GLU 58 ? A GLU 58 ? 1_555 ZN ? L ZN . ? A ZN 211 ? 1_555 NE2 ? A HIS 62 ? A HIS 62 ? 1_555 90.6 ? 31 OE1 ? A GLU 59 ? A GLU 59 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OE1 ? A GLU 104 ? A GLU 104 ? 1_555 88.1 ? 32 OE1 ? A GLU 59 ? A GLU 59 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OE2 ? A GLU 104 ? A GLU 104 ? 1_555 140.0 ? 33 OE1 ? A GLU 104 ? A GLU 104 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OE2 ? A GLU 104 ? A GLU 104 ? 1_555 58.5 ? 34 OE1 ? A GLU 59 ? A GLU 59 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 O ? S HOH . ? A HOH 325 ? 1_555 105.6 ? 35 OE1 ? A GLU 104 ? A GLU 104 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 O ? S HOH . ? A HOH 325 ? 1_555 150.3 ? 36 OE2 ? A GLU 104 ? A GLU 104 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 O ? S HOH . ? A HOH 325 ? 1_555 96.9 ? 37 OE1 ? A GLU 59 ? A GLU 59 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 O ? S HOH . ? A HOH 472 ? 1_555 107.7 ? 38 OE1 ? A GLU 104 ? A GLU 104 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 O ? S HOH . ? A HOH 472 ? 1_555 92.8 ? 39 OE2 ? A GLU 104 ? A GLU 104 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 O ? S HOH . ? A HOH 472 ? 1_555 96.2 ? 40 O ? S HOH . ? A HOH 325 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 O ? S HOH . ? A HOH 472 ? 1_555 107.3 ? 41 OD2 ? A ASP 81 ? A ASP 81 ? 1_555 ZN A M ZN . ? A ZN 212 ? 1_555 OD2 ? A ASP 81 ? A ASP 81 ? 1_555 0.0 ? 42 OD2 ? A ASP 81 ? A ASP 81 ? 1_555 ZN A M ZN . ? A ZN 212 ? 1_555 OE1 ? A GLN 83 ? A GLN 83 ? 1_555 34.4 ? 43 OD2 ? A ASP 81 ? A ASP 81 ? 1_555 ZN A M ZN . ? A ZN 212 ? 1_555 OE1 ? A GLN 83 ? A GLN 83 ? 1_555 34.4 ? 44 OD2 ? A ASP 81 ? A ASP 81 ? 1_555 ZN A M ZN . ? A ZN 212 ? 1_555 O ? S HOH . ? A HOH 471 ? 24_555 130.2 ? 45 OD2 ? A ASP 81 ? A ASP 81 ? 1_555 ZN A M ZN . ? A ZN 212 ? 1_555 O ? S HOH . ? A HOH 471 ? 24_555 130.2 ? 46 OE1 ? A GLN 83 ? A GLN 83 ? 1_555 ZN A M ZN . ? A ZN 212 ? 1_555 O ? S HOH . ? A HOH 471 ? 24_555 163.4 ? 47 OD1 ? A ASP 81 ? A ASP 81 ? 1_555 CA B N CA . ? A CA 213 ? 1_555 OD2 ? A ASP 81 ? A ASP 81 ? 1_555 49.3 ? 48 OD1 ? A ASP 81 ? A ASP 81 ? 1_555 CA B N CA . ? A CA 213 ? 1_555 OD1 ? A ASP 81 ? A ASP 81 ? 1_555 0.0 ? 49 OD2 ? A ASP 81 ? A ASP 81 ? 1_555 CA B N CA . ? A CA 213 ? 1_555 OD1 ? A ASP 81 ? A ASP 81 ? 1_555 49.3 ? 50 OD1 ? A ASP 81 ? A ASP 81 ? 1_555 CA B N CA . ? A CA 213 ? 1_555 OD2 ? A ASP 81 ? A ASP 81 ? 1_555 49.3 ? 51 OD2 ? A ASP 81 ? A ASP 81 ? 1_555 CA B N CA . ? A CA 213 ? 1_555 OD2 ? A ASP 81 ? A ASP 81 ? 1_555 0.0 ? 52 OD1 ? A ASP 81 ? A ASP 81 ? 1_555 CA B N CA . ? A CA 213 ? 1_555 OD2 ? A ASP 81 ? A ASP 81 ? 1_555 49.3 ? 53 OD1 ? A ASP 81 ? A ASP 81 ? 1_555 CA B N CA . ? A CA 213 ? 1_555 OE1 ? A GLN 83 ? A GLN 83 ? 1_555 81.5 ? 54 OD2 ? A ASP 81 ? A ASP 81 ? 1_555 CA B N CA . ? A CA 213 ? 1_555 OE1 ? A GLN 83 ? A GLN 83 ? 1_555 32.4 ? 55 OD1 ? A ASP 81 ? A ASP 81 ? 1_555 CA B N CA . ? A CA 213 ? 1_555 OE1 ? A GLN 83 ? A GLN 83 ? 1_555 81.5 ? 56 OD2 ? A ASP 81 ? A ASP 81 ? 1_555 CA B N CA . ? A CA 213 ? 1_555 OE1 ? A GLN 83 ? A GLN 83 ? 1_555 32.4 ? 57 OD1 ? A ASP 81 ? A ASP 81 ? 1_555 CA B N CA . ? A CA 213 ? 1_555 O ? S HOH . ? A HOH 471 ? 24_555 84.7 ? 58 OD2 ? A ASP 81 ? A ASP 81 ? 1_555 CA B N CA . ? A CA 213 ? 1_555 O ? S HOH . ? A HOH 471 ? 24_555 132.5 ? 59 OD1 ? A ASP 81 ? A ASP 81 ? 1_555 CA B N CA . ? A CA 213 ? 1_555 O ? S HOH . ? A HOH 471 ? 24_555 84.7 ? 60 OD2 ? A ASP 81 ? A ASP 81 ? 1_555 CA B N CA . ? A CA 213 ? 1_555 O ? S HOH . ? A HOH 471 ? 24_555 132.5 ? 61 OE1 ? A GLN 83 ? A GLN 83 ? 1_555 CA B N CA . ? A CA 213 ? 1_555 O ? S HOH . ? A HOH 471 ? 24_555 163.7 ? 62 NE2 ? A HIS 115 ? A HIS 115 ? 1_555 ZN ? F ZN . ? A ZN 205 ? 1_555 SG ? A CYS 127 ? A CYS 127 ? 1_555 115.3 ? 63 NE2 ? A HIS 115 ? A HIS 115 ? 1_555 ZN ? F ZN . ? A ZN 205 ? 1_555 O ? S HOH . ? A HOH 444 ? 1_555 115.0 ? 64 SG ? A CYS 127 ? A CYS 127 ? 1_555 ZN ? F ZN . ? A ZN 205 ? 1_555 O ? S HOH . ? A HOH 444 ? 1_555 100.2 ? 65 SG ? A CYS 127 ? A CYS 127 ? 1_555 ZN ? G ZN . ? A ZN 206 ? 7_555 OE2 ? A GLU 131 ? A GLU 131 ? 1_555 53.5 ? 66 SG ? A CYS 127 ? A CYS 127 ? 1_555 ZN ? G ZN . ? A ZN 206 ? 7_555 O ? S HOH . ? A HOH 444 ? 1_555 64.2 ? 67 OE2 ? A GLU 131 ? A GLU 131 ? 1_555 ZN ? G ZN . ? A ZN 206 ? 7_555 O ? S HOH . ? A HOH 444 ? 1_555 43.0 ? 68 SG ? A CYS 127 ? A CYS 127 ? 1_555 ZN ? G ZN . ? A ZN 206 ? 7_555 O ? S HOH . ? A HOH 489 ? 1_555 103.5 ? 69 OE2 ? A GLU 131 ? A GLU 131 ? 1_555 ZN ? G ZN . ? A ZN 206 ? 7_555 O ? S HOH . ? A HOH 489 ? 1_555 50.3 ? 70 O ? S HOH . ? A HOH 444 ? 1_555 ZN ? G ZN . ? A ZN 206 ? 7_555 O ? S HOH . ? A HOH 489 ? 1_555 57.8 ? 71 SG ? A CYS 127 ? A CYS 127 ? 1_555 ZN ? G ZN . ? A ZN 206 ? 7_555 O ? S HOH . ? A HOH 489 ? 7_555 103.5 ? 72 OE2 ? A GLU 131 ? A GLU 131 ? 1_555 ZN ? G ZN . ? A ZN 206 ? 7_555 O ? S HOH . ? A HOH 489 ? 7_555 50.3 ? 73 O ? S HOH . ? A HOH 444 ? 1_555 ZN ? G ZN . ? A ZN 206 ? 7_555 O ? S HOH . ? A HOH 489 ? 7_555 57.8 ? 74 O ? S HOH . ? A HOH 489 ? 1_555 ZN ? G ZN . ? A ZN 206 ? 7_555 O ? S HOH . ? A HOH 489 ? 7_555 0.0 ? 75 OE1 ? A GLU 131 ? A GLU 131 ? 1_555 ZN ? H ZN . ? A ZN 207 ? 1_555 OE1 ? A GLU 131 ? A GLU 131 ? 1_555 0.0 ? 76 OE1 ? A GLU 131 ? A GLU 131 ? 1_555 ZN ? H ZN . ? A ZN 207 ? 1_555 O ? S HOH . ? A HOH 345 ? 1_555 96.4 ? 77 OE1 ? A GLU 131 ? A GLU 131 ? 1_555 ZN ? H ZN . ? A ZN 207 ? 1_555 O ? S HOH . ? A HOH 345 ? 1_555 96.4 ? 78 OE1 ? A GLU 131 ? A GLU 131 ? 1_555 ZN ? H ZN . ? A ZN 207 ? 1_555 O ? S HOH . ? A HOH 345 ? 7_555 173.6 ? 79 OE1 ? A GLU 131 ? A GLU 131 ? 1_555 ZN ? H ZN . ? A ZN 207 ? 1_555 O ? S HOH . ? A HOH 345 ? 7_555 173.6 ? 80 O ? S HOH . ? A HOH 345 ? 1_555 ZN ? H ZN . ? A ZN 207 ? 1_555 O ? S HOH . ? A HOH 345 ? 7_555 83.7 ? 81 NE2 ? A HIS 133 ? A HIS 133 ? 1_555 ZN ? I ZN . ? A ZN 208 ? 1_555 O ? S HOH . ? A HOH 454 ? 1_555 99.7 ? 82 NE2 ? A HIS 133 ? A HIS 133 ? 1_555 ZN ? I ZN . ? A ZN 208 ? 1_555 O ? S HOH . ? A HOH 519 ? 1_555 116.4 ? 83 O ? S HOH . ? A HOH 454 ? 1_555 ZN ? I ZN . ? A ZN 208 ? 1_555 O ? S HOH . ? A HOH 519 ? 1_555 98.6 ? 84 NE2 ? A HIS 133 ? A HIS 133 ? 1_555 ZN ? I ZN . ? A ZN 208 ? 1_555 O ? S HOH . ? A HOH 521 ? 1_555 122.3 ? 85 O ? S HOH . ? A HOH 454 ? 1_555 ZN ? I ZN . ? A ZN 208 ? 1_555 O ? S HOH . ? A HOH 521 ? 1_555 96.4 ? 86 O ? S HOH . ? A HOH 519 ? 1_555 ZN ? I ZN . ? A ZN 208 ? 1_555 O ? S HOH . ? A HOH 521 ? 1_555 115.2 ? 87 OE2 ? A GLU 167 ? A GLU 167 ? 1_555 ZN A J ZN . ? A ZN 209 ? 1_555 OE2 ? A GLU 167 ? A GLU 167 ? 1_555 0.0 ? 88 OE2 ? A GLU 167 ? A GLU 167 ? 1_555 ZN A J ZN . ? A ZN 209 ? 1_555 O ? S HOH . ? A HOH 314 ? 16_555 91.0 ? 89 OE2 ? A GLU 167 ? A GLU 167 ? 1_555 ZN A J ZN . ? A ZN 209 ? 1_555 O ? S HOH . ? A HOH 314 ? 16_555 91.0 ? 90 OE2 ? A GLU 167 ? A GLU 167 ? 1_555 ZN A J ZN . ? A ZN 209 ? 1_555 O ? S HOH . ? A HOH 360 ? 1_555 89.9 ? 91 OE2 ? A GLU 167 ? A GLU 167 ? 1_555 ZN A J ZN . ? A ZN 209 ? 1_555 O ? S HOH . ? A HOH 360 ? 1_555 89.9 ? 92 O ? S HOH . ? A HOH 314 ? 16_555 ZN A J ZN . ? A ZN 209 ? 1_555 O ? S HOH . ? A HOH 360 ? 1_555 177.0 ? 93 OE2 ? A GLU 167 ? A GLU 167 ? 1_555 ZN A J ZN . ? A ZN 209 ? 1_555 O ? S HOH . ? A HOH 360 ? 16_555 90.3 ? 94 OE2 ? A GLU 167 ? A GLU 167 ? 1_555 ZN A J ZN . ? A ZN 209 ? 1_555 O ? S HOH . ? A HOH 360 ? 16_555 90.3 ? 95 O ? S HOH . ? A HOH 314 ? 16_555 ZN A J ZN . ? A ZN 209 ? 1_555 O ? S HOH . ? A HOH 360 ? 16_555 177.0 ? 96 O ? S HOH . ? A HOH 360 ? 1_555 ZN A J ZN . ? A ZN 209 ? 1_555 O ? S HOH . ? A HOH 360 ? 16_555 0.5 ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 6 'binding site for residue ZN A 201' AC2 Software A ZN 202 ? 4 'binding site for residue ZN A 202' AC3 Software A ZN 203 ? 6 'binding site for residue ZN A 203' AC4 Software A ZN 204 ? 5 'binding site for residue ZN A 204' AC5 Software A ZN 205 ? 7 'binding site for residue ZN A 205' AC6 Software A ZN 206 ? 9 'binding site for residue ZN A 206' AC7 Software A ZN 207 ? 6 'binding site for residue ZN A 207' AC8 Software A ZN 208 ? 4 'binding site for residue ZN A 208' AC9 Software A ZN 209 ? 11 'binding site for residue ZN A 209' AD1 Software A ZN 210 ? 5 'binding site for residue ZN A 210' AD2 Software A ZN 211 ? 3 'binding site for residue ZN A 211' AD3 Software A ZN 212 ? 6 'binding site for residue ZN A 212' AD4 Software A CA 213 ? 6 'binding site for residue CA A 213' AD5 Software A CL 214 ? 5 'binding site for residue CL A 214' AD6 Software A PEG 215 ? 5 'binding site for residue PEG A 215' AD7 Software A PEG 216 ? 8 'binding site for residue PEG A 216' AD8 Software A EDO 217 ? 7 'binding site for residue EDO A 217' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 GLU A 24 ? GLU A 24 . ? 1_555 ? 2 AC1 6 GLU A 59 ? GLU A 59 . ? 1_555 ? 3 AC1 6 HIS A 62 ? HIS A 62 . ? 1_555 ? 4 AC1 6 ZN D . ? ZN A 203 . ? 1_555 ? 5 AC1 6 HOH S . ? HOH A 325 . ? 1_555 ? 6 AC1 6 HOH S . ? HOH A 335 . ? 1_555 ? 7 AC2 4 HIS A 49 ? HIS A 49 . ? 1_555 ? 8 AC2 4 LYS A 53 ? LYS A 53 . ? 1_555 ? 9 AC2 4 HOH S . ? HOH A 491 . ? 1_555 ? 10 AC2 4 HOH S . ? HOH A 500 . ? 1_555 ? 11 AC3 6 GLU A 59 ? GLU A 59 . ? 1_555 ? 12 AC3 6 GLU A 104 ? GLU A 104 . ? 1_555 ? 13 AC3 6 GLN A 138 ? GLN A 138 . ? 1_555 ? 14 AC3 6 ZN B . ? ZN A 201 . ? 1_555 ? 15 AC3 6 HOH S . ? HOH A 325 . ? 1_555 ? 16 AC3 6 HOH S . ? HOH A 472 . ? 1_555 ? 17 AC4 5 ASP A 12 ? ASP A 12 . ? 1_555 ? 18 AC4 5 HIS A 121 ? HIS A 121 . ? 1_555 ? 19 AC4 5 HOH S . ? HOH A 462 . ? 1_555 ? 20 AC4 5 HOH S . ? HOH A 469 . ? 1_555 ? 21 AC4 5 HOH S . ? HOH A 505 . ? 1_555 ? 22 AC5 7 HIS A 115 ? HIS A 115 . ? 1_555 ? 23 AC5 7 CYS A 127 ? CYS A 127 . ? 1_555 ? 24 AC5 7 GLU A 131 ? GLU A 131 . ? 1_555 ? 25 AC5 7 ZN G . ? ZN A 206 . ? 7_555 ? 26 AC5 7 ZN G . ? ZN A 206 . ? 1_555 ? 27 AC5 7 CL O . ? CL A 214 . ? 1_555 ? 28 AC5 7 HOH S . ? HOH A 444 . ? 1_555 ? 29 AC6 9 CYS A 127 ? CYS A 127 . ? 10_555 ? 30 AC6 9 CYS A 127 ? CYS A 127 . ? 1_555 ? 31 AC6 9 GLU A 131 ? GLU A 131 . ? 1_555 ? 32 AC6 9 ZN F . ? ZN A 205 . ? 1_555 ? 33 AC6 9 ZN F . ? ZN A 205 . ? 10_555 ? 34 AC6 9 HOH S . ? HOH A 444 . ? 1_555 ? 35 AC6 9 HOH S . ? HOH A 489 . ? 10_555 ? 36 AC6 9 HOH S . ? HOH A 489 . ? 7_555 ? 37 AC6 9 HOH S . ? HOH A 489 . ? 1_555 ? 38 AC7 6 GLU A 131 ? GLU A 131 . ? 10_555 ? 39 AC7 6 GLU A 131 ? GLU A 131 . ? 7_555 ? 40 AC7 6 GLU A 131 ? GLU A 131 . ? 1_555 ? 41 AC7 6 HOH S . ? HOH A 345 . ? 10_555 ? 42 AC7 6 HOH S . ? HOH A 345 . ? 1_555 ? 43 AC7 6 HOH S . ? HOH A 345 . ? 7_555 ? 44 AC8 4 HIS A 133 ? HIS A 133 . ? 1_555 ? 45 AC8 4 HOH S . ? HOH A 454 . ? 1_555 ? 46 AC8 4 HOH S . ? HOH A 519 . ? 1_555 ? 47 AC8 4 HOH S . ? HOH A 521 . ? 1_555 ? 48 AC9 11 GLU A 167 ? GLU A 167 . ? 1_555 ? 49 AC9 11 GLU A 167 ? GLU A 167 . ? 16_555 ? 50 AC9 11 HOH S . ? HOH A 306 . ? 2_555 ? 51 AC9 11 HOH S . ? HOH A 306 . ? 15_555 ? 52 AC9 11 HOH S . ? HOH A 306 . ? 16_555 ? 53 AC9 11 HOH S . ? HOH A 306 . ? 1_555 ? 54 AC9 11 HOH S . ? HOH A 314 . ? 16_555 ? 55 AC9 11 HOH S . ? HOH A 360 . ? 16_555 ? 56 AC9 11 HOH S . ? HOH A 360 . ? 15_555 ? 57 AC9 11 HOH S . ? HOH A 360 . ? 2_555 ? 58 AC9 11 HOH S . ? HOH A 360 . ? 1_555 ? 59 AD1 5 HIS A 54 ? HIS A 54 . ? 1_555 ? 60 AD1 5 GLN A 55 ? GLN A 55 . ? 1_555 ? 61 AD1 5 GLU A 58 ? GLU A 58 . ? 1_555 ? 62 AD1 5 HOH S . ? HOH A 303 . ? 1_555 ? 63 AD1 5 HOH S . ? HOH A 304 . ? 1_555 ? 64 AD2 3 GLU A 58 ? GLU A 58 . ? 1_555 ? 65 AD2 3 HIS A 62 ? HIS A 62 . ? 1_555 ? 66 AD2 3 HOH S . ? HOH A 336 . ? 1_555 ? 67 AD3 6 ASP A 81 ? ASP A 81 . ? 70_554 ? 68 AD3 6 ASP A 81 ? ASP A 81 . ? 1_555 ? 69 AD3 6 GLN A 83 ? GLN A 83 . ? 51_554 ? 70 AD3 6 GLN A 83 ? GLN A 83 . ? 24_555 ? 71 AD3 6 HOH S . ? HOH A 471 . ? 51_554 ? 72 AD3 6 HOH S . ? HOH A 471 . ? 24_555 ? 73 AD4 6 ASP A 81 ? ASP A 81 . ? 70_554 ? 74 AD4 6 ASP A 81 ? ASP A 81 . ? 1_555 ? 75 AD4 6 GLN A 83 ? GLN A 83 . ? 51_554 ? 76 AD4 6 GLN A 83 ? GLN A 83 . ? 24_555 ? 77 AD4 6 HOH S . ? HOH A 471 . ? 51_554 ? 78 AD4 6 HOH S . ? HOH A 471 . ? 24_555 ? 79 AD5 5 HIS A 115 ? HIS A 115 . ? 1_555 ? 80 AD5 5 ALA A 119 ? ALA A 119 . ? 1_555 ? 81 AD5 5 CYS A 127 ? CYS A 127 . ? 1_555 ? 82 AD5 5 ZN F . ? ZN A 205 . ? 1_555 ? 83 AD5 5 HOH S . ? HOH A 524 . ? 1_555 ? 84 AD6 5 ASP A 42 ? ASP A 42 . ? 15_555 ? 85 AD6 5 LYS A 153 ? LYS A 153 . ? 1_555 ? 86 AD6 5 ARG A 154 ? ARG A 154 . ? 1_555 ? 87 AD6 5 HOH S . ? HOH A 307 . ? 1_555 ? 88 AD6 5 HOH S . ? HOH A 525 . ? 1_555 ? 89 AD7 8 ASN A 22 ? ASN A 22 . ? 1_555 ? 90 AD7 8 GLN A 80 ? GLN A 80 . ? 1_555 ? 91 AD7 8 ASP A 81 ? ASP A 81 . ? 1_555 ? 92 AD7 8 GLN A 83 ? GLN A 83 . ? 1_555 ? 93 AD7 8 GLN A 83 ? GLN A 83 . ? 51_554 ? 94 AD7 8 EDO R . ? EDO A 217 . ? 1_555 ? 95 AD7 8 HOH S . ? HOH A 312 . ? 1_555 ? 96 AD7 8 HOH S . ? HOH A 448 . ? 1_555 ? 97 AD8 7 TYR A 26 ? TYR A 26 . ? 51_554 ? 98 AD8 7 GLN A 83 ? GLN A 83 . ? 51_554 ? 99 AD8 7 LYS A 84 ? LYS A 84 . ? 24_555 ? 100 AD8 7 GLU A 86 ? GLU A 86 . ? 51_554 ? 101 AD8 7 PEG Q . ? PEG A 216 . ? 1_555 ? 102 AD8 7 HOH S . ? HOH A 326 . ? 1_555 ? 103 AD8 7 HOH S . ? HOH A 439 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HZ1 A LYS 53 ? ? ZN A ZN 202 ? ? 1.43 2 1 HD1 A HIS 133 ? ? O A HOH 308 ? ? 1.53 3 1 O A HOH 462 ? ? O A HOH 505 ? ? 1.78 4 1 O A HOH 495 ? ? O A HOH 520 ? ? 1.79 5 1 OD2 A ASP 122 ? B O A HOH 301 ? ? 1.90 6 1 O A HOH 414 ? ? O A HOH 507 ? ? 1.92 7 1 OE2 A GLU 58 ? B O A HOH 302 ? ? 1.97 8 1 O A HOH 518 ? ? O A HOH 534 ? ? 1.98 9 1 O A HOH 310 ? ? O A HOH 414 ? ? 2.05 10 1 OE1 A GLU 58 ? A O A HOH 303 ? ? 2.06 11 1 O A HOH 302 ? ? O A HOH 305 ? ? 2.08 12 1 O A HOH 460 ? ? O A HOH 558 ? ? 2.08 13 1 OE2 A GLU 58 ? A O A HOH 304 ? ? 2.12 14 1 O A HOH 323 ? ? O A HOH 503 ? ? 2.13 15 1 O A HOH 338 ? ? O A HOH 553 ? ? 2.13 16 1 O A HOH 464 ? ? O A HOH 467 ? ? 2.14 17 1 OE1 A GLU 58 ? A O A HOH 305 ? ? 2.14 18 1 O A HOH 308 ? ? O A HOH 513 ? ? 2.16 19 1 O A HOH 373 ? ? O A HOH 551 ? ? 2.19 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 496 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 508 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 51_554 _pdbx_validate_symm_contact.dist 2.15 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A ZN 207 ? H ZN . 2 1 A ZN 212 ? M ZN . 3 1 A CA 213 ? N CA . 4 1 A HOH 318 ? S HOH . 5 1 A HOH 360 ? S HOH . 6 1 A HOH 376 ? S HOH . 7 1 A HOH 471 ? S HOH . 8 1 A HOH 489 ? S HOH . 9 1 A HOH 584 ? S HOH . # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 585 ? 5.92 . 2 1 O ? A HOH 586 ? 5.92 . 3 1 O ? A HOH 587 ? 6.26 . 4 1 O ? A HOH 588 ? 6.37 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 1 ? A ALA 1 2 1 Y 1 A SER 171 ? A SER 171 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 CL CL CL N N 75 CYS N N N N 76 CYS CA C N R 77 CYS C C N N 78 CYS O O N N 79 CYS CB C N N 80 CYS SG S N N 81 CYS OXT O N N 82 CYS H H N N 83 CYS H2 H N N 84 CYS HA H N N 85 CYS HB2 H N N 86 CYS HB3 H N N 87 CYS HG H N N 88 CYS HXT H N N 89 EDO C1 C N N 90 EDO O1 O N N 91 EDO C2 C N N 92 EDO O2 O N N 93 EDO H11 H N N 94 EDO H12 H N N 95 EDO HO1 H N N 96 EDO H21 H N N 97 EDO H22 H N N 98 EDO HO2 H N N 99 GLN N N N N 100 GLN CA C N S 101 GLN C C N N 102 GLN O O N N 103 GLN CB C N N 104 GLN CG C N N 105 GLN CD C N N 106 GLN OE1 O N N 107 GLN NE2 N N N 108 GLN OXT O N N 109 GLN H H N N 110 GLN H2 H N N 111 GLN HA H N N 112 GLN HB2 H N N 113 GLN HB3 H N N 114 GLN HG2 H N N 115 GLN HG3 H N N 116 GLN HE21 H N N 117 GLN HE22 H N N 118 GLN HXT H N N 119 GLU N N N N 120 GLU CA C N S 121 GLU C C N N 122 GLU O O N N 123 GLU CB C N N 124 GLU CG C N N 125 GLU CD C N N 126 GLU OE1 O N N 127 GLU OE2 O N N 128 GLU OXT O N N 129 GLU H H N N 130 GLU H2 H N N 131 GLU HA H N N 132 GLU HB2 H N N 133 GLU HB3 H N N 134 GLU HG2 H N N 135 GLU HG3 H N N 136 GLU HE2 H N N 137 GLU HXT H N N 138 GLY N N N N 139 GLY CA C N N 140 GLY C C N N 141 GLY O O N N 142 GLY OXT O N N 143 GLY H H N N 144 GLY H2 H N N 145 GLY HA2 H N N 146 GLY HA3 H N N 147 GLY HXT H N N 148 HIS N N N N 149 HIS CA C N S 150 HIS C C N N 151 HIS O O N N 152 HIS CB C N N 153 HIS CG C Y N 154 HIS ND1 N Y N 155 HIS CD2 C Y N 156 HIS CE1 C Y N 157 HIS NE2 N Y N 158 HIS OXT O N N 159 HIS H H N N 160 HIS H2 H N N 161 HIS HA H N N 162 HIS HB2 H N N 163 HIS HB3 H N N 164 HIS HD1 H N N 165 HIS HD2 H N N 166 HIS HE1 H N N 167 HIS HE2 H N N 168 HIS HXT H N N 169 HOH O O N N 170 HOH H1 H N N 171 HOH H2 H N N 172 ILE N N N N 173 ILE CA C N S 174 ILE C C N N 175 ILE O O N N 176 ILE CB C N S 177 ILE CG1 C N N 178 ILE CG2 C N N 179 ILE CD1 C N N 180 ILE OXT O N N 181 ILE H H N N 182 ILE H2 H N N 183 ILE HA H N N 184 ILE HB H N N 185 ILE HG12 H N N 186 ILE HG13 H N N 187 ILE HG21 H N N 188 ILE HG22 H N N 189 ILE HG23 H N N 190 ILE HD11 H N N 191 ILE HD12 H N N 192 ILE HD13 H N N 193 ILE HXT H N N 194 LEU N N N N 195 LEU CA C N S 196 LEU C C N N 197 LEU O O N N 198 LEU CB C N N 199 LEU CG C N N 200 LEU CD1 C N N 201 LEU CD2 C N N 202 LEU OXT O N N 203 LEU H H N N 204 LEU H2 H N N 205 LEU HA H N N 206 LEU HB2 H N N 207 LEU HB3 H N N 208 LEU HG H N N 209 LEU HD11 H N N 210 LEU HD12 H N N 211 LEU HD13 H N N 212 LEU HD21 H N N 213 LEU HD22 H N N 214 LEU HD23 H N N 215 LEU HXT H N N 216 LYS N N N N 217 LYS CA C N S 218 LYS C C N N 219 LYS O O N N 220 LYS CB C N N 221 LYS CG C N N 222 LYS CD C N N 223 LYS CE C N N 224 LYS NZ N N N 225 LYS OXT O N N 226 LYS H H N N 227 LYS H2 H N N 228 LYS HA H N N 229 LYS HB2 H N N 230 LYS HB3 H N N 231 LYS HG2 H N N 232 LYS HG3 H N N 233 LYS HD2 H N N 234 LYS HD3 H N N 235 LYS HE2 H N N 236 LYS HE3 H N N 237 LYS HZ1 H N N 238 LYS HZ2 H N N 239 LYS HZ3 H N N 240 LYS HXT H N N 241 MET N N N N 242 MET CA C N S 243 MET C C N N 244 MET O O N N 245 MET CB C N N 246 MET CG C N N 247 MET SD S N N 248 MET CE C N N 249 MET OXT O N N 250 MET H H N N 251 MET H2 H N N 252 MET HA H N N 253 MET HB2 H N N 254 MET HB3 H N N 255 MET HG2 H N N 256 MET HG3 H N N 257 MET HE1 H N N 258 MET HE2 H N N 259 MET HE3 H N N 260 MET HXT H N N 261 PEG C1 C N N 262 PEG O1 O N N 263 PEG C2 C N N 264 PEG O2 O N N 265 PEG C3 C N N 266 PEG C4 C N N 267 PEG O4 O N N 268 PEG H11 H N N 269 PEG H12 H N N 270 PEG HO1 H N N 271 PEG H21 H N N 272 PEG H22 H N N 273 PEG H31 H N N 274 PEG H32 H N N 275 PEG H41 H N N 276 PEG H42 H N N 277 PEG HO4 H N N 278 PHE N N N N 279 PHE CA C N S 280 PHE C C N N 281 PHE O O N N 282 PHE CB C N N 283 PHE CG C Y N 284 PHE CD1 C Y N 285 PHE CD2 C Y N 286 PHE CE1 C Y N 287 PHE CE2 C Y N 288 PHE CZ C Y N 289 PHE OXT O N N 290 PHE H H N N 291 PHE H2 H N N 292 PHE HA H N N 293 PHE HB2 H N N 294 PHE HB3 H N N 295 PHE HD1 H N N 296 PHE HD2 H N N 297 PHE HE1 H N N 298 PHE HE2 H N N 299 PHE HZ H N N 300 PHE HXT H N N 301 PRO N N N N 302 PRO CA C N S 303 PRO C C N N 304 PRO O O N N 305 PRO CB C N N 306 PRO CG C N N 307 PRO CD C N N 308 PRO OXT O N N 309 PRO H H N N 310 PRO HA H N N 311 PRO HB2 H N N 312 PRO HB3 H N N 313 PRO HG2 H N N 314 PRO HG3 H N N 315 PRO HD2 H N N 316 PRO HD3 H N N 317 PRO HXT H N N 318 SER N N N N 319 SER CA C N S 320 SER C C N N 321 SER O O N N 322 SER CB C N N 323 SER OG O N N 324 SER OXT O N N 325 SER H H N N 326 SER H2 H N N 327 SER HA H N N 328 SER HB2 H N N 329 SER HB3 H N N 330 SER HG H N N 331 SER HXT H N N 332 THR N N N N 333 THR CA C N S 334 THR C C N N 335 THR O O N N 336 THR CB C N R 337 THR OG1 O N N 338 THR CG2 C N N 339 THR OXT O N N 340 THR H H N N 341 THR H2 H N N 342 THR HA H N N 343 THR HB H N N 344 THR HG1 H N N 345 THR HG21 H N N 346 THR HG22 H N N 347 THR HG23 H N N 348 THR HXT H N N 349 TRP N N N N 350 TRP CA C N S 351 TRP C C N N 352 TRP O O N N 353 TRP CB C N N 354 TRP CG C Y N 355 TRP CD1 C Y N 356 TRP CD2 C Y N 357 TRP NE1 N Y N 358 TRP CE2 C Y N 359 TRP CE3 C Y N 360 TRP CZ2 C Y N 361 TRP CZ3 C Y N 362 TRP CH2 C Y N 363 TRP OXT O N N 364 TRP H H N N 365 TRP H2 H N N 366 TRP HA H N N 367 TRP HB2 H N N 368 TRP HB3 H N N 369 TRP HD1 H N N 370 TRP HE1 H N N 371 TRP HE3 H N N 372 TRP HZ2 H N N 373 TRP HZ3 H N N 374 TRP HH2 H N N 375 TRP HXT H N N 376 TYR N N N N 377 TYR CA C N S 378 TYR C C N N 379 TYR O O N N 380 TYR CB C N N 381 TYR CG C Y N 382 TYR CD1 C Y N 383 TYR CD2 C Y N 384 TYR CE1 C Y N 385 TYR CE2 C Y N 386 TYR CZ C Y N 387 TYR OH O N N 388 TYR OXT O N N 389 TYR H H N N 390 TYR H2 H N N 391 TYR HA H N N 392 TYR HB2 H N N 393 TYR HB3 H N N 394 TYR HD1 H N N 395 TYR HD2 H N N 396 TYR HE1 H N N 397 TYR HE2 H N N 398 TYR HH H N N 399 TYR HXT H N N 400 VAL N N N N 401 VAL CA C N S 402 VAL C C N N 403 VAL O O N N 404 VAL CB C N N 405 VAL CG1 C N N 406 VAL CG2 C N N 407 VAL OXT O N N 408 VAL H H N N 409 VAL H2 H N N 410 VAL HA H N N 411 VAL HB H N N 412 VAL HG11 H N N 413 VAL HG12 H N N 414 VAL HG13 H N N 415 VAL HG21 H N N 416 VAL HG22 H N N 417 VAL HG23 H N N 418 VAL HXT H N N 419 ZN ZN ZN N N 420 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 EDO C1 O1 sing N N 83 EDO C1 C2 sing N N 84 EDO C1 H11 sing N N 85 EDO C1 H12 sing N N 86 EDO O1 HO1 sing N N 87 EDO C2 O2 sing N N 88 EDO C2 H21 sing N N 89 EDO C2 H22 sing N N 90 EDO O2 HO2 sing N N 91 GLN N CA sing N N 92 GLN N H sing N N 93 GLN N H2 sing N N 94 GLN CA C sing N N 95 GLN CA CB sing N N 96 GLN CA HA sing N N 97 GLN C O doub N N 98 GLN C OXT sing N N 99 GLN CB CG sing N N 100 GLN CB HB2 sing N N 101 GLN CB HB3 sing N N 102 GLN CG CD sing N N 103 GLN CG HG2 sing N N 104 GLN CG HG3 sing N N 105 GLN CD OE1 doub N N 106 GLN CD NE2 sing N N 107 GLN NE2 HE21 sing N N 108 GLN NE2 HE22 sing N N 109 GLN OXT HXT sing N N 110 GLU N CA sing N N 111 GLU N H sing N N 112 GLU N H2 sing N N 113 GLU CA C sing N N 114 GLU CA CB sing N N 115 GLU CA HA sing N N 116 GLU C O doub N N 117 GLU C OXT sing N N 118 GLU CB CG sing N N 119 GLU CB HB2 sing N N 120 GLU CB HB3 sing N N 121 GLU CG CD sing N N 122 GLU CG HG2 sing N N 123 GLU CG HG3 sing N N 124 GLU CD OE1 doub N N 125 GLU CD OE2 sing N N 126 GLU OE2 HE2 sing N N 127 GLU OXT HXT sing N N 128 GLY N CA sing N N 129 GLY N H sing N N 130 GLY N H2 sing N N 131 GLY CA C sing N N 132 GLY CA HA2 sing N N 133 GLY CA HA3 sing N N 134 GLY C O doub N N 135 GLY C OXT sing N N 136 GLY OXT HXT sing N N 137 HIS N CA sing N N 138 HIS N H sing N N 139 HIS N H2 sing N N 140 HIS CA C sing N N 141 HIS CA CB sing N N 142 HIS CA HA sing N N 143 HIS C O doub N N 144 HIS C OXT sing N N 145 HIS CB CG sing N N 146 HIS CB HB2 sing N N 147 HIS CB HB3 sing N N 148 HIS CG ND1 sing Y N 149 HIS CG CD2 doub Y N 150 HIS ND1 CE1 doub Y N 151 HIS ND1 HD1 sing N N 152 HIS CD2 NE2 sing Y N 153 HIS CD2 HD2 sing N N 154 HIS CE1 NE2 sing Y N 155 HIS CE1 HE1 sing N N 156 HIS NE2 HE2 sing N N 157 HIS OXT HXT sing N N 158 HOH O H1 sing N N 159 HOH O H2 sing N N 160 ILE N CA sing N N 161 ILE N H sing N N 162 ILE N H2 sing N N 163 ILE CA C sing N N 164 ILE CA CB sing N N 165 ILE CA HA sing N N 166 ILE C O doub N N 167 ILE C OXT sing N N 168 ILE CB CG1 sing N N 169 ILE CB CG2 sing N N 170 ILE CB HB sing N N 171 ILE CG1 CD1 sing N N 172 ILE CG1 HG12 sing N N 173 ILE CG1 HG13 sing N N 174 ILE CG2 HG21 sing N N 175 ILE CG2 HG22 sing N N 176 ILE CG2 HG23 sing N N 177 ILE CD1 HD11 sing N N 178 ILE CD1 HD12 sing N N 179 ILE CD1 HD13 sing N N 180 ILE OXT HXT sing N N 181 LEU N CA sing N N 182 LEU N H sing N N 183 LEU N H2 sing N N 184 LEU CA C sing N N 185 LEU CA CB sing N N 186 LEU CA HA sing N N 187 LEU C O doub N N 188 LEU C OXT sing N N 189 LEU CB CG sing N N 190 LEU CB HB2 sing N N 191 LEU CB HB3 sing N N 192 LEU CG CD1 sing N N 193 LEU CG CD2 sing N N 194 LEU CG HG sing N N 195 LEU CD1 HD11 sing N N 196 LEU CD1 HD12 sing N N 197 LEU CD1 HD13 sing N N 198 LEU CD2 HD21 sing N N 199 LEU CD2 HD22 sing N N 200 LEU CD2 HD23 sing N N 201 LEU OXT HXT sing N N 202 LYS N CA sing N N 203 LYS N H sing N N 204 LYS N H2 sing N N 205 LYS CA C sing N N 206 LYS CA CB sing N N 207 LYS CA HA sing N N 208 LYS C O doub N N 209 LYS C OXT sing N N 210 LYS CB CG sing N N 211 LYS CB HB2 sing N N 212 LYS CB HB3 sing N N 213 LYS CG CD sing N N 214 LYS CG HG2 sing N N 215 LYS CG HG3 sing N N 216 LYS CD CE sing N N 217 LYS CD HD2 sing N N 218 LYS CD HD3 sing N N 219 LYS CE NZ sing N N 220 LYS CE HE2 sing N N 221 LYS CE HE3 sing N N 222 LYS NZ HZ1 sing N N 223 LYS NZ HZ2 sing N N 224 LYS NZ HZ3 sing N N 225 LYS OXT HXT sing N N 226 MET N CA sing N N 227 MET N H sing N N 228 MET N H2 sing N N 229 MET CA C sing N N 230 MET CA CB sing N N 231 MET CA HA sing N N 232 MET C O doub N N 233 MET C OXT sing N N 234 MET CB CG sing N N 235 MET CB HB2 sing N N 236 MET CB HB3 sing N N 237 MET CG SD sing N N 238 MET CG HG2 sing N N 239 MET CG HG3 sing N N 240 MET SD CE sing N N 241 MET CE HE1 sing N N 242 MET CE HE2 sing N N 243 MET CE HE3 sing N N 244 MET OXT HXT sing N N 245 PEG C1 O1 sing N N 246 PEG C1 C2 sing N N 247 PEG C1 H11 sing N N 248 PEG C1 H12 sing N N 249 PEG O1 HO1 sing N N 250 PEG C2 O2 sing N N 251 PEG C2 H21 sing N N 252 PEG C2 H22 sing N N 253 PEG O2 C3 sing N N 254 PEG C3 C4 sing N N 255 PEG C3 H31 sing N N 256 PEG C3 H32 sing N N 257 PEG C4 O4 sing N N 258 PEG C4 H41 sing N N 259 PEG C4 H42 sing N N 260 PEG O4 HO4 sing N N 261 PHE N CA sing N N 262 PHE N H sing N N 263 PHE N H2 sing N N 264 PHE CA C sing N N 265 PHE CA CB sing N N 266 PHE CA HA sing N N 267 PHE C O doub N N 268 PHE C OXT sing N N 269 PHE CB CG sing N N 270 PHE CB HB2 sing N N 271 PHE CB HB3 sing N N 272 PHE CG CD1 doub Y N 273 PHE CG CD2 sing Y N 274 PHE CD1 CE1 sing Y N 275 PHE CD1 HD1 sing N N 276 PHE CD2 CE2 doub Y N 277 PHE CD2 HD2 sing N N 278 PHE CE1 CZ doub Y N 279 PHE CE1 HE1 sing N N 280 PHE CE2 CZ sing Y N 281 PHE CE2 HE2 sing N N 282 PHE CZ HZ sing N N 283 PHE OXT HXT sing N N 284 PRO N CA sing N N 285 PRO N CD sing N N 286 PRO N H sing N N 287 PRO CA C sing N N 288 PRO CA CB sing N N 289 PRO CA HA sing N N 290 PRO C O doub N N 291 PRO C OXT sing N N 292 PRO CB CG sing N N 293 PRO CB HB2 sing N N 294 PRO CB HB3 sing N N 295 PRO CG CD sing N N 296 PRO CG HG2 sing N N 297 PRO CG HG3 sing N N 298 PRO CD HD2 sing N N 299 PRO CD HD3 sing N N 300 PRO OXT HXT sing N N 301 SER N CA sing N N 302 SER N H sing N N 303 SER N H2 sing N N 304 SER CA C sing N N 305 SER CA CB sing N N 306 SER CA HA sing N N 307 SER C O doub N N 308 SER C OXT sing N N 309 SER CB OG sing N N 310 SER CB HB2 sing N N 311 SER CB HB3 sing N N 312 SER OG HG sing N N 313 SER OXT HXT sing N N 314 THR N CA sing N N 315 THR N H sing N N 316 THR N H2 sing N N 317 THR CA C sing N N 318 THR CA CB sing N N 319 THR CA HA sing N N 320 THR C O doub N N 321 THR C OXT sing N N 322 THR CB OG1 sing N N 323 THR CB CG2 sing N N 324 THR CB HB sing N N 325 THR OG1 HG1 sing N N 326 THR CG2 HG21 sing N N 327 THR CG2 HG22 sing N N 328 THR CG2 HG23 sing N N 329 THR OXT HXT sing N N 330 TRP N CA sing N N 331 TRP N H sing N N 332 TRP N H2 sing N N 333 TRP CA C sing N N 334 TRP CA CB sing N N 335 TRP CA HA sing N N 336 TRP C O doub N N 337 TRP C OXT sing N N 338 TRP CB CG sing N N 339 TRP CB HB2 sing N N 340 TRP CB HB3 sing N N 341 TRP CG CD1 doub Y N 342 TRP CG CD2 sing Y N 343 TRP CD1 NE1 sing Y N 344 TRP CD1 HD1 sing N N 345 TRP CD2 CE2 doub Y N 346 TRP CD2 CE3 sing Y N 347 TRP NE1 CE2 sing Y N 348 TRP NE1 HE1 sing N N 349 TRP CE2 CZ2 sing Y N 350 TRP CE3 CZ3 doub Y N 351 TRP CE3 HE3 sing N N 352 TRP CZ2 CH2 doub Y N 353 TRP CZ2 HZ2 sing N N 354 TRP CZ3 CH2 sing Y N 355 TRP CZ3 HZ3 sing N N 356 TRP CH2 HH2 sing N N 357 TRP OXT HXT sing N N 358 TYR N CA sing N N 359 TYR N H sing N N 360 TYR N H2 sing N N 361 TYR CA C sing N N 362 TYR CA CB sing N N 363 TYR CA HA sing N N 364 TYR C O doub N N 365 TYR C OXT sing N N 366 TYR CB CG sing N N 367 TYR CB HB2 sing N N 368 TYR CB HB3 sing N N 369 TYR CG CD1 doub Y N 370 TYR CG CD2 sing Y N 371 TYR CD1 CE1 sing Y N 372 TYR CD1 HD1 sing N N 373 TYR CD2 CE2 doub Y N 374 TYR CD2 HD2 sing N N 375 TYR CE1 CZ doub Y N 376 TYR CE1 HE1 sing N N 377 TYR CE2 CZ sing Y N 378 TYR CE2 HE2 sing N N 379 TYR CZ OH sing N N 380 TYR OH HH sing N N 381 TYR OXT HXT sing N N 382 VAL N CA sing N N 383 VAL N H sing N N 384 VAL N H2 sing N N 385 VAL CA C sing N N 386 VAL CA CB sing N N 387 VAL CA HA sing N N 388 VAL C O doub N N 389 VAL C OXT sing N N 390 VAL CB CG1 sing N N 391 VAL CB CG2 sing N N 392 VAL CB HB sing N N 393 VAL CG1 HG11 sing N N 394 VAL CG1 HG12 sing N N 395 VAL CG1 HG13 sing N N 396 VAL CG2 HG21 sing N N 397 VAL CG2 HG22 sing N N 398 VAL CG2 HG23 sing N N 399 VAL OXT HXT sing N N 400 # _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.details 'homology model' # _atom_sites.entry_id 5WPN _atom_sites.fract_transf_matrix[1][1] 0.005498 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.005498 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005498 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA CL H N O S ZN # loop_